| Basic Information | |
|---|---|
| Family ID | F041284 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 160 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MRLAYLVMSLLPTLAVVTLAWFVVRAISVRVVWRESGVRRLDDEPA |
| Number of Associated Samples | 113 |
| Number of Associated Scaffolds | 160 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 70.62 % |
| % of genes near scaffold ends (potentially truncated) | 24.38 % |
| % of genes from short scaffolds (< 2000 bps) | 86.25 % |
| Associated GOLD sequencing projects | 106 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.55 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (66.250 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil (21.250 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.250 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (36.250 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.35% β-sheet: 0.00% Coil/Unstructured: 48.65% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 160 Family Scaffolds |
|---|---|---|
| PF02245 | Pur_DNA_glyco | 52.50 |
| PF00230 | MIP | 11.25 |
| PF00330 | Aconitase | 5.62 |
| PF04945 | YHS | 0.62 |
| PF09347 | DUF1989 | 0.62 |
| PF13360 | PQQ_2 | 0.62 |
| PF00694 | Aconitase_C | 0.62 |
| COG ID | Name | Functional Category | % Frequency in 160 Family Scaffolds |
|---|---|---|---|
| COG2094 | 3-methyladenine DNA glycosylase Mpg | Replication, recombination and repair [L] | 52.50 |
| COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 11.25 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 66.88 % |
| Unclassified | root | N/A | 33.12 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000231|TB_LI09_4DRAFT_10169976 | Not Available | 725 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_103271794 | Not Available | 520 | Open in IMG/M |
| 3300002407|C687J29651_10173567 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 697 | Open in IMG/M |
| 3300004049|Ga0055493_10034509 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 895 | Open in IMG/M |
| 3300004481|Ga0069718_16255318 | All Organisms → cellular organisms → Bacteria | 5925 | Open in IMG/M |
| 3300005254|Ga0068714_10191887 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300005833|Ga0074472_10029840 | Not Available | 680 | Open in IMG/M |
| 3300005833|Ga0074472_11092920 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1842 | Open in IMG/M |
| 3300005833|Ga0074472_11093519 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
| 3300006224|Ga0079037_101549338 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 662 | Open in IMG/M |
| 3300006224|Ga0079037_102225960 | Not Available | 547 | Open in IMG/M |
| 3300009053|Ga0105095_10063092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1994 | Open in IMG/M |
| 3300009075|Ga0105090_10374179 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 869 | Open in IMG/M |
| 3300009078|Ga0105106_10239301 | All Organisms → cellular organisms → Bacteria | 1320 | Open in IMG/M |
| 3300009081|Ga0105098_10748944 | Not Available | 523 | Open in IMG/M |
| 3300009085|Ga0105103_10701087 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300009091|Ga0102851_10058017 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3152 | Open in IMG/M |
| 3300009091|Ga0102851_10164337 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2037 | Open in IMG/M |
| 3300009091|Ga0102851_11378488 | Not Available | 782 | Open in IMG/M |
| 3300009091|Ga0102851_11974571 | Not Available | 660 | Open in IMG/M |
| 3300009091|Ga0102851_12799469 | Not Available | 560 | Open in IMG/M |
| 3300009100|Ga0075418_10334832 | Not Available | 1615 | Open in IMG/M |
| 3300009111|Ga0115026_11025093 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 661 | Open in IMG/M |
| 3300009146|Ga0105091_10056109 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Zoopagomycota → Entomophthoromycotina → Basidiobolomycetes → Basidiobolales → Basidiobolaceae → Basidiobolus → Basidiobolus meristosporus → Basidiobolus meristosporus CBS 931.73 | 1757 | Open in IMG/M |
| 3300009146|Ga0105091_10465395 | Not Available | 638 | Open in IMG/M |
| 3300009146|Ga0105091_10497406 | Not Available | 619 | Open in IMG/M |
| 3300009153|Ga0105094_10021226 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3519 | Open in IMG/M |
| 3300009166|Ga0105100_10779043 | Not Available | 592 | Open in IMG/M |
| 3300009167|Ga0113563_10078398 | Not Available | 2933 | Open in IMG/M |
| 3300009167|Ga0113563_10487880 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1340 | Open in IMG/M |
| 3300009167|Ga0113563_10966887 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 977 | Open in IMG/M |
| 3300009167|Ga0113563_13032547 | Not Available | 569 | Open in IMG/M |
| 3300009167|Ga0113563_13715626 | Not Available | 517 | Open in IMG/M |
| 3300009170|Ga0105096_10550554 | Not Available | 603 | Open in IMG/M |
| 3300009179|Ga0115028_10290321 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1093 | Open in IMG/M |
| 3300009179|Ga0115028_10343271 | Not Available | 1024 | Open in IMG/M |
