| Basic Information | |
|---|---|
| Family ID | F041502 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 160 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MRQRMTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG |
| Number of Associated Samples | 130 |
| Number of Associated Scaffolds | 160 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 62.50 % |
| % of genes near scaffold ends (potentially truncated) | 25.62 % |
| % of genes from short scaffolds (< 2000 bps) | 88.12 % |
| Associated GOLD sequencing projects | 119 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.500 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (25.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.375 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) (40.625 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.48% β-sheet: 0.00% Coil/Unstructured: 53.52% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 160 Family Scaffolds |
|---|---|---|
| PF01795 | Methyltransf_5 | 53.12 |
| PF02381 | MraZ | 33.12 |
| PF14279 | HNH_5 | 8.75 |
| PF07726 | AAA_3 | 1.88 |
| PF03717 | PBP_dimer | 0.62 |
| PF00478 | IMPDH | 0.62 |
| PF14579 | HHH_6 | 0.62 |
| PF01844 | HNH | 0.62 |
| PF08245 | Mur_ligase_M | 0.62 |
| COG ID | Name | Functional Category | % Frequency in 160 Family Scaffolds |
|---|---|---|---|
| COG0275 | 16S rRNA C1402 N4-methylase RsmH | Translation, ribosomal structure and biogenesis [J] | 53.12 |
| COG2001 | MraZ, DNA-binding transcriptional regulator and inhibitor of RsmH methyltransferase activity | Translation, ribosomal structure and biogenesis [J] | 33.12 |
| COG0768 | Cell division protein FtsI, peptidoglycan transpeptidase (Penicillin-binding protein 2) | Cell cycle control, cell division, chromosome partitioning [D] | 0.62 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.50 % |
| Unclassified | root | N/A | 2.50 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352025|deepsgr__Contig_176951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 833 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c0849761 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
| 3300000443|F12B_10078509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2287 | Open in IMG/M |
| 3300000550|F24TB_10930553 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| 3300000858|JGI10213J12805_10581994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 538 | Open in IMG/M |
| 3300000858|JGI10213J12805_10966396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 540 | Open in IMG/M |
| 3300000955|JGI1027J12803_101988247 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
| 3300001431|F14TB_100116199 | Not Available | 514 | Open in IMG/M |
| 3300004114|Ga0062593_102798526 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300004463|Ga0063356_106259681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 510 | Open in IMG/M |
| 3300005161|Ga0066807_1001660 | All Organisms → cellular organisms → Bacteria | 1661 | Open in IMG/M |
| 3300005406|Ga0070703_10126050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 935 | Open in IMG/M |
| 3300005471|Ga0070698_100198827 | All Organisms → cellular organisms → Bacteria | 1940 | Open in IMG/M |
| 3300006058|Ga0075432_10295448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 671 | Open in IMG/M |
| 3300006572|Ga0074051_10014905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3602 | Open in IMG/M |
| 3300006576|Ga0074047_12056480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 555 | Open in IMG/M |
| 3300006844|Ga0075428_100274600 | All Organisms → cellular organisms → Bacteria | 1813 | Open in IMG/M |
| 3300006845|Ga0075421_100020835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8241 | Open in IMG/M |
| 3300006845|Ga0075421_102688134 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 515 | Open in IMG/M |
| 3300006847|Ga0075431_100219386 | All Organisms → cellular organisms → Bacteria | 1940 | Open in IMG/M |
| 3300006853|Ga0075420_100485061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1068 | Open in IMG/M |
| 3300006865|Ga0073934_10034625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4745 | Open in IMG/M |
| 3300006880|Ga0075429_100247609 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptococcaceae | 1560 | Open in IMG/M |
| 3300006880|Ga0075429_101039903 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300009100|Ga0075418_10027663 | All Organisms → cellular organisms → Bacteria | 6194 | Open in IMG/M |
| 3300009146|Ga0105091_10063931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1650 | Open in IMG/M |
| 3300009147|Ga0114129_11364409 | Not Available | 876 | Open in IMG/M |
| 3300009157|Ga0105092_10544714 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300009157|Ga0105092_10629562 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300009168|Ga0105104_10052862 | All Organisms → cellular organisms → Bacteria | 2211 | Open in IMG/M |
| 3300009168|Ga0105104_10286252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 904 | Open in IMG/M |
| 3300009801|Ga0105056_1039908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 633 | Open in IMG/M |
