| Basic Information | |
|---|---|
| Family ID | F040533 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 161 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MSSVVISGDTSGAITLSAPAVAGTNTATLPAATGTVM |
| Number of Associated Samples | 144 |
| Number of Associated Scaffolds | 161 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 90.00 % |
| % of genes near scaffold ends (potentially truncated) | 93.17 % |
| % of genes from short scaffolds (< 2000 bps) | 82.61 % |
| Associated GOLD sequencing projects | 124 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.19 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (45.963 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater (26.708 % of family members) |
| Environment Ontology (ENVO) | Unclassified (47.205 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (52.795 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 6.15% Coil/Unstructured: 93.85% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.19 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 161 Family Scaffolds |
|---|---|---|
| PF07460 | NUMOD3 | 5.59 |
| PF13884 | Peptidase_S74 | 2.48 |
| PF13392 | HNH_3 | 1.86 |
| PF09636 | XkdW | 1.86 |
| PF16778 | Phage_tail_APC | 0.62 |
| PF00149 | Metallophos | 0.62 |
| PF16510 | P22_portal | 0.62 |
| PF02945 | Endonuclease_7 | 0.62 |
| PF00386 | C1q | 0.62 |
| PF11651 | P22_CoatProtein | 0.62 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 66.46 % |
| Unclassified | root | N/A | 33.54 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000116|DelMOSpr2010_c10105879 | Not Available | 1048 | Open in IMG/M |
| 3300001850|RCM37_1396831 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 530 | Open in IMG/M |
| 3300003375|JGI26470J50227_1025322 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1243 | Open in IMG/M |
| 3300003809|Ga0007869_1005924 | Not Available | 1359 | Open in IMG/M |
| 3300003809|Ga0007869_1010424 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 910 | Open in IMG/M |
| 3300003819|Ga0007878_1019968 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 572 | Open in IMG/M |
| 3300004684|Ga0065168_1035314 | Not Available | 787 | Open in IMG/M |
| 3300004686|Ga0065173_1018961 | All Organisms → cellular organisms → Bacteria | 1262 | Open in IMG/M |
| 3300004686|Ga0065173_1060951 | Not Available | 682 | Open in IMG/M |
| 3300004692|Ga0065171_1028351 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 901 | Open in IMG/M |
| 3300004770|Ga0007804_1005623 | Not Available | 3925 | Open in IMG/M |
| 3300004770|Ga0007804_1084097 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 816 | Open in IMG/M |
| 3300004804|Ga0007796_10126147 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 778 | Open in IMG/M |
| 3300004804|Ga0007796_10142994 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 720 | Open in IMG/M |
| 3300005581|Ga0049081_10001434 | All Organisms → Viruses | 8981 | Open in IMG/M |
| 3300005582|Ga0049080_10015118 | All Organisms → Viruses → Predicted Viral | 2685 | Open in IMG/M |
| 3300006025|Ga0075474_10047435 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1461 | Open in IMG/M |
| 3300006026|Ga0075478_10010024 | All Organisms → Viruses → Predicted Viral | 3232 | Open in IMG/M |
| 3300006071|Ga0007876_1087739 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300006105|Ga0007819_1111798 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 536 | Open in IMG/M |
| 3300006123|Ga0007852_1063445 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 857 | Open in IMG/M |
| 3300006127|Ga0007805_1000770 | Not Available | 10816 | Open in IMG/M |
| 3300006802|Ga0070749_10252516 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Methylophilales phage MEP301 | 998 | Open in IMG/M |
| 3300006802|Ga0070749_10357640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 811 | Open in IMG/M |
| 3300006802|Ga0070749_10379142 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 783 | Open in IMG/M |
| 3300006810|Ga0070754_10168778 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1036 | Open in IMG/M |
| 3300006810|Ga0070754_10247704 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300006869|Ga0075477_10092003 | All Organisms → cellular organisms → Bacteria | 1304 | Open in IMG/M |
| 3300006919|Ga0070746_10094698 | All Organisms → Viruses → Predicted Viral | 1495 | Open in IMG/M |
| 3300007276|Ga0070747_1128865 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 919 | Open in IMG/M |
| 3300007344|Ga0070745_1274082 | Not Available | 606 | Open in IMG/M |
| 3300007346|Ga0070753_1274462 | Not Available | 607 | Open in IMG/M |