| 3300009179|Ga0115028_11138058 | Not Available | 638 | Open in IMG/M |
| 3300009430|Ga0114938_1075461 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1240 | Open in IMG/M |
| 3300009455|Ga0114939_10183574 | Not Available | 885 | Open in IMG/M |
| 3300009870|Ga0131092_11431719 | Not Available | 529 | Open in IMG/M |
| 3300011391|Ga0137331_1021779 | Not Available | 663 | Open in IMG/M |
| 3300011413|Ga0137333_1007931 | Not Available | 2305 | Open in IMG/M |
| 3300011422|Ga0137425_1174945 | Not Available | 536 | Open in IMG/M |
| 3300011436|Ga0137458_1222659 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
| 3300012039|Ga0137421_1218735 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300012163|Ga0137355_1007400 | All Organisms → cellular organisms → Bacteria | 1894 | Open in IMG/M |
| 3300012166|Ga0137350_1071028 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 692 | Open in IMG/M |
| 3300012931|Ga0153915_10580703 | Not Available | 1287 | Open in IMG/M |
| 3300012931|Ga0153915_11787957 | Not Available | 719 | Open in IMG/M |
| 3300012964|Ga0153916_12877952 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300013315|Ga0173609_10174518 | Not Available | 612 | Open in IMG/M |
| 3300014315|Ga0075350_1141516 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
| 3300014867|Ga0180076_1092069 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300014874|Ga0180084_1006343 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1931 | Open in IMG/M |
| 3300014881|Ga0180094_1130282 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
| 3300017944|Ga0187786_10640542 | Not Available | 504 | Open in IMG/M |
| 3300017966|Ga0187776_10331618 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 999 | Open in IMG/M |
| 3300018029|Ga0187787_10331044 | Not Available | 581 | Open in IMG/M |
| 3300018059|Ga0184615_10039435 | All Organisms → cellular organisms → Bacteria | 2624 | Open in IMG/M |
| 3300018063|Ga0184637_10018482 | All Organisms → cellular organisms → Bacteria | 4192 | Open in IMG/M |
| 3300018070|Ga0184631_10394166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300018074|Ga0184640_10452005 | Not Available | 571 | Open in IMG/M |
| 3300018079|Ga0184627_10130001 | Not Available | 1333 | Open in IMG/M |
| 3300018082|Ga0184639_10310098 | Not Available | 828 | Open in IMG/M |
| 3300018089|Ga0187774_11489113 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300019229|Ga0180116_1247358 | Not Available | 632 | Open in IMG/M |
| 3300020067|Ga0180109_1194556 | Not Available | 521 | Open in IMG/M |
| 3300021090|Ga0210377_10021258 | All Organisms → cellular organisms → Bacteria | 4748 | Open in IMG/M |
| 3300021090|Ga0210377_10233139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1157 | Open in IMG/M |
| 3300021859|Ga0210334_10509400 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
| 3300021859|Ga0210334_11053521 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
| 3300022185|Ga0079039_1359515 | Not Available | 500 | Open in IMG/M |
| 3300022214|Ga0224505_10352198 | Not Available | 558 | Open in IMG/M |
| 3300025106|Ga0209398_1165066 | Not Available | 511 | Open in IMG/M |
| 3300025130|Ga0209594_1239356 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300025313|Ga0209431_10027685 | Not Available | 4368 | Open in IMG/M |
| 3300025318|Ga0209519_10740167 | Not Available | 525 | Open in IMG/M |
| 3300027713|Ga0209286_1115934 | Not Available | 993 | Open in IMG/M |
| 3300027731|Ga0209592_1081356 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1192 | Open in IMG/M |
| 3300027831|Ga0209797_10337851 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 621 | Open in IMG/M |
| 3300027871|Ga0209397_10095912 | All Organisms → cellular organisms → Bacteria | 1233 | Open in IMG/M |
| 3300027871|Ga0209397_10283863 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 787 | Open in IMG/M |
| 3300027871|Ga0209397_10718841 | Not Available | 502 | Open in IMG/M |
| 3300027877|Ga0209293_10065743 | All Organisms → cellular organisms → Bacteria | 1544 | Open in IMG/M |
| 3300027885|Ga0209450_10022489 | All Organisms → cellular organisms → Bacteria | 3592 | Open in IMG/M |
| 3300027887|Ga0208980_10163436 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1303 | Open in IMG/M |
| 3300027887|Ga0208980_10810365 | Not Available | 523 | Open in IMG/M |
| 3300027890|Ga0209496_10856463 | Not Available | 504 | Open in IMG/M |
| 3300027897|Ga0209254_10027385 | All Organisms → cellular organisms → Bacteria | 5144 | Open in IMG/M |
| 3300027897|Ga0209254_10362070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1087 | Open in IMG/M |
| 3300027899|Ga0209668_10137602 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1467 | Open in IMG/M |
| 3300027899|Ga0209668_10748026 | Not Available | 657 | Open in IMG/M |
| 3300027900|Ga0209253_10180561 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1695 | Open in IMG/M |
| 3300027902|Ga0209048_10041404 | All Organisms → cellular organisms → Bacteria | 3825 | Open in IMG/M |