| 3300009804|Ga0105063_1039588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 639 | Open in IMG/M |
| 3300009810|Ga0105088_1020182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1039 | Open in IMG/M |
| 3300009810|Ga0105088_1022598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 990 | Open in IMG/M |
| 3300009811|Ga0105084_1004812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1875 | Open in IMG/M |
| 3300009811|Ga0105084_1093502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 563 | Open in IMG/M |
| 3300009814|Ga0105082_1024590 | Not Available | 931 | Open in IMG/M |
| 3300009816|Ga0105076_1073405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 640 | Open in IMG/M |
| 3300009817|Ga0105062_1007030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1690 | Open in IMG/M |
| 3300009818|Ga0105072_1006529 | All Organisms → cellular organisms → Bacteria | 1992 | Open in IMG/M |
| 3300009823|Ga0105078_1002782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1602 | Open in IMG/M |
| 3300010029|Ga0105074_1034913 | Not Available | 865 | Open in IMG/M |
| 3300010041|Ga0126312_10716182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 723 | Open in IMG/M |
| 3300010166|Ga0126306_10464527 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
| 3300010375|Ga0105239_10749316 | All Organisms → cellular organisms → Bacteria | 1118 | Open in IMG/M |
| 3300011000|Ga0138513_100006953 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1323 | Open in IMG/M |
| 3300011405|Ga0137340_1114462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 518 | Open in IMG/M |
| 3300011439|Ga0137432_1148391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 752 | Open in IMG/M |
| 3300011444|Ga0137463_1105997 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
| 3300012159|Ga0137344_1027214 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
| 3300012204|Ga0137374_10240810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1524 | Open in IMG/M |
| 3300012204|Ga0137374_10624494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 819 | Open in IMG/M |
| 3300012353|Ga0137367_11093036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 539 | Open in IMG/M |
| 3300012355|Ga0137369_10106170 | All Organisms → cellular organisms → Bacteria | 2295 | Open in IMG/M |
| 3300012355|Ga0137369_10165711 | All Organisms → cellular organisms → Bacteria | 1740 | Open in IMG/M |
| 3300012360|Ga0137375_10919238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 694 | Open in IMG/M |
| 3300012532|Ga0137373_10307964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1257 | Open in IMG/M |
| 3300012937|Ga0162653_100021352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 875 | Open in IMG/M |
| 3300015258|Ga0180093_1132751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 628 | Open in IMG/M |
| 3300017965|Ga0190266_10175889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 994 | Open in IMG/M |
| 3300017997|Ga0184610_1023900 | All Organisms → cellular organisms → Bacteria | 1669 | Open in IMG/M |
| 3300017997|Ga0184610_1031104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1498 | Open in IMG/M |
| 3300017997|Ga0184610_1071587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1060 | Open in IMG/M |
| 3300018028|Ga0184608_10000255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 13690 | Open in IMG/M |
| 3300018028|Ga0184608_10501904 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 519 | Open in IMG/M |
| 3300018031|Ga0184634_10049720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1729 | Open in IMG/M |
| 3300018031|Ga0184634_10067410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1514 | Open in IMG/M |
| 3300018051|Ga0184620_10022843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1574 | Open in IMG/M |
| 3300018052|Ga0184638_1229156 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300018056|Ga0184623_10068994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1625 | Open in IMG/M |
| 3300018063|Ga0184637_10109661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1700 | Open in IMG/M |
| 3300018071|Ga0184618_10048227 | All Organisms → cellular organisms → Bacteria | 1538 | Open in IMG/M |
| 3300018072|Ga0184635_10036183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1873 | Open in IMG/M |
| 3300018072|Ga0184635_10099197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1151 | Open in IMG/M |
| 3300018073|Ga0184624_10045198 | All Organisms → cellular organisms → Bacteria | 1763 | Open in IMG/M |
| 3300018073|Ga0184624_10380579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 629 | Open in IMG/M |
| 3300018074|Ga0184640_10062879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1557 | Open in IMG/M |
| 3300018076|Ga0184609_10103174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1283 | Open in IMG/M |
| 3300018078|Ga0184612_10503330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 591 | Open in IMG/M |
| 3300018079|Ga0184627_10031210 | All Organisms → cellular organisms → Bacteria | 2687 | Open in IMG/M |
| 3300018081|Ga0184625_10078415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1688 | Open in IMG/M |
| 3300018081|Ga0184625_10304710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 832 | Open in IMG/M |