| 3300007542|Ga0099846_1117894 | Not Available | 970 | Open in IMG/M |
| 3300007722|Ga0105051_10192118 | All Organisms → Viruses → Predicted Viral | 1568 | Open in IMG/M |
| 3300008012|Ga0075480_10521875 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 570 | Open in IMG/M |
| 3300008267|Ga0114364_1191491 | Not Available | 513 | Open in IMG/M |
| 3300008448|Ga0114876_1273796 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 503 | Open in IMG/M |
| 3300009151|Ga0114962_10089516 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1935 | Open in IMG/M |
| 3300009175|Ga0073936_10166582 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1623 | Open in IMG/M |
| 3300009184|Ga0114976_10173430 | All Organisms → Viruses → Predicted Viral | 1198 | Open in IMG/M |
| 3300009422|Ga0114998_10222138 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 894 | Open in IMG/M |
| 3300009434|Ga0115562_1255784 | Not Available | 609 | Open in IMG/M |
| 3300009435|Ga0115546_1000309 | Not Available | 34638 | Open in IMG/M |
| 3300009443|Ga0115557_1323439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → unclassified Alcaligenaceae → Alcaligenaceae bacterium | 577 | Open in IMG/M |
| 3300009449|Ga0115558_1360389 | Not Available | 571 | Open in IMG/M |
| 3300009497|Ga0115569_10259956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → unclassified Alcaligenaceae → Alcaligenaceae bacterium | 777 | Open in IMG/M |
| 3300010368|Ga0129324_10355952 | Not Available | 569 | Open in IMG/M |
| 3300010883|Ga0133547_10897730 | Not Available | 1727 | Open in IMG/M |
| 3300012013|Ga0153805_1066418 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 611 | Open in IMG/M |
| 3300013372|Ga0177922_10552997 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 632 | Open in IMG/M |
| 3300014711|Ga0134314_106894 | Not Available | 740 | Open in IMG/M |
| 3300017697|Ga0180120_10174126 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 902 | Open in IMG/M |
| 3300017716|Ga0181350_1017891 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2000 | Open in IMG/M |
| 3300017722|Ga0181347_1036860 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1509 | Open in IMG/M |
| 3300017747|Ga0181352_1042241 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1346 | Open in IMG/M |
| 3300017753|Ga0181407_1114710 | Not Available | 674 | Open in IMG/M |
| 3300017756|Ga0181382_1044757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 1293 | Open in IMG/M |
| 3300017766|Ga0181343_1165654 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 613 | Open in IMG/M |
| 3300017774|Ga0181358_1079770 | Not Available | 1197 | Open in IMG/M |
| 3300017778|Ga0181349_1008634 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4262 | Open in IMG/M |
| 3300017785|Ga0181355_1042925 | All Organisms → Viruses → Predicted Viral | 1933 | Open in IMG/M |
| 3300017985|Ga0181576_10914144 | Not Available | 514 | Open in IMG/M |
| 3300020141|Ga0211732_1589650 | Not Available | 977 | Open in IMG/M |
| 3300020723|Ga0214249_1026815 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 911 | Open in IMG/M |
| 3300021142|Ga0214192_1067025 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1058 | Open in IMG/M |
| 3300021354|Ga0194047_10211261 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 767 | Open in IMG/M |
| 3300021438|Ga0213920_1045549 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 929 | Open in IMG/M |
| 3300021440|Ga0213919_1044445 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 945 | Open in IMG/M |
| 3300021956|Ga0213922_1103554 | Not Available | 573 | Open in IMG/M |
| 3300021963|Ga0222712_10665051 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 592 | Open in IMG/M |
| 3300022050|Ga0196883_1010159 | Not Available | 1110 | Open in IMG/M |
| 3300022158|Ga0196897_1014833 | Not Available | 960 | Open in IMG/M |
| 3300022183|Ga0196891_1009945 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Methylophilales phage HIM624-A | 1890 | Open in IMG/M |
| 3300022187|Ga0196899_1144189 | Not Available | 667 | Open in IMG/M |
| 3300022190|Ga0181354_1032397 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1713 | Open in IMG/M |
| 3300022555|Ga0212088_10619214 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 663 | Open in IMG/M |
| 3300022591|Ga0236341_1016143 | All Organisms → Viruses → Predicted Viral | 2418 | Open in IMG/M |
| 3300022937|Ga0255770_10193513 | All Organisms → Viruses → Predicted Viral | 1028 | Open in IMG/M |
| 3300023700|Ga0228707_1052032 | Not Available | 591 | Open in IMG/M |
| 3300024191|Ga0228636_1005739 | All Organisms → Viruses → Predicted Viral | 3057 | Open in IMG/M |