| 3300027902|Ga0209048_10104997 | All Organisms → cellular organisms → Bacteria | 2167 | Open in IMG/M |
| 3300028803|Ga0307281_10033328 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1557 | Open in IMG/M |
| 3300028803|Ga0307281_10146026 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 827 | Open in IMG/M |
| 3300028869|Ga0302263_10084224 | All Organisms → cellular organisms → Bacteria | 1260 | Open in IMG/M |
| 3300029984|Ga0311332_10372464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1105 | Open in IMG/M |
| 3300030000|Ga0311337_11499443 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
| 3300030047|Ga0302286_10491028 | Not Available | 622 | Open in IMG/M |
| 3300030613|Ga0299915_10058895 | All Organisms → cellular organisms → Bacteria | 2840 | Open in IMG/M |
| 3300030613|Ga0299915_10626253 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 689 | Open in IMG/M |
| 3300031576|Ga0247727_10084174 | All Organisms → cellular organisms → Bacteria | 3469 | Open in IMG/M |
| 3300031834|Ga0315290_10070809 | All Organisms → cellular organisms → Bacteria | 2881 | Open in IMG/M |
| 3300031834|Ga0315290_10367657 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1260 | Open in IMG/M |
| 3300031873|Ga0315297_10509471 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1012 | Open in IMG/M |
| 3300031949|Ga0214473_10610474 | All Organisms → cellular organisms → Bacteria | 1202 | Open in IMG/M |
| 3300031965|Ga0326597_10335927 | All Organisms → cellular organisms → Bacteria | 1704 | Open in IMG/M |
| 3300031997|Ga0315278_10253549 | All Organisms → cellular organisms → Bacteria | 1816 | Open in IMG/M |
| 3300031997|Ga0315278_11098255 | Not Available | 786 | Open in IMG/M |
| 3300032143|Ga0315292_10082852 | All Organisms → cellular organisms → Bacteria | 2468 | Open in IMG/M |
| 3300032143|Ga0315292_11213092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 620 | Open in IMG/M |
| 3300032164|Ga0315283_10440437 | All Organisms → cellular organisms → Bacteria | 1416 | Open in IMG/M |
| 3300032256|Ga0315271_10267980 | All Organisms → cellular organisms → Bacteria | 1394 | Open in IMG/M |
| 3300032342|Ga0315286_10199458 | All Organisms → cellular organisms → Bacteria | 2140 | Open in IMG/M |
| 3300032397|Ga0315287_10471664 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1490 | Open in IMG/M |
| 3300032401|Ga0315275_10736547 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1095 | Open in IMG/M |
| 3300032516|Ga0315273_10893642 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1147 | Open in IMG/M |
| 3300032770|Ga0335085_10234332 | All Organisms → cellular organisms → Bacteria | 2220 | Open in IMG/M |
| 3300032783|Ga0335079_10329870 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1659 | Open in IMG/M |
| 3300032829|Ga0335070_10159437 | All Organisms → cellular organisms → Bacteria | 2285 | Open in IMG/M |
| 3300032829|Ga0335070_12078575 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300033004|Ga0335084_10693288 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1038 | Open in IMG/M |
| 3300033408|Ga0316605_10439282 | All Organisms → cellular organisms → Bacteria | 1188 | Open in IMG/M |
| 3300033408|Ga0316605_10576915 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1047 | Open in IMG/M |
| 3300033408|Ga0316605_12004850 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
| 3300033408|Ga0316605_12020627 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
| 3300033414|Ga0316619_10269899 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1278 | Open in IMG/M |
| 3300033416|Ga0316622_100706527 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1166 | Open in IMG/M |
| 3300033416|Ga0316622_101174992 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 897 | Open in IMG/M |
| 3300033416|Ga0316622_102049258 | Not Available | 664 | Open in IMG/M |
| 3300033418|Ga0316625_101923131 | Not Available | 579 | Open in IMG/M |
| 3300033433|Ga0326726_10199382 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1847 | Open in IMG/M |
| 3300033434|Ga0316613_10176660 | All Organisms → cellular organisms → Bacteria | 1365 | Open in IMG/M |
| 3300033434|Ga0316613_10857596 | Not Available | 624 | Open in IMG/M |
| 3300033434|Ga0316613_10991249 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
| 3300033480|Ga0316620_10367766 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1287 | Open in IMG/M |
| 3300033480|Ga0316620_10598819 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1035 | Open in IMG/M |
| 3300033481|Ga0316600_10580897 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 782 | Open in IMG/M |
| 3300033483|Ga0316629_10396291 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 971 | Open in IMG/M |
| 3300033483|Ga0316629_10473936 | Not Available | 903 | Open in IMG/M |
| 3300033486|Ga0316624_10120917 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1893 | Open in IMG/M |
| 3300033486|Ga0316624_11309789 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 662 | Open in IMG/M |