| 3300018081|Ga0184625_10344662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 775 | Open in IMG/M |
| 3300018084|Ga0184629_10096630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1439 | Open in IMG/M |
| 3300018465|Ga0190269_10065667 | All Organisms → cellular organisms → Bacteria | 1702 | Open in IMG/M |
| 3300018465|Ga0190269_10073982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1615 | Open in IMG/M |
| 3300018465|Ga0190269_10825576 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300018466|Ga0190268_11700331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 562 | Open in IMG/M |
| 3300018469|Ga0190270_10142673 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1929 | Open in IMG/M |
| 3300018469|Ga0190270_10260492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1516 | Open in IMG/M |
| 3300018469|Ga0190270_10542211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1120 | Open in IMG/M |
| 3300018469|Ga0190270_11064813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 839 | Open in IMG/M |
| 3300018469|Ga0190270_12751817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 555 | Open in IMG/M |
| 3300018476|Ga0190274_11969448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 680 | Open in IMG/M |
| 3300018481|Ga0190271_10563611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1256 | Open in IMG/M |
| 3300019259|Ga0184646_1054436 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 533 | Open in IMG/M |
| 3300019259|Ga0184646_1386043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 682 | Open in IMG/M |
| 3300019263|Ga0184647_1347758 | All Organisms → cellular organisms → Bacteria | 1067 | Open in IMG/M |
| 3300019884|Ga0193741_1051145 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1066 | Open in IMG/M |
| 3300020003|Ga0193739_1015184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2013 | Open in IMG/M |
| 3300020003|Ga0193739_1016681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1915 | Open in IMG/M |
| 3300020005|Ga0193697_1026885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1435 | Open in IMG/M |
| 3300020005|Ga0193697_1147659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 524 | Open in IMG/M |
| 3300020009|Ga0193740_1053897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 624 | Open in IMG/M |
| 3300020016|Ga0193696_1018343 | All Organisms → cellular organisms → Bacteria | 1882 | Open in IMG/M |
| 3300020020|Ga0193738_1013328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2653 | Open in IMG/M |
| 3300020020|Ga0193738_1100938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 824 | Open in IMG/M |
| 3300021412|Ga0193736_1066075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 500 | Open in IMG/M |
| 3300021972|Ga0193737_1007601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1460 | Open in IMG/M |
| 3300022195|Ga0222625_1612926 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300022534|Ga0224452_1187940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 635 | Open in IMG/M |
| 3300022694|Ga0222623_10028624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2106 | Open in IMG/M |
| 3300025310|Ga0209172_10114596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1524 | Open in IMG/M |
| 3300025310|Ga0209172_10163666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1206 | Open in IMG/M |
| 3300025910|Ga0207684_10505312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1036 | Open in IMG/M |
| 3300025925|Ga0207650_10059052 | All Organisms → cellular organisms → Bacteria | 2858 | Open in IMG/M |
| 3300025961|Ga0207712_11565468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 591 | Open in IMG/M |
| 3300026535|Ga0256867_10244861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 646 | Open in IMG/M |
| 3300026763|Ga0207568_105082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 547 | Open in IMG/M |
| 3300027006|Ga0209896_1006886 | All Organisms → cellular organisms → Bacteria | 1190 | Open in IMG/M |
| 3300027056|Ga0209879_1043284 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300027277|Ga0209846_1001633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3932 | Open in IMG/M |
| 3300027324|Ga0209845_1010923 | All Organisms → cellular organisms → Bacteria | 1528 | Open in IMG/M |
| 3300027379|Ga0209842_1078150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 576 | Open in IMG/M |
| 3300027523|Ga0208890_1000002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 26757 | Open in IMG/M |
| 3300027577|Ga0209874_1041913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1216 | Open in IMG/M |
| 3300027650|Ga0256866_1007253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2736 | Open in IMG/M |
| 3300027657|Ga0256865_1162321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 588 | Open in IMG/M |
| 3300027675|Ga0209077_1068414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 974 | Open in IMG/M |
| 3300027695|Ga0209966_1122802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 596 | Open in IMG/M |
| 3300027722|Ga0209819_10205923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 685 | Open in IMG/M |