| 3300025168|Ga0209337_1173649 | Not Available | 906 | Open in IMG/M |
| 3300025316|Ga0209697_10510451 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 550 | Open in IMG/M |
| 3300025368|Ga0208620_1009856 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1177 | Open in IMG/M |
| 3300025369|Ga0208382_1023055 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 823 | Open in IMG/M |
| 3300025378|Ga0207960_1007737 | All Organisms → Viruses → Predicted Viral | 1543 | Open in IMG/M |
| 3300025378|Ga0207960_1038303 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 654 | Open in IMG/M |
| 3300025382|Ga0208256_1038360 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 675 | Open in IMG/M |
| 3300025383|Ga0208250_1000483 | Not Available | 11664 | Open in IMG/M |
| 3300025392|Ga0208380_1001439 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5470 | Open in IMG/M |
| 3300025392|Ga0208380_1009908 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1720 | Open in IMG/M |
| 3300025396|Ga0208874_1031293 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 804 | Open in IMG/M |
| 3300025400|Ga0208387_1014652 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1495 | Open in IMG/M |
| 3300025400|Ga0208387_1040329 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 759 | Open in IMG/M |
| 3300025400|Ga0208387_1054974 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 616 | Open in IMG/M |
| 3300025418|Ga0208253_1003924 | All Organisms → Viruses → Predicted Viral | 4159 | Open in IMG/M |
| 3300025425|Ga0208646_1041302 | Not Available | 920 | Open in IMG/M |
| 3300025430|Ga0208622_1033735 | Not Available | 982 | Open in IMG/M |
| 3300025466|Ga0208497_1020655 | All Organisms → cellular organisms → Bacteria | 1512 | Open in IMG/M |
| 3300025466|Ga0208497_1043613 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 919 | Open in IMG/M |
| 3300025606|Ga0207954_1009028 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3268 | Open in IMG/M |
| 3300025648|Ga0208507_1164277 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 601 | Open in IMG/M |
| 3300025652|Ga0208134_1169876 | Not Available | 532 | Open in IMG/M |
| 3300025655|Ga0208795_1035769 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1538 | Open in IMG/M |
| 3300025674|Ga0208162_1113259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 789 | Open in IMG/M |
| 3300025699|Ga0209715_1085363 | All Organisms → Viruses → Predicted Viral | 1209 | Open in IMG/M |
| 3300025759|Ga0208899_1072276 | All Organisms → Viruses → Predicted Viral | 1376 | Open in IMG/M |
| 3300025769|Ga0208767_1215139 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Methylophilales phage MEP301 | 632 | Open in IMG/M |
| 3300025782|Ga0208867_1028908 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 817 | Open in IMG/M |
| 3300025809|Ga0209199_1291299 | Not Available | 512 | Open in IMG/M |
| 3300025828|Ga0208547_1050808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 1438 | Open in IMG/M |
| 3300025853|Ga0208645_1114604 | Not Available | 1088 | Open in IMG/M |
| 3300025889|Ga0208644_1180713 | Not Available | 936 | Open in IMG/M |
| 3300025892|Ga0209630_10457152 | Not Available | 537 | Open in IMG/M |
| 3300025896|Ga0208916_10503384 | Not Available | 527 | Open in IMG/M |
| 3300026455|Ga0255155_1039410 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 816 | Open in IMG/M |
| 3300026460|Ga0247604_1050174 | All Organisms → Viruses → Predicted Viral | 1003 | Open in IMG/M |
| 3300027708|Ga0209188_1140194 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 923 | Open in IMG/M |
| 3300027734|Ga0209087_1222620 | Not Available | 711 | Open in IMG/M |
| 3300027744|Ga0209355_1129577 | Not Available | 1103 | Open in IMG/M |
| 3300027777|Ga0209829_10155458 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1040 | Open in IMG/M |
| 3300027777|Ga0209829_10428853 | Not Available | 506 | Open in IMG/M |
| 3300027785|Ga0209246_10233330 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 715 | Open in IMG/M |
| 3300027788|Ga0209711_10233012 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 831 | Open in IMG/M |
| 3300027798|Ga0209353_10211470 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 846 | Open in IMG/M |
| 3300027896|Ga0209777_10338955 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1149 | Open in IMG/M |
| 3300027896|Ga0209777_10588965 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 807 | Open in IMG/M |
| 3300027969|Ga0209191_1268965 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 643 | Open in IMG/M |
| 3300028025|Ga0247723_1022274 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2113 | Open in IMG/M |
