| Basic Information | |
|---|---|
| Family ID | F041450 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 160 |
| Average Sequence Length | 44 residues |
| Representative Sequence | ALAAGHATQAQALLRQALEIFQRIGAAEAPDLRAELDALTGPPPAR |
| Number of Associated Samples | 127 |
| Number of Associated Scaffolds | 160 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.89 % |
| % of genes near scaffold ends (potentially truncated) | 94.38 % |
| % of genes from short scaffolds (< 2000 bps) | 90.00 % |
| Associated GOLD sequencing projects | 119 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.69 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (58.125 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (36.875 % of family members) |
| Environment Ontology (ENVO) | Unclassified (41.250 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.250 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.70% β-sheet: 0.00% Coil/Unstructured: 47.30% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.69 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 160 Family Scaffolds |
|---|---|---|
| PF00126 | HTH_1 | 6.25 |
| PF02776 | TPP_enzyme_N | 2.50 |
| PF02678 | Pirin | 2.50 |
| PF00230 | MIP | 1.88 |
| PF13560 | HTH_31 | 1.88 |
| PF00999 | Na_H_Exchanger | 1.88 |
| PF07690 | MFS_1 | 1.88 |
| PF02653 | BPD_transp_2 | 1.88 |
| PF13424 | TPR_12 | 1.25 |
| PF03625 | DUF302 | 1.25 |
| PF12697 | Abhydrolase_6 | 1.25 |
| PF00498 | FHA | 1.25 |
| PF00589 | Phage_integrase | 1.25 |
| PF01243 | Putative_PNPOx | 1.25 |
| PF02635 | DrsE | 1.25 |
| PF12724 | Flavodoxin_5 | 0.62 |
| PF03466 | LysR_substrate | 0.62 |
| PF01467 | CTP_transf_like | 0.62 |
| PF07286 | D-Glu_cyclase | 0.62 |
| PF01695 | IstB_IS21 | 0.62 |
| PF01027 | Bax1-I | 0.62 |
| PF02784 | Orn_Arg_deC_N | 0.62 |
| PF02152 | FolB | 0.62 |
| PF07702 | UTRA | 0.62 |
| PF01610 | DDE_Tnp_ISL3 | 0.62 |
| PF13683 | rve_3 | 0.62 |
| PF12840 | HTH_20 | 0.62 |
| PF13487 | HD_5 | 0.62 |
| PF08241 | Methyltransf_11 | 0.62 |
| PF13367 | PrsW-protease | 0.62 |
| PF12708 | Pectate_lyase_3 | 0.62 |
| PF13378 | MR_MLE_C | 0.62 |
| PF00383 | dCMP_cyt_deam_1 | 0.62 |
| PF02604 | PhdYeFM_antitox | 0.62 |
| PF13561 | adh_short_C2 | 0.62 |
| PF00583 | Acetyltransf_1 | 0.62 |
| PF08281 | Sigma70_r4_2 | 0.62 |
| PF12695 | Abhydrolase_5 | 0.62 |
| PF12680 | SnoaL_2 | 0.62 |
| PF07859 | Abhydrolase_3 | 0.62 |
| PF00440 | TetR_N | 0.62 |
| PF03069 | FmdA_AmdA | 0.62 |
| PF13602 | ADH_zinc_N_2 | 0.62 |
| PF02771 | Acyl-CoA_dh_N | 0.62 |
| PF07992 | Pyr_redox_2 | 0.62 |
| PF01494 | FAD_binding_3 | 0.62 |
| PF00392 | GntR | 0.62 |
| PF08327 | AHSA1 | 0.62 |
| PF12146 | Hydrolase_4 | 0.62 |
| COG ID | Name | Functional Category | % Frequency in 160 Family Scaffolds |
|---|---|---|---|
| COG1741 | Redox-sensitive bicupin YhaK, pirin superfamily | General function prediction only [R] | 2.50 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 1.88 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 1.88 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 1.88 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 1.88 |
| COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 1.88 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 1.88 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.25 |
| COG3439 | Uncharacterized conserved protein, DUF302 family | Function unknown [S] | 1.25 |
| COG0019 | Diaminopimelate decarboxylase | Amino acid transport and metabolism [E] | 0.62 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.62 |
| COG4336 | Uncharacterized conserved protein YcsI, UPF0317/DUF1446 family | Function unknown [S] | 0.62 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.62 |
| COG3464 | Transposase | Mobilome: prophages, transposons [X] | 0.62 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.62 |
| COG2421 | Acetamidase/formamidase | Energy production and conversion [C] | 0.62 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.62 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.62 |
| COG1539 | Dihydroneopterin aldolase | Coenzyme transport and metabolism [H] | 0.62 |
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.62 |
| COG1166 | Arginine decarboxylase (spermidine biosynthesis) | Amino acid transport and metabolism [E] | 0.62 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.62 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.62 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 58.12 % |
| Unclassified | root | N/A | 41.88 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001356|JGI12269J14319_10076642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1806 | Open in IMG/M |