| 3300027743|Ga0209593_10037196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1906 | Open in IMG/M |
| 3300027909|Ga0209382_10528385 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1295 | Open in IMG/M |
| 3300027961|Ga0209853_1006714 | All Organisms → cellular organisms → Bacteria | 3569 | Open in IMG/M |
| 3300028380|Ga0268265_12591276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 513 | Open in IMG/M |
| 3300028596|Ga0247821_10743179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 643 | Open in IMG/M |
| 3300028707|Ga0307291_1042132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1088 | Open in IMG/M |
| 3300028715|Ga0307313_10076784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1002 | Open in IMG/M |
| 3300028717|Ga0307298_10178979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 621 | Open in IMG/M |
| 3300028771|Ga0307320_10018075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2537 | Open in IMG/M |
| 3300028771|Ga0307320_10478334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 503 | Open in IMG/M |
| 3300028784|Ga0307282_10638339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 516 | Open in IMG/M |
| 3300028791|Ga0307290_10224062 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300028799|Ga0307284_10166683 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300028878|Ga0307278_10089823 | All Organisms → cellular organisms → Bacteria | 1382 | Open in IMG/M |
| 3300030006|Ga0299907_10000340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 21846 | Open in IMG/M |
| 3300030336|Ga0247826_11607079 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300030592|Ga0247612_1149391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 576 | Open in IMG/M |
| 3300030600|Ga0247659_1144882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 581 | Open in IMG/M |
| 3300031114|Ga0308187_10396235 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 544 | Open in IMG/M |
| 3300031170|Ga0307498_10332405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 578 | Open in IMG/M |
| 3300031198|Ga0307500_10140541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 682 | Open in IMG/M |
| 3300031854|Ga0310904_11074150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 576 | Open in IMG/M |
| 3300031892|Ga0310893_10092502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1095 | Open in IMG/M |
| 3300032012|Ga0310902_10257383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1055 | Open in IMG/M |
| 3300034113|Ga0364937_011184 | All Organisms → cellular organisms → Bacteria | 1369 | Open in IMG/M |
| 3300034115|Ga0364945_0182078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 637 | Open in IMG/M |
| 3300034115|Ga0364945_0236994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 561 | Open in IMG/M |
| 3300034643|Ga0370545_063942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 741 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 25.00% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 15.00% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 11.88% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.88% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 5.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.38% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 3.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.12% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 2.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.50% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 1.88% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.88% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.88% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.25% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.25% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.25% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.25% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 1.25% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.25% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.62% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000443 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemly | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005161 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPA | Environmental | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006572 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006576 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009801 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 | Environmental | Open in IMG/M |
| 3300009804 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40 | Environmental | Open in IMG/M |
| 3300009810 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 | Environmental | Open in IMG/M |
| 3300009811 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 | Environmental | Open in IMG/M |
| 3300009814 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 | Environmental | Open in IMG/M |
| 3300009816 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 | Environmental | Open in IMG/M |
| 3300009817 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 | Environmental | Open in IMG/M |
| 3300009818 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 | Environmental | Open in IMG/M |