| 3300033487|Ga0316630_10503340 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300033489|Ga0299912_10279677 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1406 | Open in IMG/M |
| 3300033489|Ga0299912_11079001 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
| 3300033513|Ga0316628_103132804 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
| 3300033513|Ga0316628_103734488 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
| 3300033521|Ga0316616_100138738 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2269 | Open in IMG/M |
| 3300033521|Ga0316616_100299402 | All Organisms → cellular organisms → Bacteria | 1704 | Open in IMG/M |
| 3300033521|Ga0316616_100530751 | All Organisms → cellular organisms → Bacteria | 1359 | Open in IMG/M |
| 3300033521|Ga0316616_102202122 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 734 | Open in IMG/M |
| 3300033521|Ga0316616_104942999 | Not Available | 502 | Open in IMG/M |
| 3300033557|Ga0316617_101834016 | Not Available | 620 | Open in IMG/M |
| 3300033557|Ga0316617_102425319 | Not Available | 544 | Open in IMG/M |
| 3300033814|Ga0364930_0109344 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 945 | Open in IMG/M |
| 3300033815|Ga0364946_135014 | Not Available | 565 | Open in IMG/M |
| 3300034165|Ga0364942_0246323 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
| 3300034177|Ga0364932_0125838 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 974 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 21.25% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 8.12% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 8.12% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 8.12% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 6.25% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 5.62% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.12% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.75% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 2.50% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 2.50% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.50% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.50% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 2.50% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.88% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 1.88% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.88% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.25% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.25% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.62% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.62% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater | 0.62% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.62% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.62% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.62% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.62% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.62% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.62% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.62% |
| Sediment | Engineered → Wastewater → Industrial Wastewater → Mine Water → Unclassified → Sediment | 0.62% |
| Enrichment Culture | Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Enrichment Culture | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000231 | Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- LI09_4 | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300002407 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 | Environmental | Open in IMG/M |
| 3300004049 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLC_D2 | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300005254 | Enrichment culture microbial communities from rom New York Harbor, USA that are MTBE-degrading - MTBE-NYH (New York Harbor Sulfidogenic) MetaG | Engineered | Open in IMG/M |
| 3300005833 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK | Environmental | Open in IMG/M |
| 3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009153 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009166 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
| 3300009430 | Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Big Spring | Environmental | Open in IMG/M |
| 3300009455 | Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Crystal Spring | Environmental | Open in IMG/M |
| 3300009870 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant | Engineered | Open in IMG/M |
| 3300011391 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT163_2 | Environmental | Open in IMG/M |
| 3300011413 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT231_2 | Environmental | Open in IMG/M |
| 3300011422 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT640_2 | Environmental | Open in IMG/M |
| 3300011436 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2 | Environmental | Open in IMG/M |
| 3300012039 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT534_2 | Environmental | Open in IMG/M |