| 3300028027|Ga0247722_10060680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Colwelliaceae → Colwellia → unclassified Colwellia → Colwellia sp. | 1446 | Open in IMG/M |
| 3300028027|Ga0247722_10121869 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 953 | Open in IMG/M |
| 3300028131|Ga0228642_1055831 | All Organisms → Viruses → Predicted Viral | 1060 | Open in IMG/M |
| 3300028280|Ga0228646_1098732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 714 | Open in IMG/M |
| 3300028338|Ga0247567_1050432 | Not Available | 1062 | Open in IMG/M |
| 3300031519|Ga0307488_10454147 | Not Available | 777 | Open in IMG/M |
| 3300031566|Ga0307378_11283911 | Not Available | 573 | Open in IMG/M |
| 3300031569|Ga0307489_11410276 | Not Available | 507 | Open in IMG/M |
| 3300031570|Ga0308144_1040835 | Not Available | 572 | Open in IMG/M |
| 3300031622|Ga0302126_10284657 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 561 | Open in IMG/M |
| 3300031638|Ga0302125_10261882 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 523 | Open in IMG/M |
| 3300031700|Ga0302130_1250581 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
| 3300031758|Ga0315907_10113353 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2318 | Open in IMG/M |
| 3300031952|Ga0315294_10763458 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 839 | Open in IMG/M |
| 3300032053|Ga0315284_12218393 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 547 | Open in IMG/M |
| 3300032073|Ga0315315_10609206 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1007 | Open in IMG/M |
| 3300032117|Ga0316218_1150477 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 868 | Open in IMG/M |
| 3300032462|Ga0335396_10181049 | All Organisms → Viruses → Predicted Viral | 1387 | Open in IMG/M |
| 3300032722|Ga0316231_1110616 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1325 | Open in IMG/M |
| 3300033996|Ga0334979_0385250 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 778 | Open in IMG/M |
| 3300034120|Ga0335056_0725040 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
| 3300034374|Ga0348335_029751 | All Organisms → Viruses → Predicted Viral | 2427 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 26.71% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 18.01% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 7.45% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 4.97% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.35% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 4.35% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 3.11% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 2.48% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 1.86% |
| Freshwater Lake Hypolimnion | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion | 1.86% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.86% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.86% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.24% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.24% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.24% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.24% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 1.24% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 1.24% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.24% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.24% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 1.24% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.62% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.62% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.62% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.62% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.62% |
| Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 0.62% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.62% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.62% |
| Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.62% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.62% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.62% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.62% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.62% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.62% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300001850 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2a | Environmental | Open in IMG/M |
| 3300003375 | Freshwater actinobacteria microbial communities from Trout Bog Lake, Wisconsin, USA - enrichment TB-E6 | Environmental | Open in IMG/M |
| 3300003809 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH03Jun09 | Environmental | Open in IMG/M |