| 3300001356|JGI12269J14319_10223989 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 719 | Open in IMG/M |
| 3300001614|JGI20249J16330_100863 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300004082|Ga0062384_100984920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes | 602 | Open in IMG/M |
| 3300004091|Ga0062387_100445692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 887 | Open in IMG/M |
| 3300004092|Ga0062389_103524351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes globisporus | 587 | Open in IMG/M |
| 3300005435|Ga0070714_102079169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 553 | Open in IMG/M |
| 3300005439|Ga0070711_100525936 | Not Available | 978 | Open in IMG/M |
| 3300005439|Ga0070711_101612244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 567 | Open in IMG/M |
| 3300005537|Ga0070730_10514925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 767 | Open in IMG/M |
| 3300005712|Ga0070764_10861369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 566 | Open in IMG/M |
| 3300005764|Ga0066903_104999740 | Not Available | 703 | Open in IMG/M |
| 3300005764|Ga0066903_108076263 | Not Available | 539 | Open in IMG/M |
| 3300006028|Ga0070717_10394067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1243 | Open in IMG/M |
| 3300006086|Ga0075019_10737422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 625 | Open in IMG/M |
| 3300006163|Ga0070715_10788154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 576 | Open in IMG/M |
| 3300006176|Ga0070765_100129984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2221 | Open in IMG/M |
| 3300006881|Ga0068865_102193720 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300009520|Ga0116214_1233082 | Not Available | 697 | Open in IMG/M |
| 3300010048|Ga0126373_10063597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3313 | Open in IMG/M |
| 3300010048|Ga0126373_10464095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis | 1303 | Open in IMG/M |
| 3300010048|Ga0126373_12142093 | Not Available | 621 | Open in IMG/M |
| 3300010048|Ga0126373_12543649 | Not Available | 571 | Open in IMG/M |
| 3300010361|Ga0126378_13345742 | Not Available | 509 | Open in IMG/M |
| 3300010366|Ga0126379_13558641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 522 | Open in IMG/M |
| 3300010371|Ga0134125_12174928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 603 | Open in IMG/M |
| 3300010376|Ga0126381_104997552 | Not Available | 509 | Open in IMG/M |
| 3300010379|Ga0136449_104406182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 519 | Open in IMG/M |
| 3300010398|Ga0126383_12988676 | Not Available | 552 | Open in IMG/M |
| 3300010403|Ga0134123_12576683 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 575 | Open in IMG/M |
| 3300011120|Ga0150983_10278006 | Not Available | 612 | Open in IMG/M |
| 3300012961|Ga0164302_10354696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 982 | Open in IMG/M |
| 3300012985|Ga0164308_10201120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1518 | Open in IMG/M |
| 3300013308|Ga0157375_12522149 | Not Available | 614 | Open in IMG/M |
| 3300014657|Ga0181522_10365003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 861 | Open in IMG/M |
| 3300015372|Ga0132256_102540052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 613 | Open in IMG/M |
| 3300015374|Ga0132255_103362874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. NRRL S-4 | 681 | Open in IMG/M |
| 3300016294|Ga0182041_10841898 | Not Available | 822 | Open in IMG/M |
| 3300016294|Ga0182041_10916619 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 789 | Open in IMG/M |
| 3300016294|Ga0182041_11970936 | Not Available | 543 | Open in IMG/M |
| 3300016357|Ga0182032_10674874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 865 | Open in IMG/M |
| 3300016404|Ga0182037_10394110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1139 | Open in IMG/M |
| 3300016422|Ga0182039_11559574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 602 | Open in IMG/M |
| 3300016445|Ga0182038_11521021 | Not Available | 601 | Open in IMG/M |
| 3300017955|Ga0187817_11141879 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300017970|Ga0187783_10162686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1644 | Open in IMG/M |
| 3300017970|Ga0187783_10574206 | Not Available | 816 | Open in IMG/M |
| 3300017972|Ga0187781_10780535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 693 | Open in IMG/M |
| 3300018006|Ga0187804_10578075 | Not Available | 509 | Open in IMG/M |
| 3300018007|Ga0187805_10564746 | Not Available | 536 | Open in IMG/M |