| 3300009823 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50 | Environmental | Open in IMG/M |
| 3300010029 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_10_20 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300011000 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015 | Environmental | Open in IMG/M |
| 3300011405 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT400_2 | Environmental | Open in IMG/M |
| 3300011439 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2 | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012159 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT500_2 | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012937 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t5i015 | Environmental | Open in IMG/M |
| 3300015258 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_1Da | Environmental | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019263 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019884 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2 | Environmental | Open in IMG/M |
| 3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
| 3300020005 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2 | Environmental | Open in IMG/M |
| 3300020009 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s1 | Environmental | Open in IMG/M |
| 3300020016 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1 | Environmental | Open in IMG/M |
| 3300020020 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1 | Environmental | Open in IMG/M |
| 3300021412 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2m1 | Environmental | Open in IMG/M |
| 3300021972 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2m2 | Environmental | Open in IMG/M |
| 3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300025310 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026535 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq) | Environmental | Open in IMG/M |
| 3300026763 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G08A4-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027006 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027056 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027277 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027324 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300027379 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027523 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes) | Environmental | Open in IMG/M |
| 3300027577 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027650 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 HiSeq | Environmental | Open in IMG/M |
| 3300027657 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 HiSeq | Environmental | Open in IMG/M |
| 3300027675 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027722 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027743 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027961 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028596 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14 | Environmental | Open in IMG/M |
| 3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300030592 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Ab1 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030600 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb12 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300034113 | Sediment microbial communities from East River floodplain, Colorado, United States - 7_s17 | Environmental | Open in IMG/M |
| 3300034115 | Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17 | Environmental | Open in IMG/M |
| 3300034643 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_120 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deepsgr_03007450 | 2199352025 | Soil | MSKEGLRGELRQSLSLIVMTAVTAATFLGLGLLTAHLLG |
| ICChiseqgaiiDRAFT_08497612 | 3300000033 | Soil | MKPRASKEALRGELRQSLSLIVMTAVTAATFLGLGLLTAHLLG* |
| F12B_100785092 | 3300000443 | Soil | MTPRASKEPLRGELRQSLSLIAMTAVTAATFLGLGLLAAHLLG* |
| F24TB_109305532 | 3300000550 | Soil | MNKEALRGELRQSLSLIVMTAVTAATFLGLGLLTAHLLG* |
| JGI10213J12805_105819942 | 3300000858 | Soil | MSQGMKQRTTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG* |
| JGI10213J12805_109663962 | 3300000858 | Soil | MKRGTSKEALRGELRQSLWLIAMTAATAATFLGFGLLTAHLLG* |
| JGI1027J12803_1019882472 | 3300000955 | Soil | MKPRASKEALRGELRQSLSLIAMTAVTAATFLGLGLLTAHLLG* |
| F14TB_1001161992 | 3300001431 | Soil | MTPRASKEPLRGELRQSLSLIAMTAVTAATFLGLGLLTAHLLG* |
| Ga0062593_1027985262 | 3300004114 | Soil | MKRGTSKEALRGEFRQSLSLIAMTAAAAATFLGFGLLTAHLLG* |
| Ga0063356_1062596812 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MSKEALRGELRQSLSLIVMTAVTAATFLGLGLLTAHLLG* |
| Ga0066807_10016603 | 3300005161 | Soil | MKQRASKKALRGELRQSLSLIAMTAATAATFLGLGLLTAHLLG* |
| Ga0070703_101260502 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MTPRASKESLRGELRQSLSLIAMTAVTAATFLGLGLLTAHLLG* |
| Ga0070698_1001988272 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MKPRASKGPLRAELRQRLSLISMTAVTAATFHGLGLLTAHLLG* |
| Ga0075432_102954481 | 3300006058 | Populus Rhizosphere | KPMSKEALRGELRQSLSLIVMTAVTAATFLGLGLLTAHLLG* |