| 3300003819 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH23Jun09 | Environmental | Open in IMG/M |
| 3300004684 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Jun09 (version 2) | Environmental | Open in IMG/M |
| 3300004686 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Oct08 (version 2) | Environmental | Open in IMG/M |
| 3300004692 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun07 (version 2) | Environmental | Open in IMG/M |
| 3300004770 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07 | Environmental | Open in IMG/M |
| 3300004804 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0M | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006071 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09 | Environmental | Open in IMG/M |
| 3300006104 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09.1 | Environmental | Open in IMG/M |
| 3300006105 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE07Jul09 | Environmental | Open in IMG/M |
| 3300006109 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH04Jul08 | Environmental | Open in IMG/M |
| 3300006123 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH28Sep08 | Environmental | Open in IMG/M |
| 3300006127 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE24Aug09 | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300007722 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (megahit assembly) | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009175 | Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009422 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 | Environmental | Open in IMG/M |
| 3300009434 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300009443 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421 | Environmental | Open in IMG/M |
| 3300009449 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426 | Environmental | Open in IMG/M |
| 3300009497 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014711 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0111 | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
| 3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017985 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020723 | Freshwater microbial communities from Trout Bog Lake, WI - 23JUN2009 hypolimnion | Environmental | Open in IMG/M |
| 3300021142 | Freshwater microbial communities from Trout Bog Lake, WI - 29JUL2008 epilimnion | Environmental | Open in IMG/M |
| 3300021354 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L221-5m | Environmental | Open in IMG/M |
| 3300021438 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG | Environmental | Open in IMG/M |
| 3300021440 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 3-17 MG | Environmental | Open in IMG/M |
| 3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022050 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v3) | Environmental | Open in IMG/M |
| 3300022158 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v3) | Environmental | Open in IMG/M |
| 3300022183 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022555 | Alinen_combined assembly | Environmental | Open in IMG/M |
| 3300022591 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S2 | Environmental | Open in IMG/M |
| 3300022937 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG | Environmental | Open in IMG/M |
| 3300023700 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17_Aug_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024191 | Seawater microbial communities from Monterey Bay, California, United States - 45D | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025316 | Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025368 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Jun08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025369 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE28Sep08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025378 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH29May08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025382 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22Jun08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025383 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025389 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Sep07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025392 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025396 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Oct08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025400 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025402 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH03Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025403 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH23Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025418 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Oct08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025423 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH15Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025425 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK8 (SPAdes) | Environmental | Open in IMG/M |