| 3300018085|Ga0187772_11092176 | Not Available | 585 | Open in IMG/M |
| 3300018085|Ga0187772_11309605 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 536 | Open in IMG/M |
| 3300019260|Ga0181506_1155357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1015 | Open in IMG/M |
| 3300020581|Ga0210399_11486115 | Not Available | 526 | Open in IMG/M |
| 3300021181|Ga0210388_11733580 | Not Available | 516 | Open in IMG/M |
| 3300021401|Ga0210393_10593500 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 905 | Open in IMG/M |
| 3300021401|Ga0210393_11120134 | Not Available | 635 | Open in IMG/M |
| 3300021401|Ga0210393_11607414 | Not Available | 515 | Open in IMG/M |
| 3300021560|Ga0126371_10002244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 16598 | Open in IMG/M |
| 3300021560|Ga0126371_11343380 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 847 | Open in IMG/M |
| 3300021560|Ga0126371_12478714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 628 | Open in IMG/M |
| 3300025412|Ga0208194_1058928 | Not Available | 589 | Open in IMG/M |
| 3300025929|Ga0207664_10796696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 850 | Open in IMG/M |
| 3300026023|Ga0207677_11123189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 717 | Open in IMG/M |
| 3300026551|Ga0209648_10040232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4045 | Open in IMG/M |
| 3300027090|Ga0208604_1026543 | Not Available | 546 | Open in IMG/M |
| 3300027110|Ga0208488_1000545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6380 | Open in IMG/M |
| 3300027604|Ga0208324_1203673 | Not Available | 524 | Open in IMG/M |
| 3300027824|Ga0209040_10022086 | All Organisms → cellular organisms → Bacteria | 4142 | Open in IMG/M |
| 3300027825|Ga0209039_10098680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1255 | Open in IMG/M |
| 3300027829|Ga0209773_10071519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1417 | Open in IMG/M |
| 3300027879|Ga0209169_10535156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 614 | Open in IMG/M |
| 3300027905|Ga0209415_10547952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis camponoti | 874 | Open in IMG/M |
| 3300027908|Ga0209006_10962930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 681 | Open in IMG/M |
| 3300028742|Ga0302220_10065447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1486 | Open in IMG/M |
| 3300028789|Ga0302232_10095180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. MUSC 14 | 1529 | Open in IMG/M |
| 3300028801|Ga0302226_10196133 | Not Available | 866 | Open in IMG/M |
| 3300028807|Ga0307305_10523843 | Not Available | 530 | Open in IMG/M |
| 3300029882|Ga0311368_10255513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1352 | Open in IMG/M |
| 3300029999|Ga0311339_10361883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1529 | Open in IMG/M |
| 3300030056|Ga0302181_10027260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3192 | Open in IMG/M |
| 3300030503|Ga0311370_10512604 | Not Available | 1466 | Open in IMG/M |
| 3300030520|Ga0311372_11044114 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
| 3300030524|Ga0311357_11075093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 703 | Open in IMG/M |
| 3300030580|Ga0311355_10983086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 760 | Open in IMG/M |
| 3300030617|Ga0311356_10057106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4153 | Open in IMG/M |
| 3300030617|Ga0311356_10356088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes bogorensis | 1454 | Open in IMG/M |
| 3300030618|Ga0311354_10066093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4139 | Open in IMG/M |
| 3300030730|Ga0307482_1145296 | Not Available | 688 | Open in IMG/M |
| 3300031233|Ga0302307_10171178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1124 | Open in IMG/M |
| 3300031545|Ga0318541_10163492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1225 | Open in IMG/M |
| 3300031545|Ga0318541_10598377 | Not Available | 617 | Open in IMG/M |
| 3300031640|Ga0318555_10500925 | Not Available | 658 | Open in IMG/M |
| 3300031668|Ga0318542_10031341 | All Organisms → cellular organisms → Bacteria | 2292 | Open in IMG/M |
| 3300031679|Ga0318561_10173224 | Not Available | 1165 | Open in IMG/M |
| 3300031681|Ga0318572_10689544 | Not Available | 608 | Open in IMG/M |
| 3300031708|Ga0310686_106950636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus | 538 | Open in IMG/M |
| 3300031708|Ga0310686_115142926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 3051 | Open in IMG/M |