| 3300012163 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT800_2 | Environmental | Open in IMG/M |
| 3300012166 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT660_2 | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300013315 | Sediment microbial communities from Acid Mine Drainage holding pond in Pittsburgh, PA, USA - 1B | Engineered | Open in IMG/M |
| 3300014315 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014867 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT433_16_10D | Environmental | Open in IMG/M |
| 3300014874 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_2_16_10D | Environmental | Open in IMG/M |
| 3300014881 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_1Da | Environmental | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
| 3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018070 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b1 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300019229 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_1_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020067 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT47_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
| 3300021859 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.306 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022185 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022214 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300025106 | Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Big Spring (SPAdes) | Environmental | Open in IMG/M |
| 3300025130 | Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Crystal Spring (SPAdes) | Environmental | Open in IMG/M |
| 3300025313 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025318 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1 | Environmental | Open in IMG/M |
| 3300027713 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027731 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027831 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027871 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027877 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027885 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes) | Environmental | Open in IMG/M |
| 3300027887 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 Bulk | Environmental | Open in IMG/M |
| 3300027890 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300028869 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_4 | Environmental | Open in IMG/M |
| 3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300030000 | I_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300030047 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_3 | Environmental | Open in IMG/M |
| 3300030613 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT92D227 | Environmental | Open in IMG/M |
| 3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
| 3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
| 3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
| 3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
| 3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
| 3300033416 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033434 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_b | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033481 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CT | Environmental | Open in IMG/M |
| 3300033483 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| 3300033487 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A | Environmental | Open in IMG/M |
| 3300033489 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214 | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| 3300033814 | Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17 | Environmental | Open in IMG/M |
| 3300033815 | Sediment microbial communities from East River floodplain, Colorado, United States - 31_s17 | Environmental | Open in IMG/M |
| 3300034165 | Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17 | Environmental | Open in IMG/M |
| 3300034177 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| TB_LI09_4DRAFT_101699761 | 3300000231 | Groundwater | MKVVYLALSLLPTLAVVTLAWYVIRAISVRVTWRETEVNRLDDEPA* |
| JGIcombinedJ13530_1032717942 | 3300001213 | Wetland | MRLAYLVLSLAPTAAVVTLAWYVIRAVSVRVVWRETTVRRLDDEPA* |
| C687J29651_101735672 | 3300002407 | Soil | MVLSLLPTVAVVTLAWFVVRAISVRVVWRASSARPLDDEAA* |
| Ga0055493_100345092 | 3300004049 | Natural And Restored Wetlands | MVRLAYLVLSLVPTAAVVALAWYVVRAVSVRVVWRETTDARHLDDRPAA* |
| Ga0069718_162553185 | 3300004481 | Sediment | MKLVYLAVSLLPTLAVVTLAWYVIRAISVRVTWRETEVRRLDDETA* |
| Ga0068714_101918871 | 3300005254 | Enrichment Culture | MRLVYLTLHVLPTLAVLALAWRVVRAVSVRVVWRDTTVPSLDDEPA* |
| Ga0074472_100298403 | 3300005833 | Sediment (Intertidal) | MKLAYLVMSLLPTVAVVTLAWFVIRAISVRVVWRESGVRRLDD |
| Ga0074472_110929202 | 3300005833 | Sediment (Intertidal) | MLRLSYLVMSLVPTAAVVALAWYVVRAVSVRVVWRETGAHSLDDGPAA* |