| Ga0074051_100149052 | 3300006572 | Soil | MKQRASKEALRGELRQSLSLIAMTAATAATFLGLGLLTAHLLG* |
| Ga0074047_120564802 | 3300006576 | Soil | MKQMASREGLRGELRQSLSLITMTAVTAATFLGLGLLTAHLLG* |
| Ga0075428_1002746001 | 3300006844 | Populus Rhizosphere | GRLPGRHARTGGQGMSQGMSQGMSQGMSQGMSQGMRQRTTKGTLRGELRQSLSLIAMTALTAATFLGLGLITAHLLG* |
| Ga0075421_1000208352 | 3300006845 | Populus Rhizosphere | MSQGMSQGMSQGTSHMTTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG* |
| Ga0075421_1026881342 | 3300006845 | Populus Rhizosphere | MKPRASKEPLRGELRQSLSLIAMTAVTAATFLGLGLLAAHLLG* |
| Ga0075431_1002193862 | 3300006847 | Populus Rhizosphere | MSQGMSQGMRQRTTKGTLRGELRQSLSLIAMTALTAATFLGLGLITAHLLG* |
| Ga0075420_1004850613 | 3300006853 | Populus Rhizosphere | MSQGTSHMTTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG* |
| Ga0073934_100346256 | 3300006865 | Hot Spring Sediment | MSQGMSQGMSQGMRQRMTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG* |
| Ga0075429_1002476092 | 3300006880 | Populus Rhizosphere | MSQGMRQRTTKGTLPGELRQSLQLIAMTALTAATFLGLGLFTAHLLG* |
| Ga0075429_1010399032 | 3300006880 | Populus Rhizosphere | MKPRASKEPLRGELRQSLSLIAMTAVTAATFLGLGLVTAHLLG* |
| Ga0075418_100276636 | 3300009100 | Populus Rhizosphere | MTTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG* |
| Ga0105091_100639311 | 3300009146 | Freshwater Sediment | GQGMSQGMSQGMRQRMTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG* |
| Ga0114129_113644092 | 3300009147 | Populus Rhizosphere | QGMRQRTTKGTLPGELRQSLQLIAMTALTAATFLGLGLFTAHLLS* |
| Ga0105092_105447142 | 3300009157 | Freshwater Sediment | MRQRMTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG* |
| Ga0105092_106295622 | 3300009157 | Freshwater Sediment | MRQRTTKGTLSGELRQSLSLIAMTALTAATFLGLGLITARLLG* |
| Ga0105104_100528622 | 3300009168 | Freshwater Sediment | MRQRTTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG* |
| Ga0105104_102862522 | 3300009168 | Freshwater Sediment | MKPRASKEPLRGELRQSLSLIAMTAMTAATFLGLGLLTAHLLG* |
| Ga0105056_10399082 | 3300009801 | Groundwater Sand | MKPRASKEALRGELRQSLSLIAMTAVTAATFLGLGLLAAHLLG* |
| Ga0105063_10395882 | 3300009804 | Groundwater Sand | MNQRRTKGTLPGELRQSLALIAMTALTAASFLGLGLITAHLLG* |
| Ga0105088_10201823 | 3300009810 | Groundwater Sand | MRQRMTKGTLPGELRQSLSMIAMTALTAATFLGLGLITAHLLG* |
| Ga0105088_10225982 | 3300009810 | Groundwater Sand | KHAVRGGLGRTLSPIAMTAVTASVFLGLGPLTAHLPG* |
| Ga0105084_10048123 | 3300009811 | Groundwater Sand | MRQRMTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAQLLG* |
| Ga0105084_10935022 | 3300009811 | Groundwater Sand | MKRTSKEALRGELRQSLWLIAMTAATAATFLGFGLLTAHLLG* |
| Ga0105082_10245901 | 3300009814 | Groundwater Sand | GRNARTGGQGMSQGMNQRRTKGTLPGELRQSLSLIAMTALTAASFPGLGLITAHLLG* |
| Ga0105076_10734052 | 3300009816 | Groundwater Sand | MRQRMTKGTLPGELRQSLSLIAMTALTAASFPGLGLITAHLLG* |
| Ga0105062_10070303 | 3300009817 | Groundwater Sand | MKRGTSKEAQRSELRQSLSLIAMTAAAVIAFLGFGPLTAHLLG* |
| Ga0105072_10065292 | 3300009818 | Groundwater Sand | MSQGTTKGTLPGELRQSLSLIAMTALTAASFLGLGLITAHLLG* |
| Ga0105078_10027822 | 3300009823 | Groundwater Sand | MKPRASKEALRGELRQSLWLIAMTAATAATFLGFGLLTAHLLG* |
| Ga0105074_10349131 | 3300010029 | Groundwater Sand | SQEMSQEMSQETRQRMTKGTLSGELRQSLSLIAMTALTAATFLGLGLITAHLLG* |
| Ga0126312_107161822 | 3300010041 | Serpentine Soil | MNQGMGTGTTQAPLRGELRQSLSLIAMTAVTAATFLGLGLITAHLLG* |
| Ga0126306_104645272 | 3300010166 | Serpentine Soil | MSQRTTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG* |
| Ga0105239_107493162 | 3300010375 | Corn Rhizosphere | MSKEALRGELRQSLSLIVMTAVTAAMFLGLGLLTAHLLG* |
| Ga0138513_1000069534 | 3300011000 | Soil | MKPRASKEPLRGELCQSLSLIAMTAVTAATFLGLGLLTAHLLG* |
| Ga0137340_11144622 | 3300011405 | Soil | MSQGTKQRMREGTLPGELRQSLSLIAMTALAAATFLGLGLITAHLLG* |
| Ga0137432_11483912 | 3300011439 | Soil | MEQRMRQGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG* |
| Ga0137463_11059972 | 3300011444 | Soil | MSKEALRGELRQSLSLIVMTAVTAATFLGIGLLTAHLLG* |
| Ga0137344_10272141 | 3300012159 | Soil | GTKQRMREGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG* |
| Ga0137374_102408102 | 3300012204 | Vadose Zone Soil | MKPGASKEPLRGELRQSLSLIAMTAVTAATFLGLGLLTAHLLG* |
| Ga0137374_106244941 | 3300012204 | Vadose Zone Soil | MKQKVCKEALRGELRRSLSLIRMTAVTVATFLGLGVLTAHVLG* |
| Ga0137367_110930362 | 3300012353 | Vadose Zone Soil | MKQKVCKEALRGELRQSLSLIGMTAVTAATFLGLGVLTAHLLG* |
| Ga0137369_101061704 | 3300012355 | Vadose Zone Soil | MSKEALRGELRQSLSLIVVTAATAATFLGLGLLTAHLLG* |
| Ga0137369_101657112 | 3300012355 | Vadose Zone Soil | MKPRASKEPLRGELRQSLSLIAMTAVTAATFLGLGLLTAHLLG* |
| Ga0137375_109192382 | 3300012360 | Vadose Zone Soil | MSREALRGELRQSLSLIVVTAATAATFLGLGLLTAHLLG |
| Ga0137373_103079642 | 3300012532 | Vadose Zone Soil | MKQKVSKEALRGELRQSLSLIGMTAVTAATFLGLGVLTAHLLG* |
| Ga0162653_1000213522 | 3300012937 | Soil | MKRGTSKEALHGEPRQSLSLIAMAAVTAATFLGFGLLTARLLG* |
| Ga0180093_11327511 | 3300015258 | Soil | GMSQRMTKVTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG* |
| Ga0190266_101758891 | 3300017965 | Soil | MSQGMSQGMSQGMSQGMSQGMSQRTTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG |
| Ga0184610_10239003 | 3300017997 | Groundwater Sediment | MKPRASKEPLRGELRQSLSLIAMTAVTAATFLGLGLLTAHLLG |