| 3300031713|Ga0318496_10162422 | Not Available | 1222 | Open in IMG/M |
| 3300031724|Ga0318500_10306485 | Not Available | 779 | Open in IMG/M |
| 3300031736|Ga0318501_10311514 | Not Available | 842 | Open in IMG/M |
| 3300031751|Ga0318494_10679959 | Not Available | 602 | Open in IMG/M |
| 3300031753|Ga0307477_10607751 | Not Available | 737 | Open in IMG/M |
| 3300031764|Ga0318535_10115810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1181 | Open in IMG/M |
| 3300031764|Ga0318535_10415346 | Not Available | 600 | Open in IMG/M |
| 3300031768|Ga0318509_10646630 | Not Available | 588 | Open in IMG/M |
| 3300031769|Ga0318526_10457621 | Not Available | 521 | Open in IMG/M |
| 3300031770|Ga0318521_10067717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1893 | Open in IMG/M |
| 3300031777|Ga0318543_10130273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1097 | Open in IMG/M |
| 3300031779|Ga0318566_10399594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 676 | Open in IMG/M |
| 3300031793|Ga0318548_10251767 | Not Available | 868 | Open in IMG/M |
| 3300031795|Ga0318557_10067491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1538 | Open in IMG/M |
| 3300031797|Ga0318550_10403945 | Not Available | 661 | Open in IMG/M |
| 3300031798|Ga0318523_10430242 | Not Available | 655 | Open in IMG/M |
| 3300031799|Ga0318565_10111772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Herbidospora → Herbidospora galbida | 1314 | Open in IMG/M |
| 3300031799|Ga0318565_10300521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium bourgelatii | 779 | Open in IMG/M |
| 3300031799|Ga0318565_10310316 | Not Available | 766 | Open in IMG/M |
| 3300031805|Ga0318497_10833164 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300031831|Ga0318564_10119751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1172 | Open in IMG/M |
| 3300031831|Ga0318564_10368557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 630 | Open in IMG/M |
| 3300031835|Ga0318517_10043914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1851 | Open in IMG/M |
| 3300031893|Ga0318536_10492185 | Not Available | 617 | Open in IMG/M |
| 3300031894|Ga0318522_10287370 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300031896|Ga0318551_10275208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 944 | Open in IMG/M |
| 3300031896|Ga0318551_10463011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kibdelosporangium → Kibdelosporangium aridum | 725 | Open in IMG/M |
| 3300031897|Ga0318520_10029626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2720 | Open in IMG/M |
| 3300031897|Ga0318520_10618627 | Not Available | 674 | Open in IMG/M |
| 3300031941|Ga0310912_11085544 | Not Available | 612 | Open in IMG/M |
| 3300031947|Ga0310909_11038325 | Not Available | 668 | Open in IMG/M |
| 3300031954|Ga0306926_11809356 | Not Available | 693 | Open in IMG/M |
| 3300032001|Ga0306922_10433837 | Not Available | 1405 | Open in IMG/M |
| 3300032001|Ga0306922_10621550 | Not Available | 1143 | Open in IMG/M |
| 3300032008|Ga0318562_10053611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2217 | Open in IMG/M |
| 3300032008|Ga0318562_10296554 | Not Available | 939 | Open in IMG/M |
| 3300032008|Ga0318562_10526065 | Not Available | 685 | Open in IMG/M |
| 3300032010|Ga0318569_10049970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1805 | Open in IMG/M |
| 3300032010|Ga0318569_10189175 | Not Available | 953 | Open in IMG/M |
| 3300032010|Ga0318569_10427864 | Not Available | 617 | Open in IMG/M |
| 3300032039|Ga0318559_10095574 | All Organisms → cellular organisms → Bacteria | 1311 | Open in IMG/M |
| 3300032041|Ga0318549_10164277 | Not Available | 991 | Open in IMG/M |
| 3300032044|Ga0318558_10717138 | Not Available | 500 | Open in IMG/M |
| 3300032052|Ga0318506_10307027 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300032052|Ga0318506_10495266 | Not Available | 542 | Open in IMG/M |
| 3300032055|Ga0318575_10357419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 740 | Open in IMG/M |
| 3300032059|Ga0318533_10261934 | Not Available | 1250 | Open in IMG/M |
| 3300032060|Ga0318505_10276442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 792 | Open in IMG/M |
| 3300032063|Ga0318504_10492656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharopolyspora | 587 | Open in IMG/M |
| 3300032066|Ga0318514_10634159 | Not Available | 569 | Open in IMG/M |
| 3300032067|Ga0318524_10792904 | Not Available | 501 | Open in IMG/M |
| 3300032126|Ga0307415_101197168 | Not Available | 716 | Open in IMG/M |
| 3300032261|Ga0306920_102115199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 785 | Open in IMG/M |