| Ga0074472_110935191 | 3300005833 | Sediment (Intertidal) | NDGMRLAYLVMSLLPTLAVVTLAWFVVRAISVRVVWREADGRRLDDEPA* |
| Ga0079037_1015493382 | 3300006224 | Freshwater Wetlands | MRLVYLVLSLAPTVVVVTLAWYVIRAVSVRVVWRESDTHRLDDEMA* |
| Ga0079037_1022259601 | 3300006224 | Freshwater Wetlands | MKFVYMAVSLLPTLAVVTLAWYVIRAISVRVTWRETEVHRLDDETA* |
| Ga0105095_100630922 | 3300009053 | Freshwater Sediment | MKVVYLTLSLLPTAAVLTLAWYVMRAISVRIVWREPEERRLDDKAA* |
| Ga0105090_103741792 | 3300009075 | Freshwater Sediment | MKLVYLVMSLLPTVAVVTLAWFVVRAISVRVVWRESGARRLDDEPA* |
| Ga0105106_102393013 | 3300009078 | Freshwater Sediment | RMKVVYLALSLLPTLAVVTLAWYVVRAISVRVTWRKTEVHRLDDEPA* |
| Ga0105098_107489442 | 3300009081 | Freshwater Sediment | LAYLVMSLLPTAAVICLAGYVVRAVSVRVVWREGDASRLDDEPAA* |
| Ga0105103_107010871 | 3300009085 | Freshwater Sediment | LVYLAISLLPPVAVVALAWYVVRAISVRVTWRETDVRRLDDEPA* |
| Ga0102851_100580173 | 3300009091 | Freshwater Wetlands | MRLVYLVLSLLPTLAVVTLAWYVFRAISVRVVWRQPVVRPLDDEPA* |
| Ga0102851_101643373 | 3300009091 | Freshwater Wetlands | MRLVYLVLSLAPTVAVVTLAWYVIRAISVRVVWRESDAHRLDDEMA* |
| Ga0102851_113784883 | 3300009091 | Freshwater Wetlands | MQLVYLVLSLAPTVAVVTLAWYVIRAVSVRVVWRETTIRRLDDEPA* |
| Ga0102851_119745711 | 3300009091 | Freshwater Wetlands | MKVVYLALSLLPTLAVVTLAWYVIRAISVRVTWREAEVHRLDDEPA* |
| Ga0102851_127994691 | 3300009091 | Freshwater Wetlands | MKLVYLVMSLLPTVAVVTLAWCVIRAISVRVVWRDTDVRRLDDEPA* |
| Ga0075418_103348321 | 3300009100 | Populus Rhizosphere | MMLSLLPALALVALAWFVVRAISVRVVWRGTGGRPLDDKTA* |
| Ga0115026_110250931 | 3300009111 | Wetland | MKLVYLVISLLPPVAVVALAWYVVRAISVRVTWRETDVRRLDDEPA* |
| Ga0105091_100561091 | 3300009146 | Freshwater Sediment | MKVVYLTLSLLPTAAVLTLAWYVVRAVSVRIVWRGSEERRLDDKAA* |
| Ga0105091_104653951 | 3300009146 | Freshwater Sediment | MLRLAYLFVSLVPTAAVVALAWYVVRAVSVRVVWREADARSLDDEPAA* |
| Ga0105091_104974061 | 3300009146 | Freshwater Sediment | MKAMYLTLSLLPTAAVVTLAWYLVRAVSIRIVWRDPEHRRLDDKAA* |
| Ga0105094_100212263 | 3300009153 | Freshwater Sediment | MKVVYLALSLLPTLAVVTLAWYVVRAISVRVTWRKTEVHRLDDEPA* |
| Ga0105100_107790431 | 3300009166 | Freshwater Sediment | MKVVYLTLSLLPTAAVLTLAWYVMRAISVRIVWREPEERR |
| Ga0113563_100783985 | 3300009167 | Freshwater Wetlands | MKLVYLVMSLLPTVAVVTLAWCVIRAISVRVVWRDTDVRRL |
| Ga0113563_104878802 | 3300009167 | Freshwater Wetlands | MRLVYLVLSLAPTVAVVTLAWYVIRAISVRVVWREGDTHRLDDGMA* |
| Ga0113563_109668872 | 3300009167 | Freshwater Wetlands | MKFVYMAVSLLPTLAVVTLAWYVVRAISVRVTWRKTDVHRLDDEPA* |
| Ga0113563_130325471 | 3300009167 | Freshwater Wetlands | MRLAYVVVSLVPTVAVVALAWMVLRAISVHVVWRKADRHHLDDEPA* |
| Ga0113563_137156261 | 3300009167 | Freshwater Wetlands | MKLVYLVMSLLPTAAVVTLAWFVVRAISVRVTWCETDVRRLDDEPA* |
| Ga0105096_105505541 | 3300009170 | Freshwater Sediment | MTLAYLVVSLLPILAIVTLAWFVVRAISVRVVWRESSVRRLDDEPA* |
| Ga0115028_102903213 | 3300009179 | Wetland | VRGDGIEEEDGRMRLVYLVLSLLPTLAVVTLAWYVFRAISVRVVWRQPVVRPLDDEPA* |
| Ga0115028_103432711 | 3300009179 | Wetland | MLMSLLPTAALVALAWYVVRAVSVRVVWRASGRSLDDKAA* |
| Ga0115028_111380581 | 3300009179 | Wetland | MRLVYLVTSLIPTVAVLTFAWYVIRAISVRVVWRESGVRRLDDEPA* |
| Ga0114938_10754612 | 3300009430 | Groundwater | MRLVYVVMSILPTAAVVTLAWFVVRAISVRVTWREADVRRLDDEPA* |
| Ga0114939_101835741 | 3300009455 | Groundwater | VREDEEEEEPRMKLVYLVISLLPPVAVVALAWYVVRAISVRVTWRETDVRRLDDEPA* |
| Ga0131092_114317193 | 3300009870 | Activated Sludge | MRLIYVMLSLLPTLAVVTLAWYVLRAISVRVVWRQTGRPLDDEPA* |
| Ga0137331_10217791 | 3300011391 | Soil | MSLLPTLAVVTLAWFVVRAISVRVVWRESGVRRLDDETA* |
| Ga0137333_10079311 | 3300011413 | Soil | MRLAYLVMSLLPTLVVVTLAWFVVRAISVRVVWREAEGRRLDDEPA* |
| Ga0137425_11749451 | 3300011422 | Soil | MRLAYLVMSLLPTLVVVTLAWFVVRAISVRVVWREADGRRLDDEPA* |
| Ga0137458_12226592 | 3300011436 | Soil | MRLIYLAMSLVPTLAVVTLACFVVRAISVRVVWRETDGRRLDDEPA* |
| Ga0137421_12187351 | 3300012039 | Soil | KGERRMRLAYLVMSLLPTLAVVTLAWFVVRAISVRVVWREADGRRLDDEPA* |
| Ga0137355_10074003 | 3300012163 | Soil | TLVVVTLAWFVVRAISVRVVWREADGRRLDDEPA* |
| Ga0137350_10710281 | 3300012166 | Soil | TLAVVTLAWFVVRAISVRVVWREADGRRLDDEPA* |
| Ga0153915_105807033 | 3300012931 | Freshwater Wetlands | MNVVYVTLSLLPTAAVVTLAWYLVRAISIRIVWREPENRRLDDKPA* |
| Ga0153915_117879571 | 3300012931 | Freshwater Wetlands | MKLVYLALSLLPTAAVVTLAWVVIRAISVRVVWRETDVHRLDDKPA* |
| Ga0153916_128779522 | 3300012964 | Freshwater Wetlands | MRFVYLAVSLLPTLAVVTLAWFVVRAISVRVVWRKADVRRLDDETA* |
| Ga0173609_101745182 | 3300013315 | Sediment | MKLVYLVISLLPPVAVVALAWYVVRAISVRVTWRESGARRLDDEPV* |
| Ga0075350_11415162 | 3300014315 | Natural And Restored Wetlands | SLLPPVAVVALAWYVVRAISVRVTWRETDVRRLDDEPA* |
| Ga0180076_10920692 | 3300014867 | Soil | ERRMRLAYLVMSLLPTLAVVTLAWFVVRAISVRVVWREADGRRLDDEPA* |
| Ga0180084_10063433 | 3300014874 | Soil | MRLAYLVMSLLPTLAVVTLAWFVVRAISVRVVWREAEGRRLDDEPA* |
| Ga0180094_11302822 | 3300014881 | Soil | MRLVYLVTSLIPTVAVLTFAWYVLRAISVRAVWRESGVRRLDDEPA* |
| Ga0187786_106405421 | 3300017944 | Tropical Peatland | MKAIYLTLSLLPTAAVVTLAWCVVRAISIRVVWREPDERRLDDKPA |
| Ga0187776_103316182 | 3300017966 | Tropical Peatland | MSMVYVALSLLPTAAVVILVWYVVRAISVRIVWREPVERRLDDKPA |