| 3300025430 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025466 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025606 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0M (SPAdes) | Environmental | Open in IMG/M |
| 3300025648 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025699 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025782 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE05Oct08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025809 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 (SPAdes) | Environmental | Open in IMG/M |
| 3300025828 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300025892 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026455 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8h | Environmental | Open in IMG/M |
| 3300026460 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 85R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027744 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027788 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028027 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 3H_FC | Environmental | Open in IMG/M |
| 3300028131 | Seawater microbial communities from Monterey Bay, California, United States - 53D | Environmental | Open in IMG/M |
| 3300028280 | Seawater microbial communities from Monterey Bay, California, United States - 58D | Environmental | Open in IMG/M |
| 3300028338 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 15R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
| 3300031569 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2 | Environmental | Open in IMG/M |
| 3300031570 | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB9_547_5m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031622 | Marine microbial communities from Western Arctic Ocean, Canada - CB4_20m | Environmental | Open in IMG/M |
| 3300031638 | Marine microbial communities from Western Arctic Ocean, Canada - CB4_surface | Environmental | Open in IMG/M |
| 3300031700 | Marine microbial communities from Western Arctic Ocean, Canada - CB9_surface | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
| 3300032117 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003 | Environmental | Open in IMG/M |
| 3300032462 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (spades assembly) | Environmental | Open in IMG/M |
| 3300032722 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18027 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSpr2010_101058794 | 3300000116 | Marine | MASIKLTGDTSGEITISAPAVAGTNTLTLPATTGTMALTSDISE |
| RCM37_13968312 | 3300001850 | Marine Plankton | MSSVVISGDTSGAITLAAPLVAGTNTLTPPAATATVLSTA |
| JGI26470J50227_10253221 | 3300003375 | Freshwater | MSSVVISGDTSGAITLAAPSVAGTNTITLPASTGTAMVNG |
| Ga0007869_10059243 | 3300003809 | Freshwater | MSSVVISGDSSGAITLAAPSVAGTNTISLPALTGTVGLSG |
| Ga0007869_10104242 | 3300003809 | Freshwater | MSSVIISGDTSGSITLASPSVAGTNTATFPAATGTVMVSGNMPAFSY |
| Ga0007878_10199682 | 3300003819 | Freshwater | MSSVIISGDTSGSITLASPSVAGTNTATFPAATGTVMVSGNMPAFSYYQSVAQTLA |
| Ga0065168_10353142 | 3300004684 | Freshwater | MSSIVISGDTSGAITLSAPAVSGTNTATLPAATGTVMVSGNMPA |
| Ga0065173_10189613 | 3300004686 | Freshwater | MAQISIAGDTSGAITIAAPSVAGTNTLTLPAATGTVLTSA |
| Ga0065173_10609511 | 3300004686 | Freshwater | MSSIVISGDTSGSITLSSPAVAGSNTVTMPAASGVCMVSGNM |
| Ga0065171_10283512 | 3300004692 | Freshwater | MSSMVLSGDTSGAITVTVPAVAGTNTATLPAATGTVMVSGNMPAFSAY |
| Ga0007804_10056231 | 3300004770 | Freshwater | MSSIVVSGDSSGAITLAAPSVAGTNTITMPATTGNMVTDNATQT |
| Ga0007804_10840972 | 3300004770 | Freshwater | MSSVVISGDTSGAITLSAPSVAGTNTATLPAATGTVMVSGNQPAFRA |
| Ga0007796_101261472 | 3300004804 | Freshwater | MSSVVISGDTSGAITLSAPAVAGTNTITLPASTGTIMVNGPAFS |
| Ga0007796_101429942 | 3300004804 | Freshwater | MSSVVISGDTSGTITLAAPAVSGTNTITLPAATGTMALYAAPQ |
| Ga0049081_1000143418 | 3300005581 | Freshwater Lentic | MASLVLTGDTSGQVTISAPAVAGTNTLTLQAATATNAVNKL |
| Ga0049080_100151181 | 3300005582 | Freshwater Lentic | MSSLVLTGDTSGAVTLAAPAVAGTNTLTLLAATATNSVNVSGTAVTL |