| 3300032261|Ga0306920_102138216 | Not Available | 780 | Open in IMG/M |
| 3300032895|Ga0335074_10140614 | All Organisms → cellular organisms → Bacteria | 3079 | Open in IMG/M |
| 3300032895|Ga0335074_11470000 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 545 | Open in IMG/M |
| 3300033134|Ga0335073_10080430 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4258 | Open in IMG/M |
| 3300033134|Ga0335073_10981767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 877 | Open in IMG/M |
| 3300033290|Ga0318519_10898550 | Not Available | 547 | Open in IMG/M |
| 3300033475|Ga0310811_11279963 | Not Available | 588 | Open in IMG/M |
| 3300033803|Ga0314862_0067568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis marina | 794 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 36.88% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 8.75% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.50% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.12% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.12% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.75% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.75% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.50% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.50% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.88% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.88% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.25% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.25% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.25% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.25% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.25% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.62% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.62% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.62% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.62% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.62% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.62% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.62% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.62% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.62% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.62% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001614 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF015 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300019260 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025412 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027090 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF016 (SPAdes) | Environmental | Open in IMG/M |
| 3300027110 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF001 (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028742 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028801 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300033803 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12269J14319_100766421 | 3300001356 | Peatlands Soil | EAGVLLRQALEIFQRIGAAEADDVARELTALTEAGPPA* |
| JGI12269J14319_102239892 | 3300001356 | Peatlands Soil | AGLGRCALAAGRATQAEAFLRQALEIFQRIGVPDADDVSRELTALTEVSRQPQRPA* |
| JGI20249J16330_1008632 | 3300001614 | Forest Soil | LLRQALETFQRIGAAEAPDLLAELDTLTGPPPAR* |
| Ga0062384_1009849202 | 3300004082 | Bog Forest Soil | GRCALAAGSATDAEAWLQQALETFQRIGAAEAADVSAELDALRAAG* |
| Ga0062387_1004456921 | 3300004091 | Bog Forest Soil | ALAVGHAVQAEGLLRQALEIFQRIGAAEAPDLLTELDALTAQPPAP* |
| Ga0062389_1035243511 | 3300004092 | Bog Forest Soil | GHATQAAALLRQALEIFQRTGAADAGNVARELAALTEAGPPA* |
| Ga0070714_1020791691 | 3300005435 | Agricultural Soil | GHATQAEILLRQALEIFQRTGAAEADGVARELAAFTEAGPPA* |
| Ga0070711_1005259363 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | GRTAQAEALLRHALEIFQRTGAAETPALLAELDALTGPPPANDAT* |
| Ga0070711_1016122442 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | LGRCALAAGHATQAEILLRQALEIFQRIGAAEADGVARELAALAGPGPPA* |
| Ga0070730_105149252 | 3300005537 | Surface Soil | LAGLGRCALAGGRAAQAEDLLRQALEIFQRIGAAETPDMSAELEALTSARPSAQSS* |
| Ga0070764_108613692 | 3300005712 | Soil | GLGRCALAASHATQAAALLHQALEIFTRIGAAEAPDLRAELDALTGPPPAQ* |
| Ga0066903_1049997401 | 3300005764 | Tropical Forest Soil | AAGHTTQAQAHLRQALEIFQRTGAAEAGEVSRELTALTEAGPPA* |
| Ga0066903_1080762631 | 3300005764 | Tropical Forest Soil | AAGHTTQAQAHLRQALEIFQRTGAAEAGEVSRELTALTEARPPA* |
| Ga0070717_103940673 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | ALAAGHATQAETLLRQALEIFQRIGAAEAVGVSAELDAATQPQSAERPAVRRTDL* |
| Ga0075019_107374222 | 3300006086 | Watersheds | RPLYPRDAQARVLLRQALKILQRIGAAEAYDVVRELTTLTEAGPPA* |