| Ga0187787_103310442 | 3300018029 | Tropical Peatland | MKVVYMTLSLLPTAAVVTLAWYVVRAISIRVVWREPEERRLDDKPA |
| Ga0184615_100394353 | 3300018059 | Groundwater Sediment | MVLSLLPTVAVVTLAWFVVRAISVRVVWRASSARPLDDEAA |
| Ga0184637_100184822 | 3300018063 | Groundwater Sediment | MVLSLLPTLAVVTLAWYVARAISVRVVWRETGGRPLDDKAA |
| Ga0184631_103941661 | 3300018070 | Groundwater Sediment | KEGERRMRLAYLVMSLLPTLAVVTLAWFVVRAISVRVVWRESGVRRLDDEPA |
| Ga0184640_104520052 | 3300018074 | Groundwater Sediment | LRLAYMVLSLLPTLAVVTLAWYVARAISVRVVWRETGGRPLDDKAA |
| Ga0184627_101300013 | 3300018079 | Groundwater Sediment | MVLSLLPTLAVVTLAWYVARAISVRVVWRETGGRPLDDKAAF |
| Ga0184639_103100981 | 3300018082 | Groundwater Sediment | MVLALLPTLAVVTLAWYVARAISVRVVWRETGGRPLDDKAA |
| Ga0187774_114891131 | 3300018089 | Tropical Peatland | MKVVYLTLSLLPTAAVVTLAWYVVRAVSIRIVWREPDERRLDDKPA |
| Ga0180116_12473581 | 3300019229 | Groundwater Sediment | MRLAYLVMSLLPTLAVVTLAWFVVRAISVRVVWRREADGRRLDDQPA |
| Ga0180109_11945561 | 3300020067 | Groundwater Sediment | MKLAYLVLSLAPTAAVVTLAWYVVRAVSVRVVWRETTVRRLDDEPA |
| Ga0210377_100212582 | 3300021090 | Groundwater Sediment | MRLAYLVMSLLPTLAVVTLAWFVVRAISVRVVWRESGVRRLDDEPA |
| Ga0210377_102331391 | 3300021090 | Groundwater Sediment | MRLIYLAMSLVPTLAVVTLACFVVRAISVRVVWRETDGRRLDDEPV |
| Ga0210334_105094002 | 3300021859 | Estuarine | SLLPTLLVVTLAWYVVRAVSVRIVWRGTAGRSLDDETA |
| Ga0210334_110535213 | 3300021859 | Estuarine | MRLAYLVMSLLPTLAVVTLAWFVVRAISVRVVWRESGVRRLDDETA |
| Ga0079039_13595152 | 3300022185 | Freshwater Wetlands | MRLVYLVLSLLPTLAVVTLAWYVFRAISVRVVWRQPVVRPLDDEPA |
| Ga0224505_103521982 | 3300022214 | Sediment | MTLVGLALSVLPTAAVLTLVWFVIRAISVRVVWRESGVRHLDDEPA |
| Ga0209398_11650661 | 3300025106 | Groundwater | MRLVYVVMSILPTAAVVTLAWFVVRAISVRVTWREADVRRLDDEPA |
| Ga0209594_12393561 | 3300025130 | Groundwater | VMSILPTAAVVTLAWFVVRAISVRVTWREADVRRLDDEPA |
| Ga0209431_100276854 | 3300025313 | Soil | DALRLVYMVLSLLPTVAVVTLAWFVVRAISVRVVWRASSARPLDDEAA |
| Ga0209519_107401671 | 3300025318 | Soil | MRLIYLAMSLLPTLAVVTLAFFVVRAISVRVVWREASGRRLDDGPA |
| Ga0209286_11159341 | 3300027713 | Freshwater Sediment | MKVVYLALSLLPTLAVVTLAWYVVRAISVRVTWRKTEVHRLDDEPA |
| Ga0209592_10813562 | 3300027731 | Freshwater Sediment | MKVVYLTLSLLPTAAVLTLAWYVMRAISVRIVWREPEERRLDDKAA |
| Ga0209797_103378512 | 3300027831 | Wetland Sediment | MLRVSYLVMSLVPTAAVVALAWYVVRAVSVRVVWRETGAHSLDDGPAA |
| Ga0209397_100959121 | 3300027871 | Wetland | MQLVYLVLSLAPTVAVVTLAWYVIRAVSVRVVWRETTIRRLDDEPA |
| Ga0209397_102838631 | 3300027871 | Wetland | MKLVYLVMSLLPTVAVVTLAWCVIRAISVRVVWRDTDVRRLDDEPA |
| Ga0209397_107188412 | 3300027871 | Wetland | MRLVYLVLSLAPTVVVVTLAWYVIRAVSVRVVWRESDTHRLDD |
| Ga0209293_100657431 | 3300027877 | Wetland | MKFVYMAVSLLPTLAVVTLAWYVIRAISVRVTWRETEVHRLDDETA |
| Ga0209450_100224894 | 3300027885 | Freshwater Lake Sediment | MKLVYLAVSVLPTLAVVTLAWYVIRAISVRVTWRKAEVDRLDDEPA |
| Ga0208980_101634362 | 3300027887 | Wetland | MKFVYLAESLLPTLAVVTLAWYVIRAISVRVTWRETEVRRLDDETA |
| Ga0208980_108103652 | 3300027887 | Wetland | MRLAYLVLSLAPTAAVVTLAWYVIRAVSVRVVWRETTVRRLDDEPA |
| Ga0209496_108564631 | 3300027890 | Wetland | MLMSLLPTVALVALAWYVVRAVSVRVVWRESDAHRLDDEMA |
| Ga0209254_100273853 | 3300027897 | Freshwater Lake Sediment | MRLAYLVVSLLPTVAVLTFAWYVVRAISVRVVWRESGVRRLDDEPA |
| Ga0209254_103620702 | 3300027897 | Freshwater Lake Sediment | MRLAYLVMSLLPTLVVVTLACFVVRAFSVRVVWRESGVRRLDDEPA |
| Ga0209668_101376022 | 3300027899 | Freshwater Lake Sediment | MKLAYLVMSLLPTAAVVTLAWFVVRAISVRVTWRETDVRRLDDEPA |
| Ga0209668_107480261 | 3300027899 | Freshwater Lake Sediment | MRLVYLVLSLAPPVAVVTLAWFVIRAVSVRVVWRESAVRRMDDEPA |
| Ga0209253_101805613 | 3300027900 | Freshwater Lake Sediment | MKLAYLAVSLLPTLAVVTLAWYVIRAISVRVTWRETEVHRLDDETA |
| Ga0209048_100414043 | 3300027902 | Freshwater Lake Sediment | MRFVFMAVSLLPTVAVVALAWYVVRAISVRVVWREGEVRHLDDEPA |
| Ga0209048_101049972 | 3300027902 | Freshwater Lake Sediment | VLYVFMAISLLPTVAVVALAWYVVRAISVRVVWRKGEVRHLDDEPA |
| Ga0307281_100333283 | 3300028803 | Soil | MRLIYLVTSLLPTAAVLTFAWYVFRAISVRVVWRESDVRRLDDEPA |
| Ga0307281_101460262 | 3300028803 | Soil | MRLAYLVASLLPTAAVLTFAWYVVRAISVRVVWRESDVRRLDDEPA |
| Ga0302263_100842243 | 3300028869 | Fen | PTLAVLALAWYVVRAISVRVVWREAVSDRLDDEPV |
| Ga0311332_103724642 | 3300029984 | Fen | MRLAYMTLSLLPTVAVVALAWMVVRAISVRVVWRDAAVRTLDDEPA |
| Ga0311337_114994431 | 3300030000 | Fen | TLSLLPTVAVVALAWMVVRAISVRVVWRDAAVRTLDDEPA |
| Ga0302286_104910282 | 3300030047 | Fen | MRLVYLAMHTLPTLAVLALAWYVVRAISVRVVWREAVSDRLDD |
| Ga0299915_100588953 | 3300030613 | Soil | MKLVYLALSLLPTLAVVTLAWFVVRAISVRVVWRETHTRRLDDKTA |
| Ga0299915_106262532 | 3300030613 | Soil | MKVVYLTLSLLPTAAVLTLAWYVVRAVSVRIVWREPEERRLDDKAA |
| Ga0247727_100841742 | 3300031576 | Biofilm | LRLVYMVLSLLPSLAVVTLAWYVVRAISVRIVWRETGGRPLDDKTA |
| Ga0315290_100708093 | 3300031834 | Sediment | MRLAYLVLSLLPTLAVVTLAWFVVRAISVRVVWRESGVRRLDDPTA |
| Ga0315290_103676572 | 3300031834 | Sediment | MRLAYLVISLLPTVAVVTLAWFVVRAISVRVVWREAGGRRLDDEPA |