| Ga0184610_10311042 | 3300017997 | Groundwater Sediment | MSQGMQQRMTKGTLPGELSQSLSLIAMTALTAATFLGLGLISAQLLG |
| Ga0184610_10715872 | 3300017997 | Groundwater Sediment | MSQGTKQRMREGTLPGELRQSLSLIAMTAMTAATFLGLGLITAHLLG |
| Ga0184608_100002553 | 3300018028 | Groundwater Sediment | MSQGMSQGMSQGMSQGVSQGVRQRMTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG |
| Ga0184608_105019042 | 3300018028 | Groundwater Sediment | MKRGTSKEALRGELRQSLSLIAMTAAAAATFLGFGLLTA |
| Ga0184634_100497203 | 3300018031 | Groundwater Sediment | LSQEVRQRMTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG |
| Ga0184634_100674103 | 3300018031 | Groundwater Sediment | MKPGASKEPLRGELRQSLSLIAMTAVTAATFLGLGLLTAHLLG |
| Ga0184620_100228433 | 3300018051 | Groundwater Sediment | MKPRASKEPLRGELRQSLSLIAMAAVTAATFLGFGLLTARLLG |
| Ga0184638_12291562 | 3300018052 | Groundwater Sediment | MSQGMSQGIGMRQRMTKGTLPGELRQSLSLIAMTALTAAMFLGLGLITAHLLG |
| Ga0184623_100689943 | 3300018056 | Groundwater Sediment | MSQGMQQRMTKGTLPGELSQGLSLIAMTALTAATFLGLGLISAQLLG |
| Ga0184637_101096612 | 3300018063 | Groundwater Sediment | MSQGMSQGMSQGMSQGMSQGMSQGIGMRQRMTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG |
| Ga0184618_100482272 | 3300018071 | Groundwater Sediment | MKPGASKEALRGELRQSLSLIAMTAVTAATFLGLGLLTAHLLG |
| Ga0184635_100361832 | 3300018072 | Groundwater Sediment | MSQGIGMRQRMTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG |
| Ga0184635_100991971 | 3300018072 | Groundwater Sediment | MKPGASKEPLRGELRQSLSLIAMTAVTAATFLGLGLLTAHL |
| Ga0184624_100451982 | 3300018073 | Groundwater Sediment | MKRGTSKEALHGEPRQSLSLIAMAAVTAATFLGFGLLTARLLG |
| Ga0184624_103805792 | 3300018073 | Groundwater Sediment | MSKEALRGELRQSLSLIVMTAVTAATFLGFGLLTARLLG |
| Ga0184640_100628793 | 3300018074 | Groundwater Sediment | MSQGMSQGIGMRQRMTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG |
| Ga0184609_101031742 | 3300018076 | Groundwater Sediment | MKPGASKAPLRGELRQSLSLIAMTAVTAATFLGLGLLTAHLLG |
| Ga0184612_105033302 | 3300018078 | Groundwater Sediment | MSQGMRQRMTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG |
| Ga0184627_100312104 | 3300018079 | Groundwater Sediment | MSQGTKQRMRKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG |
| Ga0184625_100784152 | 3300018081 | Groundwater Sediment | MKQRGTSKEALHGEPRQSLSLIAMAAVTAATFLGFGLLTARLLG |
| Ga0184625_103047101 | 3300018081 | Groundwater Sediment | MSQGMSQGIGMRQRMTKGTLPGELSQSLSLIAMTALTADTFLGLGLISAQLL |
| Ga0184625_103446621 | 3300018081 | Groundwater Sediment | QGMSQGMQQRIPKGTLPGELSQSLSLIAMTAATFLGLGLISAQLLG |
| Ga0184629_100966302 | 3300018084 | Groundwater Sediment | MSQGMSQGMSQGVRQRMTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG |
| Ga0190269_100656672 | 3300018465 | Soil | MSEGMQERMTKGTLSGELRQSLSLIAMTALTAGTFLGLGLITAQLLG |
| Ga0190269_100739822 | 3300018465 | Soil | MKRRASKEPLRGELRQSLSLIAMTAVTAATFLGLGLLTAHLLG |
| Ga0190269_108255762 | 3300018465 | Soil | MKRGTSKEAQRGELRQSLSLIAMTAAAAATFLGFGPLTAHLLG |
| Ga0190268_117003312 | 3300018466 | Soil | MKERTTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG |
| Ga0190270_101426732 | 3300018469 | Soil | MKPSASKEPLRGELRQSLSLIVMTAVTAATFLGLGLLTAHLLG |
| Ga0190270_102604923 | 3300018469 | Soil | MSQGTSQGMSQGTSQGTSQGTSQGMTKGTLPGELRQSLSLIAMTALTAATFLGLGLITARLLG |
| Ga0190270_105422111 | 3300018469 | Soil | MSQGMSQGMSQGMTKGTLPGELRQSLSLIAMTALTAATFMGLGLITARMLR |
| Ga0190270_110648132 | 3300018469 | Soil | MTKEALRGELRQSLSLIVMTAVTAATFLGLGLLTAYLLG |
| Ga0190270_127518172 | 3300018469 | Soil | MSEGMQERMTKGTLSGELRQSLSLIAMTALTAGTFLGLGLTTAQLLG |
| Ga0190274_119694482 | 3300018476 | Soil | MSQGMSQRTTKGTLPGELRQSLSLIAMTALTAATFLGLGLITARLLG |
| Ga0190271_105636112 | 3300018481 | Soil | MSQGMSQGMSQGMRQRTTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG |
| Ga0184646_10544362 | 3300019259 | Groundwater Sediment | QGMSQGMSQGMRQRMTKGTLPRELGQSLSLIAMTGLTAATFLGLGLITAHLLG |
| Ga0184646_13860431 | 3300019259 | Groundwater Sediment | MSQGMSQGMTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG |
| Ga0184647_13477582 | 3300019263 | Groundwater Sediment | MNKEALRGELRQSLSLIVMTAVTAATFLGLGLLTAHLLG |
| Ga0193741_10511452 | 3300019884 | Soil | EPRDEPRDEGMKGRTTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG |
| Ga0193739_10151842 | 3300020003 | Soil | MSQGMSQGMSQGMSQGIGMRQRMTKGTLPGELRQSLSLIAMTALTAATFLGLGLITARLL |
| Ga0193739_10166812 | 3300020003 | Soil | MSQGMKQRMTNRTLPGELRQSFSLIAMTALTAATFLGLGLITAHLLG |
| Ga0193697_10268851 | 3300020005 | Soil | ARTGGQGMSQGMQQRMTKGTLAGELSQSLSLIAMTALTAATFLGLGLISAQLLG |
| Ga0193697_11476591 | 3300020005 | Soil | ARTGGKGMKRGTSKEALHGEPRQSLSLIAMAAVTAATFLGFGLLTARLLG |
| Ga0193740_10538971 | 3300020009 | Soil | TKGTLPRELGQSLSLIAMTGLTAATFLGLGLITAHLLG |
| Ga0193696_10183432 | 3300020016 | Soil | MSKEALRGELRQSLSLIVMTAVTAATFLGLGLLTAHLLG |
| Ga0193738_10133284 | 3300020020 | Soil | MTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG |
| Ga0193738_11009381 | 3300020020 | Soil | HARTGGQGMSQGIGMRQRMTKGTLPGELRQSLSLIAMTALTAATFLGLGLITARLLG |
| Ga0193736_10660752 | 3300021412 | Soil | MSQGMSQGIGMRQRMTKGTLPGELRQSLSLIAMTALTAATFLGLGLITARL |
| Ga0193737_10076013 | 3300021972 | Soil | QGIGMRQRMTKGTLPGELRQSLSLIAMTALTAATFLGLGLITARLLG |