| Ga0070715_107881541 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | LAGLGRCALAAGHATQAEILLRQALEIFQRTGAAEADGVARDLTALTEAGPPA* |
| Ga0070765_1001299844 | 3300006176 | Soil | RCALAAGHATQAEILLRQALEIFHRIGAAEAPDLVAELDALTGPPPAP* |
| Ga0068865_1021937202 | 3300006881 | Miscanthus Rhizosphere | TQAGILLRQALEIFQRIGAAEADGVARELAAVAEAGPPA* |
| Ga0116214_12330821 | 3300009520 | Peatlands Soil | TLAAGHATQAEALLRQALEILQRIGAAEADDVSRELTAITEAGPPA* |
| Ga0126373_100635974 | 3300010048 | Tropical Forest Soil | LRIALGHATEAEILLRQALEIFRDTGAAEARELHAELDALRAIG* |
| Ga0126373_104640952 | 3300010048 | Tropical Forest Soil | LLRQALEIFQRIGAVEAGDISRELTALAEAGPPA* |
| Ga0126373_121420931 | 3300010048 | Tropical Forest Soil | AALLRQALGIFQRIGAAEAPDLRAELDALTGPPPAQ* |
| Ga0126373_125436491 | 3300010048 | Tropical Forest Soil | LGRCALAARHATRAAELLHQAAEIFQRTGAAEAGDVSRELTALTEAGPPP* |
| Ga0126378_133457421 | 3300010361 | Tropical Forest Soil | AGRTVQDGGLLRQALEIFQRIGAAEVPGLTAELGALASPPSAR* |
| Ga0126379_135586411 | 3300010366 | Tropical Forest Soil | RCALAADHATQALAFLRQALEIFQRIGTAEANDVSRELTALTEAGPPA* |
| Ga0134125_121749281 | 3300010371 | Terrestrial Soil | ALAGLGRCALASDRATKAEALLRQALEIFQRIGAAEAAYVSVELDALTEAEPAAPGS* |
| Ga0126381_1048552132 | 3300010376 | Tropical Forest Soil | EALAGLGRCDWAAGRASDARARLGQALEIFQRVGVAEASEVAVELDALTTVPERTSSSH* |
| Ga0126381_1049975521 | 3300010376 | Tropical Forest Soil | AQALLQQAHEIFQRIGAAETLSVLAELSALTTPEPPGKR* |
| Ga0136449_1044061823 | 3300010379 | Peatlands Soil | AAGHARHAGVLLRQALEIFQRIGAAEAPDLRTELDTLTGPPPAH* |
| Ga0126383_129886762 | 3300010398 | Tropical Forest Soil | QALLRQALEIFQRTGAAEAGEVSRELTALTEARPPA* |
| Ga0134123_125766832 | 3300010403 | Terrestrial Soil | GHATQAEILLRQALEIFQRIGAAEADGVARELAALAEAGPPA* |
| Ga0150983_102780062 | 3300011120 | Forest Soil | GLGRCALAAGRATQAEALLRQALHIFQRIGAGEAPDLLAELDALNGAPPP* |
| Ga0164302_103546962 | 3300012961 | Soil | AGHATQAGILLRQALEVFQRIGAAEADGVTRELAALAEAGPPA* |
| Ga0164308_102011201 | 3300012985 | Soil | RRRRRAAAGHATQAGILLRQALEIFQRIGAAEADGVTRELAALAEAGPPA* |
| Ga0157375_125221491 | 3300013308 | Miscanthus Rhizosphere | HAAQASGLLRQSLAIFQQIGGAEAPDLLAELDALTGLPPPPFN* |
| Ga0181522_103650031 | 3300014657 | Bog | QAADQGTQAEVLLRQALEIFQRIGAAEAPDLLAELDARTEHSGLQA* |
| Ga0132256_1025400521 | 3300015372 | Arabidopsis Rhizosphere | LGRCVLAVGHATQAAALLQQALEIFQRIGAAEAGDISRELTALTAAGPPA* |
| Ga0132255_1033628741 | 3300015374 | Arabidopsis Rhizosphere | GHATQAGVLLRQAVQIFQRIGAAEAPDLLAELDTLTGPQPAQ* |
| Ga0182041_108418982 | 3300016294 | Soil | AAALLQQALEIFQRIGTAEAGDVSRELTALTEAGPPT |
| Ga0182041_109166192 | 3300016294 | Soil | GRCALAAGNATRAGILLRQALDIFQRIGAAEAQDLRAELDALTGPRRGE |
| Ga0182041_119709361 | 3300016294 | Soil | QARALLRQALEIFQRIGAAETPDVTAELETLTSPKPAQ |
| Ga0182032_106748742 | 3300016357 | Soil | AAGHAAQARALLCQALQIFQRIGAAETPDLLAELDTLTSPKPAR |
| Ga0182037_103941104 | 3300016404 | Soil | AAQARVLLRQALEIFQRIGAAEAAEVSGELGALTQAQPAAPGS |
| Ga0182039_115595742 | 3300016422 | Soil | GHATQAQALLRQALEIFQRTGAAEASDVSRELAALTEAGPPA |
| Ga0182038_115210211 | 3300016445 | Soil | ILLRQALEIFQRIGAAEVPELRAELDALTGPPPAH |
| Ga0187817_111418791 | 3300017955 | Freshwater Sediment | ALEIFQRIGAAEADDLASELTTLTETRPSAYPGADQS |
| Ga0187783_101626862 | 3300017970 | Tropical Peatland | VAAGHATQAAALLRQALEIFQRIGAVEVGDVSRELAALTKAGPPS |
| Ga0187783_105742061 | 3300017970 | Tropical Peatland | HPTQAEVLLREALEIFQRIGAAEAPDVLAELGPLSVPPPAR |
| Ga0187781_107805351 | 3300017972 | Tropical Peatland | AQAAGHAGQAADMLRQALEIFRRGGMAEAAEVSAELQALTDSRPSTHGT |
| Ga0187804_105780751 | 3300018006 | Freshwater Sediment | ALAADHASQAGVLLRQALEIFQRIGAAAAAGVSAELEALTGARPSAQGL |
| Ga0187805_105647461 | 3300018007 | Freshwater Sediment | GRCALAAGHATQAGVLLRQALEIFQRIGAAEAAGVSAELEALTGARPSAQGL |
| Ga0187772_110921763 | 3300018085 | Tropical Peatland | GRCALAADCAAEAAAGLRQALEIFQRIGAAETAYVSAELETLERS |
| Ga0187772_113096052 | 3300018085 | Tropical Peatland | AEVLLRQALEIFRRIGAAEVPDLLAELDALAGPPAAQ |
| Ga0181506_11553571 | 3300019260 | Peatland | LGRCALAAGHAAQAEILLRQALEIFQRIGAAEAPDLLAELDES |
| Ga0210399_114861151 | 3300020581 | Soil | RWSGLGRCALAADRAAQAAALLRRALEIFQRIGAAEVGHVSRELTALTQAGPPA |
| Ga0210388_117335801 | 3300021181 | Soil | RCALAADRAAQAEVLLGRALEIFQRIGTAEAPDLLAELAALTGPPPAQ |
| Ga0210393_105935002 | 3300021401 | Soil | GRCALAGGHAAQAEILLRQALEIFQRIGAAEADGVARELAALAEAGPPA |
| Ga0210393_111201341 | 3300021401 | Soil | ALACLGRCALAAGHATRAEDMLLQALEIFERIGAAEGAAVSTELQALIGARPTAQGH |
| Ga0210393_116074141 | 3300021401 | Soil | QAAAFLRQALEIFQRIGAAEAADVSRELAALTGAGPLA |
| Ga0126371_100022443 | 3300021560 | Tropical Forest Soil | LRIALGHATEAEILLRQALEIFRDTGAAEARELHAELDALRAIG |