| Ga0075474_100474351 | 3300006025 | Aqueous | MASIKLTGDTSGEITISAPAVAGTNTLTLPASTSTIATTD |
| Ga0075478_100100241 | 3300006026 | Aqueous | MASIKLTGDTSGEITISAPAVAGTNTLTLPAETGNILTDGSALP |
| Ga0007876_10877391 | 3300006071 | Freshwater | MSSVVISGDSSGTITLAAPAVAGSNTITLPAQTGTSAVLSSAV |
| Ga0007882_101643561 | 3300006104 | Freshwater | MASINIAGDTSGSISLTVPSVAGTNTVTIPANSGVVMVSGNMPAFS |
| Ga0007819_11117982 | 3300006105 | Freshwater | MSSVVISGDTSGAITLTAPATAGTNTITLPAQTGTSAVLSSA |
| Ga0007870_10995551 | 3300006109 | Freshwater | MASINIAGDTSGSISLTVPSVAGTNTVTIPANSGVVMVSGNMPAFSAY |
| Ga0007852_10634453 | 3300006123 | Freshwater | MSSVVISGDTSGAITLSAPSVAGTNTATLPAATGTVMVSGNQPAFRAYSSGNFT |
| Ga0007805_10007701 | 3300006127 | Freshwater | MGGFMSSIVISGDTSGAITLAAPSVAGTNTATLPAATGTVMVSGNMP |
| Ga0070749_102525164 | 3300006802 | Aqueous | MASIKLRGDTSGELVIEAPAVAGTNTLTLPADTANILTDN |
| Ga0070749_103576401 | 3300006802 | Aqueous | MASINLKGTTSGEITISAPAVAGTNTLTIPASTGTMIINDGT |
| Ga0070749_103791421 | 3300006802 | Aqueous | MASIKLTGDTSGEITISAPAVAGTNTLTLPATTGSLMTSTFTGDIN |
| Ga0070754_101687784 | 3300006810 | Aqueous | MASIKLTGDTSGEITISSPAVAGTNTLTLPAETGNILTDGSALP |
| Ga0070754_102477043 | 3300006810 | Aqueous | MSSIKLQGSTSGEITISAPAVAGTNTLTLPAETGNILT |
| Ga0075477_100920031 | 3300006869 | Aqueous | MSSIKLTGDTSGEITISAPAVAGTNTLTLPAETGNIVT |
| Ga0070746_100946981 | 3300006919 | Aqueous | MASIKLTGDTSGEITISAPAVAGTNTLTLPASTGTVALTSDI |
| Ga0070747_11288651 | 3300007276 | Aqueous | MSSIVLTGDTSGAITVSAPAVAGTNTITMPSETGTLVSL |
| Ga0070745_12740823 | 3300007344 | Aqueous | MASIKLTGDTSGEITISAPAVAGTNTITLPASTGTMLDSNS |
| Ga0070753_12744621 | 3300007346 | Aqueous | MASIKISGDTSGEITISAPAVAGTNTITLPASTGT |
| Ga0099846_11178942 | 3300007542 | Aqueous | MASIKLTGDTSGEITISAPAVAGTNTLTLPAATGNILT |
| Ga0070751_13446111 | 3300007640 | Aqueous | MASIKLTGDTSGEITISAPAVAGTNTLTLPATTGTMALTSDISG |
| Ga0105051_101921181 | 3300007722 | Freshwater | MANVVLSGDTSGAITIAAPAEAGTNTLTLPASTGTLLT |
| Ga0075480_105218753 | 3300008012 | Aqueous | RIVLASIKLTGDTSGEITISAPAVAGTNTLTLPAETGNIITNDT* |
| Ga0114364_11914911 | 3300008267 | Freshwater, Plankton | MSSVVISGDTSGAITVLAPLVAGTNTLTLQAATATSAVNK |
| Ga0114876_12737962 | 3300008448 | Freshwater Lake | MASVVIKGDTSGQVTIAAPAVAVTNTITLPASTGTAIISDAS |
| Ga0114918_106654372 | 3300009149 | Deep Subsurface | MASLKLNGDASGEITISAPSVAGTNTLTLPATTET |
| Ga0114962_100895163 | 3300009151 | Freshwater Lake | MANVAISGDTSGAVTLTVPATAGTQTVTFPAATGTAMVSGNMPAF |
| Ga0073936_101665821 | 3300009175 | Freshwater Lake Hypolimnion | MSSIVISGDTSGAITLSAPAVSGTNTATIPAATGTVMV |
| Ga0114976_101734302 | 3300009184 | Freshwater Lake | MSSVVISGDTSGAITLAAPAVAGTNTITLPTGTGTML |
| Ga0114998_102221381 | 3300009422 | Marine | MSSIVLTGDTSGTITVSAPAVAGTRTLTLPAATGT |
| Ga0115562_12557843 | 3300009434 | Pelagic Marine | MSSIVLTGDTSGAITVSAPAVAGTNTITMPERSGTLAIDS |
| Ga0115546_100030956 | 3300009435 | Pelagic Marine | MADIVLTGDTSGSITVAAPAVAGTNTLTLPASTGT |
| Ga0115557_13234391 | 3300009443 | Pelagic Marine | MSSIVLTGDTSGAITVSAPAVAGTNTITMPASSGTLAIGDSTGS |
| Ga0115558_13603893 | 3300009449 | Pelagic Marine | MSSIVLTGDTSGTITVSAPAVAGTNTITLPASTGTLS |
| Ga0115569_102599564 | 3300009497 | Pelagic Marine | MSSIVLTGDTSGTVTVSAPAVAGTNTITMPASSGTLAIGDS |
| Ga0129324_103559523 | 3300010368 | Freshwater To Marine Saline Gradient | MASIKLTGDTSGEITISAPAVAGTNTLTLPASSGEITTGGN |
| Ga0133547_108977301 | 3300010883 | Marine | MASIKLTGDTSGVITVSAPAAAGTNTLTLPATTGTIL |
| Ga0153805_10664182 | 3300012013 | Surface Ice | MASLVLTGDTSGQVTVSAPAVAGTNTLTLQAATATNAVNTLATAVA |
| Ga0177922_105529971 | 3300013372 | Freshwater | MSSVVISGDTSGAVTLAAPAVAGTNTLTLLAATATSSVNILG |
| Ga0134314_1068942 | 3300014711 | Surface Water | MSSVVISGDTSGTVSLTVPAVAGTNTATLPAATGTVMVSGNMPAFSAWPSS |
| Ga0180120_101741263 | 3300017697 | Freshwater To Marine Saline Gradient | MADIVLTGDTSGAITIAAPAVAGTNTLTLPASTGTVTINS |
| Ga0181363_10265782 | 3300017707 | Freshwater Lake | MASVVLSGDTSGTITISAPAVSGSNTQTLVATTGTLAPI |
| Ga0181350_10178911 | 3300017716 | Freshwater Lake | MASLVLTGDTSGQVTIAAPAVAGTNTITLPASTGT |
| Ga0181347_10368604 | 3300017722 | Freshwater Lake | MASLVLTGDTSGQVTIAAPAVAGTNTLTLQAATATNSVNTLATAVAS |
| Ga0181352_10422411 | 3300017747 | Freshwater Lake | MSSVVISGDTSGAITVSAPAVAGTNTLTLQAATATSAVNL |
| Ga0181407_11147103 | 3300017753 | Seawater | MADIVLTGNTSGAITVAAPAVAGTNTLTLPASTGT |
| Ga0181382_10447571 | 3300017756 | Seawater | MAGIILTGDTSGTITVNAPAVAGTNTLTLPAETGNIITNDTSGTI |
| Ga0181343_11656541 | 3300017766 | Freshwater Lake | MSSVVISGDTSGAITLSAPAVAGTNTITLPASTGTVVT |
| Ga0181358_10797703 | 3300017774 | Freshwater Lake | MSSVVISGDTSGAITLSAPAVAGTNTLSLPAQTAT |
| Ga0181349_10086341 | 3300017778 | Freshwater Lake | MSSVVISGDTSGAITVSAPAVAGSNTLTLLAATATNSVNTLAT |