| Ga0315297_105094712 | 3300031873 | Sediment | MRLAYLVLSLLPTLAVVTLAWFVVRAFSVRVVWRGSGVRRLDDEPA |
| Ga0214473_106104743 | 3300031949 | Soil | MRLVYVTLSLLPSAAVVVLAWCLIRAVSIRVVWRKGDVRRLDDEPA |
| Ga0326597_103359273 | 3300031965 | Soil | MVLSLLPTLVVVTLAWYVVRAISVRVVWRGTGGRSLDDKAV |
| Ga0315278_102535491 | 3300031997 | Sediment | SLLPTLAVVTLAWFVVRAISVRVVWRESGVRRLDDPTA |
| Ga0315278_110982551 | 3300031997 | Sediment | MRLAYLVISLLPTVAVLTFAWYVVRAISVRVVWRESGVRRLDDKPA |
| Ga0315292_100828522 | 3300032143 | Sediment | MRLAYLMMSLLPTLVVVTLAWFVVRAFSVRVVWRGSGVRRLDDEPA |
| Ga0315292_112130921 | 3300032143 | Sediment | VVSLLPTVAVLTFAWYVVRAISVRVVWRESGVRRLDDEPA |
| Ga0315283_104404371 | 3300032164 | Sediment | MRLAYLVVSLLPTVAVLTFAWYVVRAISVRVVWRESGVRRLDDETA |
| Ga0315271_102679801 | 3300032256 | Sediment | VLSLLPSVVVVTLAWFVLRAISVRVVWRSAGRPLDDKAA |
| Ga0315286_101994581 | 3300032342 | Sediment | MRLAYLVLSLLPTLAVVTLAWFVVRAISVRVVWRESGVRRLDDETA |
| Ga0315287_104716642 | 3300032397 | Sediment | MRLAYLVMSLLPTLAVVTLAWFVVRAISVRVVWRESGVRRLDDKTA |
| Ga0315275_107365473 | 3300032401 | Sediment | MRLAYLVMSLLPTLAVVTLAWFVVRAISVRVVWRESGVRRLDDPTA |
| Ga0315273_108936422 | 3300032516 | Sediment | MRFVYLVTSLVPTVAVLTFAWYVVRAISVRVVWRKSGVRRLDDEPA |
| Ga0335085_102343324 | 3300032770 | Soil | MKVVYLTLSLLPTAAVVTLAWYVVRAISIRVVWREPEERRLDDRPA |
| Ga0335079_103298703 | 3300032783 | Soil | MRLAYLVLSLAPTMAVLTLAWYVVRAISVRVVWRERTARHLDDELA |
| Ga0335070_101594373 | 3300032829 | Soil | MKVVYMTLSLLPTAAVVTLAWYVVRAISIRIVWREPEDRRLDDKPA |
| Ga0335070_120785751 | 3300032829 | Soil | LLPTAAVVTLAWYVVRAISIRVVWREPDERRLDDKPA |
| Ga0335084_106932882 | 3300033004 | Soil | MRVVYLALSVLPTAAVVTLAWCVVRAISIRIVWREPENRRLDDRPA |
| Ga0316605_104392823 | 3300033408 | Soil | MLMSLLPTAALVALAWYVVRAVSVRVVWRASGRSLDDKAA |
| Ga0316605_105769151 | 3300033408 | Soil | MKVVYLALSLLPTLAVVTLAWYVIRAISVRVTWREAEVHRLDDEPA |
| Ga0316605_120048501 | 3300033408 | Soil | DRRMKLAYLVVSLLPILAVVTLAWFVVRAISVRVVWRGSGVRRLDDEPA |
| Ga0316605_120206272 | 3300033408 | Soil | YMAVSLLPTLAVVTLAWYVIRAISVRVTWRETEVHRLDDETA |
| Ga0316619_102698992 | 3300033414 | Soil | MRLAYLVLSLAPTVAVVTLAWYVIRAVSVRVVWRETTVRRLDDEPA |
| Ga0316622_1007065273 | 3300033416 | Soil | MRLAYLVLSLAPTVAVVTLAWYVIRAVSVRVVWRETTVRRLDDETA |
| Ga0316622_1011749923 | 3300033416 | Soil | YLVTSLLPTAAVVTLAWYVIRAISVRVVWRETDGHRLDDEPA |
| Ga0316622_1020492583 | 3300033416 | Soil | MQLVYVMLSLLPTLAVVTLAWYVIRAISVRVTWRKAEVHRLD |
| Ga0316625_1019231311 | 3300033418 | Soil | MRLAYMALHLLPTLGVLALAWLVVRAISVRVVWRDTTVRDLDDEPA |
| Ga0326726_101993822 | 3300033433 | Peat Soil | MMRLAYLAVYLLPTVAVVALAWYVARAVSVRVVWRETERGLDDEPV |
| Ga0316613_101766603 | 3300033434 | Soil | DGRMRLVYLVLSLLPTLAVVTLAWYVFRAISVRVVWRQPVVRPLDDEPA |
| Ga0316613_108575962 | 3300033434 | Soil | MRLVYLVTSLIPTVAVLTFAWYVIRAISVRVVWRESGVRRLDDEPA |
| Ga0316613_109912492 | 3300033434 | Soil | EEARRMKVVYLALSLLPTLAVVTLAWYVIRAISVRVTWREAEVHRLDDEPA |
| Ga0316620_103677663 | 3300033480 | Soil | MRLVYLVLSLLPTLALVTLAWFIVRAISVRVVWREADVRRLDDEPA |
| Ga0316620_105988192 | 3300033480 | Soil | MRLAYVVLSLLPTLAVVTLAWYVVRAISVRVTWRETEVHRLDDETA |
| Ga0316600_105808972 | 3300033481 | Soil | LVYLVLSLLPTLAVVTLAWYVFRAISVRVVWRQPVVRPLDDEPA |
| Ga0316629_103962913 | 3300033483 | Soil | LLYLVLSLLPTAAVVTLAWYVIRAISVRVVWRESDVHRLDDGTA |
| Ga0316629_104739363 | 3300033483 | Soil | MQLVYLVLSLAPTVAVVTLAWYVIRAVSVRVVWRETTVRRLDDETA |
| Ga0316624_101209173 | 3300033486 | Soil | MKVVYLTLSLLPTAAVVTLAWYVVRAISIRIVWREPDERRLDDKPA |
| Ga0316624_113097891 | 3300033486 | Soil | RMRLAYVVLSLLPTLAVVTLAWYVVRAISVRVTWRETEVHRLDDETA |
| Ga0316630_105033401 | 3300033487 | Soil | AVSLLPTLAVVTLAWYVIRAISVRVTWRETEVHRLDDETA |
| Ga0299912_102796772 | 3300033489 | Soil | MKLVYLAVSLLPTLAVVTLAWYVIRAISVRVTWRETEVHRLDDETA |
| Ga0299912_110790011 | 3300033489 | Soil | MKLVYLALSLLPTLAVVTLAWYVIRAISVRVTWRETEVHRLDDEPA |
| Ga0316628_1031328041 | 3300033513 | Soil | MNVVYVALSLLPTAAVVTLAWYVVRAISIRIVWREPENRRLDDKPA |
| Ga0316628_1037344882 | 3300033513 | Soil | VAYLALSILPTAAVVTLAWYVVRAISIRVVWREPDERRLDDKPA |
| Ga0316616_1001387383 | 3300033521 | Soil | MVRLAYLVLSLAPTAAVVALAWYVVRAVSVRVVWRETDARPLDDGPAV |
| Ga0316616_1002994023 | 3300033521 | Soil | MRLAYLVLSLAPTVAVVTLAWYVIRAVSVRVVWRETTIRRLDDEPA |
| Ga0316616_1005307511 | 3300033521 | Soil | LPTLAVVTLAWYVVRAISVRVTWRETEVHRLDDETA |
| Ga0316616_1022021222 | 3300033521 | Soil | LVMSLLPTAAVVTLAWYVIRAISVRVVWREGDVRRLDDEPA |
| Ga0316616_1049429992 | 3300033521 | Soil | MTIVYLVVSLLPTLAVVTLAWYVVRAISVRVTWRKAHVRRLDDEPA |
| Ga0316617_1018340162 | 3300033557 | Soil | MRLVYLVLSLAPTVAVVTLAWYVIRAISVRVVWRESDAHRLDDGMA |
| Ga0316617_1024253191 | 3300033557 | Soil | MRLAYLVLSLLPTAAVLTLAWYVVRAVSVRIVWRDTGVRPLDDEPA |
| Ga0364930_0109344_386_511 | 3300033814 | Sediment | MVLSLLPTLAVVTLAWYVVRAISVRVVWRGTGGRSLDDKAV |
| Ga0364946_135014_251_376 | 3300033815 | Sediment | MVLSLLPTLAVVTLAWYVVRAISVRVVWRGTGGRPLDDKAA |
| Ga0364942_0246323_335_460 | 3300034165 | Sediment | MVLSLLPTLVVVTLAWYVVRAISVRVVWRGTGGRSLDDKAA |
| Ga0364932_0125838_406_531 | 3300034177 | Sediment | MVLSLLPTLAVVTLAWYVVRAISVRVVWRGTGGRSLDDKAA |
| ⦗Top⦘ |