| Ga0126371_113433801 | 3300021560 | Tropical Forest Soil | AEDMLRQALEIFQRIGAPEAPDLLTELDALTGPPPAHTQ |
| Ga0126371_124787142 | 3300021560 | Tropical Forest Soil | ALAAGHATQAQALLRQALEIFQRIGAAEAPDLRAELDALTGPPPAR |
| Ga0208194_10589281 | 3300025412 | Peatland | IQAEVLLRQALEIFQRIGAAEAPDLLAELDASPGPPLAR |
| Ga0207664_107966962 | 3300025929 | Agricultural Soil | VGHATQAEILLRQALEIFQRTGAAEADGVARELAAFTEAGPPA |
| Ga0207677_111231891 | 3300026023 | Miscanthus Rhizosphere | TQAGILLRQALEIFQRIGAAEADGVARELAAVAEAGPPA |
| Ga0209648_100402322 | 3300026551 | Grasslands Soil | MAVGHGKQAEVLLRQALEIFQRIGAGEAADVSAELEAVTGAPPSAPGL |
| Ga0208604_10265432 | 3300027090 | Forest Soil | TQAEALLRQALHIFQRIGAGEAPDLLAELDALNGAPPP |
| Ga0208488_10005456 | 3300027110 | Forest Soil | AEGAAGLRQALEIFQRLGAAEVPGLIAEIASLPGQPPAR |
| Ga0208324_12036732 | 3300027604 | Peatlands Soil | TLAAGHATQAEALLRQALEILQRIGAAEADDVSRELTAITEAGPPA |
| Ga0209040_100220863 | 3300027824 | Bog Forest Soil | EALLRQALEIFQRIGAAEADDVARELTTFTEAGPPA |
| Ga0209039_100986801 | 3300027825 | Bog Forest Soil | RSRPLYPRDGQAAQARVLLRQALKILQRIGAAEADDVVRELTTLTEAGPPA |
| Ga0209773_100715192 | 3300027829 | Bog Forest Soil | AGLGRCATAAGHATQAEVLLRRALEIFQRIGAAEAPDVLAELHALTGPPPAQ |
| Ga0209169_105351562 | 3300027879 | Soil | ASHATQAAALLHQALEIFTRIGAAEAPDLRAELDALTGPPPAQ |
| Ga0209415_105479522 | 3300027905 | Peatlands Soil | MAAGHAAQAEVLLRQALEIFQSLGAAEAADLLAELDARSGPTPQD |
| Ga0209006_109629301 | 3300027908 | Forest Soil | ATQAEILLRQALEIFQRIGAAEADGVARELAALAEAGPPA |
| Ga0302220_100654472 | 3300028742 | Palsa | GRCAMAAGHAAQAEALLRQALEIFQRIGAAEVADLLAELDVFAGRPTAQ |
| Ga0302232_100951801 | 3300028789 | Palsa | VGRATQAKVLLRQALEIFQRIGAAEAPDLLAELAALTGPPPAQ |
| Ga0302226_101961332 | 3300028801 | Palsa | AVGHTTQAEVLLRQALEIFQRIGAAEARGLIAELDALASPSPS |
| Ga0307305_105238431 | 3300028807 | Soil | LAAGHATQAGVLLRQALEIFQRIGAAEAADLLGELDALAGPPPVQ |
| Ga0311368_102555131 | 3300029882 | Palsa | DHLRRALEIFRRIDAADAGDVSRELAALTEAGPPA |
| Ga0311339_103618833 | 3300029999 | Palsa | MADGHATQAEVLLRQALEIFQRIGAAEVPDLVAELDALTGSRSVQW |
| Ga0302181_100272603 | 3300030056 | Palsa | VQAEGLLRQALEIFQRIGAAEAPDLLTELDALTALPPAP |
| Ga0311370_105126041 | 3300030503 | Palsa | CAIAVGRATQAEVLLRQARETFQRIGAAEASDLLAELDALTGPPPAQ |
| Ga0311372_110441143 | 3300030520 | Palsa | CALASGHAAEAEANLRQALEIFQRIGAAEAAELAAEFDAIRAAG |
| Ga0311357_110750931 | 3300030524 | Palsa | HATQAAALLRQALEIFNRIGAAEAPDLRAELDALTGPPPAP |
| Ga0311355_109830861 | 3300030580 | Palsa | VASHATQAAALLRQALEIFNRIGAAEAPDLRAELDALTGPPPAP |
| Ga0311356_100571061 | 3300030617 | Palsa | AVQAEGLLRQALEIFQRIGAAEAPDLLTELDALTALPPAP |
| Ga0311356_103560881 | 3300030617 | Palsa | PATPAQAEALLRQALEIFQRIGAAEAPDLLAGLDALTGPPPAQ |
| Ga0311354_100660934 | 3300030618 | Palsa | GLLRQALEIFQRIGAAEAPDLLTELDALTALPPAP |
| Ga0307482_11452962 | 3300030730 | Hardwood Forest Soil | AQAIALLQQAHQITQLIGSAEASGLLAELDALAGTRP |
| Ga0302307_101711782 | 3300031233 | Palsa | MAAGHAAQAEALLRQALEIFQRIGAAEVADLLAELDVFAGRPTAQ |
| Ga0318541_101634921 | 3300031545 | Soil | ALAFLRQALEIFQRIGTAEANDVSRELAALTEAGPA |
| Ga0318541_105983771 | 3300031545 | Soil | HAAQARALLCQALQIFQRIGAAETPDLLAELDTLTSPKPAR |
| Ga0318555_105009251 | 3300031640 | Soil | ALAAGHAAQARVLLRQALEIFQRIGAAEAAEVSGELGALTQAQPAAPGS |
| Ga0318542_100313414 | 3300031668 | Soil | LAGLGRCALAAGDATRAGILLRQALEIFQRTGAAEAQDLRAEVDALTGPRRGE |
| Ga0318561_101732243 | 3300031679 | Soil | TQAEALLRQALEIFQRIGSAEAPDLLAELDALAGPPPAH |
| Ga0318572_106895441 | 3300031681 | Soil | TQAKALLRQALEIFQRIGAAETPDLLAELDTFTSPPPAQ |
| Ga0310686_1069506361 | 3300031708 | Soil | LAAGDAGQAGALLRQALEIFQRTGAVEAAGTAAELDALGQG |
| Ga0310686_1151429262 | 3300031708 | Soil | MADYRATQAEALLRQALEIFQRIGAAEATDVSGELQALTDARPAAQGS |
| Ga0318496_101624221 | 3300031713 | Soil | HATEAQALLRQALEIFQRIAAAEASDVASELTALTEAGPPA |
| Ga0318500_103064853 | 3300031724 | Soil | LGRCALAAGDATRAGILLRQALEIFQRTGAAETADLRAELDALTGPRRGE |
| Ga0318501_103115142 | 3300031736 | Soil | ILLRQALEIFQRTGAAETADLRAELDVLTGPPRGE |
| Ga0318494_106799591 | 3300031751 | Soil | CKRAAGHATQAAALLQQALEIFQRIGAAEATDLLAELDALTGPPPAQ |
| Ga0307477_106077513 | 3300031753 | Hardwood Forest Soil | AGHVTQAEALLRRALEIFQRTGAAEAADVSAELKDLTDARPAAQGS |
| Ga0318535_101158101 | 3300031764 | Soil | LGRCALAAGHATQAGVLLRQALEIFQRTEAAEAPDLLAELDALTVVRPEYVRNGP |
| Ga0318535_104153461 | 3300031764 | Soil | VADGHATQAEVLLRQALEIFQRIGAAEAPDLLAELDTLTGPRTTG |
| Ga0318509_106466301 | 3300031768 | Soil | SSACCKRAAGHATQAAALLQQALEIFQRIGAAEATDLLAELDALTGPPPAQ |
| Ga0318526_104576211 | 3300031769 | Soil | ATQARALLRHALEIFQRIGAAETPDLLTELDALTSPPPAQ |
| Ga0318521_100677171 | 3300031770 | Soil | PGAADHATQALAFLRQALEIFQRIGTAEANDVSRELAALTEAGPA |
| Ga0318543_101302733 | 3300031777 | Soil | GHAARAAVLLRQALEIFQGIGAAEAPELHAELEALTGPPLA |