| Ga0222625_16129262 | 3300022195 | Groundwater Sediment | MSQGMSQKMTNGRLPRELGQSLSLIAMTALTAATFLGLGLITAHLLG |
| Ga0224452_11879402 | 3300022534 | Groundwater Sediment | MSQGMSQGVRQRMTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG |
| Ga0222623_100286242 | 3300022694 | Groundwater Sediment | MSQGMQQRIPKGTLPGELSQSLSLIAMTALTAATFLGLGLISAQLLG |
| Ga0209172_101145962 | 3300025310 | Hot Spring Sediment | VKGSLSTEVRQSLSLIAMTAVATATYLGLALLLAHVLG |
| Ga0209172_101636662 | 3300025310 | Hot Spring Sediment | MSQGMSQGMSQGMRQRMTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG |
| Ga0207684_105053122 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | EGKPMSKEALRGELRQSLSLIVMTAVTAATFLGLGLLTAHLLG |
| Ga0207650_100590522 | 3300025925 | Switchgrass Rhizosphere | MTPRASKESLRGELRQSLSLIAMTAVTAATFLGLGLLTAHLLG |
| Ga0207712_115654682 | 3300025961 | Switchgrass Rhizosphere | MKPRASKEPLHGELRQSLSLIAMTAVTAATFLGLGLLAAHLLG |
| Ga0256867_102448612 | 3300026535 | Soil | MSQGMSQGMKGRTTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG |
| Ga0207568_1050821 | 3300026763 | Soil | MKPRASKEPLRGELRQSLSLIAMTAMTAATFLGLGLLTAHLLG |
| Ga0209896_10068862 | 3300027006 | Groundwater Sand | MKPRASKEALRGELRQSLSLIAMTAVTAATFLGLGLLTAHLLG |
| Ga0209879_10432842 | 3300027056 | Groundwater Sand | MKRTSKEALRGELRQSLWLIAMTAATAATFLGFGLLTAHLLG |
| Ga0209846_10016335 | 3300027277 | Groundwater Sand | MSQGMRQRMTKGTLPGELRQSLSMIAMTALTAATFLGLGLITAHLLG |
| Ga0209845_10109232 | 3300027324 | Groundwater Sand | MTKGTLPGELRQSLSMIAMTALTAATFLGLGLITAHLLG |
| Ga0209842_10781502 | 3300027379 | Groundwater Sand | MKRGTSKEAQRSELRQSLSLIAMTAAAAAAFLGFGPLTAHLLG |
| Ga0208890_100000217 | 3300027523 | Soil | MKQRASKEALRGELRQSLSLIAMTAATAATFLGLGLLTAHLLG |
| Ga0209874_10419131 | 3300027577 | Groundwater Sand | MSQGMRQRMTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHL |
| Ga0256866_10072534 | 3300027650 | Soil | MSQGMKGRTTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG |
| Ga0256865_11623212 | 3300027657 | Soil | MSQGMSQGMSQGMSQRMTKGTLPRELGQSLSLIAMTALTAATFLGLGLITAHLLG |
| Ga0209077_10684141 | 3300027675 | Freshwater Sediment | GQGMSQGMSQGMSQGMSQRTTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG |
| Ga0209966_11228021 | 3300027695 | Arabidopsis Thaliana Rhizosphere | MKPRAGKEALRGELRQSLSLIAMTAVTAATFLGLGLVTAHLL |
| Ga0209819_102059232 | 3300027722 | Freshwater Sediment | MKRGTSKEALRGELRQSLWLIAMTAATAATFLGFGLLTAHLLG |
| Ga0209593_100371964 | 3300027743 | Freshwater Sediment | MSQGMSQGMSQGMSQGMSQGMRQRTTKGTLPGELRQSLSLIAVIALTAATFLGLGLITAHLLG |
| Ga0209382_105283853 | 3300027909 | Populus Rhizosphere | MSQGMSQGMRQRTTKGTLRGELRQSLSLIAMTALTAATFLGLGLITAHLLG |
| Ga0209853_10067142 | 3300027961 | Groundwater Sand | MRRRVSKHAVRGGLRRTLSPIAMTAVTASVFLGLGPLTAHLLG |
| Ga0268265_125912762 | 3300028380 | Switchgrass Rhizosphere | ALRGELRQSLSLIVMTAVTAATFLGLGLLTAHLLG |
| Ga0247821_107431792 | 3300028596 | Soil | MSKEALRGELRQSLSLIVMTAVTAATFLGLGLLTAYLLG |
| Ga0307291_10421322 | 3300028707 | Soil | GMKPGASKAPLRGELRQSLSLIAMTAVTAATFLGLGLLTAHLLG |
| Ga0307313_100767842 | 3300028715 | Soil | KPRASKEPLRGELRQSLSLIAMTAVTAATFLGLGLLTAHLLG |
| Ga0307298_101789791 | 3300028717 | Soil | ASKEPLRGELRQSLSLIAMTAVTAATFLGLGLLTAHLLG |
| Ga0307320_100180752 | 3300028771 | Soil | MKQKASREALSGELRQSLSLIAVTAVTASTFLGLGLLTAHLLG |
| Ga0307320_104783341 | 3300028771 | Soil | MSQGMSQGMSQGMSQGVSQGVRQRMTKGTLPGELRQSLSLIAMTALTAATFL |
| Ga0307282_106383392 | 3300028784 | Soil | MSKEALRGELRQSLSLIVMTAVTAATFLGIGLLTAHLLG |
| Ga0307290_102240622 | 3300028791 | Soil | MSQGMSQGVRQRMTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHL |
| Ga0307284_101666832 | 3300028799 | Soil | MKQRASKEALRGELRQSLSLIAMTAVTAATFLGLGLLTAHLLG |
| Ga0307278_100898232 | 3300028878 | Soil | MKPRASKAPLRGELRQSLSLIAMTAVTAATFLGLGLLTAHLLG |
| Ga0299907_1000034019 | 3300030006 | Soil | MSQGMSQGMSQGMKGRTTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG |
| Ga0247826_116070792 | 3300030336 | Soil | MKPRASKEALRGELRQSLSLIAMTAVTAATFLGLGLVTAHLLG |
| Ga0247612_11493912 | 3300030592 | Soil | TTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG |
| Ga0247659_11448822 | 3300030600 | Soil | GMSQGMSQRTTKGTLPGELRQSLSLIAMTALTAATFLGLGLITARLLG |
| Ga0308187_103962351 | 3300031114 | Soil | MKPGASKAPLRGELRQSLSLIAMTAVTAATFLGLG |
| Ga0307498_103324052 | 3300031170 | Soil | RDEGMPMNKGALRGELRQSLSLIVMTAVTAATFLGLGLLTAHLLG |
| Ga0307500_101405411 | 3300031198 | Soil | RPMNKEALRGELRQSLSLIVMTAVTAATFLGLGLLTAHLLG |
| Ga0310904_110741501 | 3300031854 | Soil | RSHPEPRDRPRDEPRDEPRDEEEAMSKEALRGELRQSLSLIVMTAVTAATFLGLGLLTAHLLG |
| Ga0310893_100925021 | 3300031892 | Soil | KEALRGELRQSLSLIVMTAVTAATFLGLGLLTAHLLG |
| Ga0310902_102573832 | 3300032012 | Soil | AMSKEALRGELRQSLSLIVMTAVTAATFLGLGLLTAHLLG |
| Ga0364937_011184_908_1039 | 3300034113 | Sediment | MRQRMTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG |
| Ga0364945_0182078_313_516 | 3300034115 | Sediment | MSEGMSEGMSQGMSEGMSEGMSQGMSQRMTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG |
| Ga0364945_0236994_105_236 | 3300034115 | Sediment | MRQRMTKGTLPGELRQSLSLIAITALTAATFLGLGLITAHLLG |
| Ga0370545_063942_151_270 | 3300034643 | Soil | VSKEALRGELRQSLSLIVMTAVTAATFLGLGLLTAHLLG |
| ⦗Top⦘ |