| Ga0318566_103995941 | 3300031779 | Soil | HTTQARALLRQALEIFQRIGAAETPDLLAELDALTSPPPAQ |
| Ga0318548_102517673 | 3300031793 | Soil | GLGHCALASGHATRAEALLRQALEIFQRIGAAEAPGLRAELDALTSPPHGR |
| Ga0318557_100674913 | 3300031795 | Soil | AGLGRWGLAAGHATQAEALLRQALEIYQQLGAAEAGEVSRELAALTEAGPPA |
| Ga0318550_104039451 | 3300031797 | Soil | RALLRQALEIFQRIGAAEAPDLRAELDTLTSSPAQ |
| Ga0318523_104302421 | 3300031798 | Soil | AQARALLRQALQIFQRIGAAETPDLLAELDTLTSPKPAR |
| Ga0318565_101117721 | 3300031799 | Soil | DATRAGILLRQALEIFQRTGAAETADLRAELDALTGPRRGE |
| Ga0318565_103005212 | 3300031799 | Soil | TQAQALLRQALEIFQRIEAAEASDVSRELTALTEAGPPA |
| Ga0318565_103103161 | 3300031799 | Soil | VGHATQGEAFLRQALEIFQRIGAAEAGDVSRELTALTEAGPPT |
| Ga0318497_108331642 | 3300031805 | Soil | ATQAQALLRQALEIFQRIEAAEASDVSRELTALTEAGPPA |
| Ga0318564_101197513 | 3300031831 | Soil | ALAGLGRCALAAGDATRAGILLRQALEIFQRTGAAETADLRAELDVLTGPPRGE |
| Ga0318564_103685571 | 3300031831 | Soil | CALAAGHATQAGVLLRQALEIFQRIGAAEAAELSAELQALTGARPSAAGP |
| Ga0318517_100439144 | 3300031835 | Soil | RAGILLRQALEIFQRTGAAEAQDLRAEVDALTGPRRGE |
| Ga0318536_104921852 | 3300031893 | Soil | AAALLRQALEIFQRIGAAEAPDLRAELDALTGPPPAR |
| Ga0318522_102873701 | 3300031894 | Soil | ALAAGDATRAGILLRQALEIFQRTGAAEAQDLRAEVDALTGPRRGE |
| Ga0318551_102752081 | 3300031896 | Soil | RCALAAGHATQAQALLRQALEIFQRTGAAEAGDVSRELAALSEAGPPA |
| Ga0318551_104630111 | 3300031896 | Soil | GRCALAAGHVAQAEILLRQALEIFQRIGAAGEAPELRAELDALTGPPPAQ |
| Ga0318520_100296266 | 3300031897 | Soil | LEQALAFLRQALEIFQRIGTAEANDVSRELAALTEAGPA |
| Ga0318520_106186271 | 3300031897 | Soil | TQAEALLRQALEIFQRIGAAEAPGLRAELDALTSPPHGR |
| Ga0310912_110855441 | 3300031941 | Soil | AALLRQALEIFQRIGAAEAPDLRAELDALTGPPPAR |
| Ga0310909_110383253 | 3300031947 | Soil | ALAAGHITQARALLRQALEIFQRIGAAEAPDLIAELDTLTSPPPAQ |
| Ga0306926_118093561 | 3300031954 | Soil | GHATEAQALLRQALEIFQRIGAAEASDVASELAALAGAGPPA |
| Ga0306922_104338372 | 3300032001 | Soil | AGDHATQAQALLRQALEIFQRTGAAEASDVASELTALTEAGPPA |
| Ga0306922_106215503 | 3300032001 | Soil | AAGHATQAAALLQQALEIFQRIGTAEAGDVSRELTALTEAGPPT |
| Ga0318562_100536111 | 3300032008 | Soil | VGGLGRCALAADHATQALAFLRQALEIFQRIGTAEANDVSRELAALTEAGPA |
| Ga0318562_102965542 | 3300032008 | Soil | HSTGHATQAAALLRQALEIFQRIGAAEAPDLRAELDALTGPPPAR |
| Ga0318562_105260651 | 3300032008 | Soil | TQAQALLRQALEIFQRTGAAEAGDVSRELAALSEAGPPA |
| Ga0318569_100499703 | 3300032010 | Soil | EAHALAGLGRCALAAGDATRAGILLRQALEIFQRTGAAETADLRAELDVLTGPPRGE |
| Ga0318569_101891751 | 3300032010 | Soil | TQAAALLRQALEIFQRIDAAGATRAARELAALTEPGLPA |
| Ga0318569_104278641 | 3300032010 | Soil | GHATQARALLRQALEIFQRIGAAEAPDLRAELDTLTSSPAQ |
| Ga0318559_100955741 | 3300032039 | Soil | PRAGILLRQALEIFQRTGAAEAQDLRAEVDALTGPRRGE |
| Ga0318549_101642772 | 3300032041 | Soil | ALAVGHATQAEALLRQALEIFQRIGSAEAPDLLAELDALAGPPPAH |
| Ga0318558_107171381 | 3300032044 | Soil | AAGHATQAQALLRQALEIFQRTGAAEAGDVSRELAALSEAGPPA |
| Ga0318506_103070271 | 3300032052 | Soil | AAGDATRAGILLRQALEIFQRTGAAEAQDLRAEVDALTGPRRGE |
| Ga0318506_104952662 | 3300032052 | Soil | RCALAADHATQALAFLRQALEIFQRIGTAEANDVSRELAALTEAGPA |
| Ga0318575_103574192 | 3300032055 | Soil | GRCALAAGHATQAGALLCQALEIFQRIGAAETPGLLAELDTLTSPPPAQ |
| Ga0318533_102619343 | 3300032059 | Soil | GHATQAEALLRQALEIFQRIGAAEAPGLRAELDALTSPPHGR |
| Ga0318505_102764421 | 3300032060 | Soil | AGLGRWGLAAGHATQAEALLRQALEIYQQLGAAEAGEVSRELAALTEAGPPG |
| Ga0318504_104926561 | 3300032063 | Soil | CALAADHATQAGVLLRQALEIFQRIGAAEAADLSAELQALTGARPSAAGP |
| Ga0318514_106341591 | 3300032066 | Soil | TQAKALLHQALEIFQRIGAAEAPDLRAELDTLTSPPAQ |
| Ga0318524_107929042 | 3300032067 | Soil | EDPGLAAGHAAQARVLLRQALEIFQRIGAAEAAEVSGELGALTQAQPAAPGS |
| Ga0307415_1011971681 | 3300032126 | Rhizosphere | LGRCDLAAGDIPAAVTQLSTALEIFQRIGAAEAADVAAELDAVRAGHPPDG |
| Ga0306920_1021151991 | 3300032261 | Soil | AAGDATRAGVLLRQALEIFQRIGAAETPDLLAELDALTGSPPAP |
| Ga0306920_1021382162 | 3300032261 | Soil | AVALLRQALEIFQRIGAAEAGDVSRELTALTGPPT |
| Ga0335074_101406145 | 3300032895 | Soil | ALAAGRATQAAVLLRQALEIFHRIGAAETPDLRTELDALTGTPPVR |
| Ga0335074_114700002 | 3300032895 | Soil | GDTAQAGVLLRQALEIFQRIGAAEAPDVAAELAAVSQSVPRST |
| Ga0335073_100804306 | 3300033134 | Soil | AGDATQAKALLRQALEIFQRIGAAEAPNLLAELDALTSPPPAP |
| Ga0335073_109817671 | 3300033134 | Soil | MAVGDAGNIQAGQAEALLRQALEIFRRIGTAEAQDLHAELDTHAGPRP |
| Ga0318519_108985502 | 3300033290 | Soil | RCAMADGHATQAGVLLRQGLEIFQRIGAAEAPDLLAELDALTVPPLAQ |
| Ga0310811_112799631 | 3300033475 | Soil | RCALAAADAVQAGILLRLALEIFQRIGAAETPELLAEVAALSGNRS |
| Ga0314862_0067568_648_794 | 3300033803 | Peatland | RCALAAGHATQAQALLRKALGIFQRIGTTEAGDVSRELTALTEAGPPA |
| ⦗Top⦘ |