| Ga0181355_10429255 | 3300017785 | Freshwater Lake | MASLVLTGDTSGQVTIAAPAVAGTNTLTLQAATAT |
| Ga0181576_109141443 | 3300017985 | Salt Marsh | MASIKISGDTSGEITISAPAVAGTNTLTLPASTST |
| Ga0211732_15896501 | 3300020141 | Freshwater | MSSVVISGDTSGAATLTVAAAAGSPTLTLPTTTDTLVGRAT |
| Ga0214249_10268153 | 3300020723 | Freshwater | MSSVIISGDTSGAITLSAPAVAGTNTATLPSATGTVQVSGNMPA |
| Ga0214192_10670252 | 3300021142 | Freshwater | MGDSMSSMILNGDTSGAITVTVPSVAGTNTATLPAATGTVMVSGNMPAFSA |
| Ga0194047_102112613 | 3300021354 | Anoxic Zone Freshwater | MSSVVISGDTSGAITLSAPAVAGTNTITLPASTGTVALT |
| Ga0213920_10455491 | 3300021438 | Freshwater | MASIVVSGDTSGAITLSAPSVAGTNTITFPAATGT |
| Ga0213919_10444452 | 3300021440 | Freshwater | MSKIRISGDTSGLIDLQAPAVAGSNVLTLPAVTGTLAVDLSSNALTT |
| Ga0213922_11035541 | 3300021956 | Freshwater | MANVAISGDTSGAVTLTVPATAGTQTVTFPAATGTAMVSGNMPAFNV |
| Ga0222712_106650511 | 3300021963 | Estuarine Water | MSSVVISGDTSGTVTVAAPAVAGSNTLTLQAGTATNSMNTLSTA |
| Ga0196883_10101591 | 3300022050 | Aqueous | MASIKLTGDTSGEITISAPAVAGTNTLTLPAETGTVGIVGPTFK |
| Ga0196897_10148334 | 3300022158 | Aqueous | LASIKLTGDTSGEITISAPAVAGTNTLTLPASTSTIATTDD |
| Ga0196891_10099456 | 3300022183 | Aqueous | MASIKLTGDTSGDITISAPAVAGTNTLTLPASTGNVVIDSAT |
| Ga0196899_11441891 | 3300022187 | Aqueous | MSSIRIAGDTSGEIILSAPSVAGTNTITLPAVTGTILT |
| Ga0181354_10323973 | 3300022190 | Freshwater Lake | MSSVVISGDTSGAVTLAAPAVAGTNTLTLQAATATSSVNVL |
| Ga0212088_106192142 | 3300022555 | Freshwater Lake Hypolimnion | MSSISIAGDTSGSITLAAPAVAGTNTITLPASTGTVLT |
| Ga0236341_10161431 | 3300022591 | Freshwater | MGGVMSSVVISGDTSGSITLSAPAVSGTNTATLPAATGTVMVSGNMPAFSAY |
| Ga0255770_101935131 | 3300022937 | Salt Marsh | MASIKISGDTSGEITISAPAVAGTNTLTLPANSGEITVG |
| Ga0228707_10520322 | 3300023700 | Freshwater | MSSVVISGDTSGTITLQAPAAAGSTVINLPAVNGTAVVNSNAT |
| Ga0228636_10057396 | 3300024191 | Seawater | MASIKLTGDTSGEITISAPAVAGTNTLTLPATTGTTVVLS |
| Ga0209337_11736491 | 3300025168 | Marine | MASIKLTGDTSGVITVSAPASAGTNTITLPATTGT |
| Ga0209697_105104512 | 3300025316 | Freshwater Lake Hypolimnion | MSSIVISGDTSGAITVSAPAVSGTTTITLPATTGNAL |
| Ga0208620_10098561 | 3300025368 | Freshwater | MSSMILNGDTSGAITVTVPAVAGTNTATLPAATGTVMVSGNMPAFSYYPNATV |
| Ga0208382_10230551 | 3300025369 | Freshwater | MSSVVISGDTSGAITLSAPSVAGTNTATLPAATGTVMVSGNQPAFRAYSS |
| Ga0207960_10077373 | 3300025378 | Freshwater | MSSVVISGDTSGTVTVTVPSVAGTNTITMPALTGNALVSTGVSS |
| Ga0207960_10383032 | 3300025378 | Freshwater | MGDSMSSMILNGDTSGAITVTVPAVAGTNTATLPAATGTVMV |
| Ga0208256_10383601 | 3300025382 | Freshwater | MSSVVLNGDTSGAITLAVPSVAGTNTITLPAKTGTLGFSPY |
| Ga0208250_100048317 | 3300025383 | Freshwater | MGGFMSSIVISGDTSGAITLAAPSVAGTNTATLPASTGTVM |
| Ga0208257_10434831 | 3300025389 | Freshwater | MSSIVISGDTSGSITLSAPAVSGTNTATLPASSGVVMVSGNMPAFSAYAN |
| Ga0208380_10014391 | 3300025392 | Freshwater | MSSIVISGDTSGAITLAAPSVAGTNTATLPAAAGTVMVSGNM |
| Ga0208380_10099081 | 3300025392 | Freshwater | MSSIVISGDTSGAITLAAPSVAGTNTATLPAATGTVMVSGN |
| Ga0208874_10312931 | 3300025396 | Freshwater | MSSVVISGDTSGAITLSAPSVAGTNTATLPAATGTVMVSGNQP |
| Ga0208387_10146521 | 3300025400 | Freshwater | MSSIVISGDSSGSITLAAPSVAGINTITLPASTGTVQINNGPT |
| Ga0208387_10403291 | 3300025400 | Freshwater | MSSIVISGDTSGAITLAAPSVAGTNTATLPAAAGTVMVSGNMPAFRATSTGLNVTAS |
| Ga0208387_10549741 | 3300025400 | Freshwater | MSSVVLNGDTSGAITLAVPSVAGTNTITLPASTGTTALTSD |
| Ga0208876_10151213 | 3300025402 | Freshwater | MASINIAGDTSGSISLTVPSVAGTNTVTIPANSGVVMVSGNMPAFSVYLSTS |
| Ga0208745_10088261 | 3300025403 | Freshwater | MASINIAGDTSGSISLTVPSVAGTNTVTIPANSGVVMVSGNMPTF |
| Ga0208745_10474502 | 3300025403 | Freshwater | MSSVVISGDSSGAITLAAPSVAGTNTISLPALTGTVGLSGPAFSAFIS |
| Ga0208253_100392410 | 3300025418 | Freshwater | MSSVIISGDTSGAITLSAPAVAGTNTATLPSATGTVQVSG |
| Ga0208746_10598152 | 3300025423 | Freshwater | MSSVVISGDTSGAITLAAPSVAGTNTISLPALTGTVGLSGPAFSAFISTQSV |
| Ga0208646_10413023 | 3300025425 | Saline Lake | MANVVLSGNTSGAITIASPAVAGTNTLTLPATTGT |
| Ga0208622_10337352 | 3300025430 | Freshwater | MSSVVISGDSSGAITLAAPSVAGTNTISLPALTGT |
| Ga0208497_10206551 | 3300025466 | Freshwater | MSSVVISGDSSGAITLAAPSVAGTNTISLPALTGTVGLSGPA |
| Ga0208497_10436132 | 3300025466 | Freshwater | MSSVVLNGDTSGAITLAVPSVAGTNTITLPAKTGTLGFSPYSGQILMMGG |
| Ga0207954_10090284 | 3300025606 | Freshwater | MANVAISGDTSGAVTLTVPATAGTQTVTFPAATGTAMVSGNMPAFSAYQS |
| Ga0208507_11511822 | 3300025648 | Freshwater | MASINIAGDTSGSISLTVPSVAGTNTVTIPANSGVVMVSGNMPTFRAVSNITQSL |
| Ga0208507_11642771 | 3300025648 | Freshwater | MSSIVISGDTSGAITLAAPSVAGTNTITLPAGTGTAA |
| Ga0208134_11698761 | 3300025652 | Aqueous | MASIKLQGDTSGELTISAPAVAGTNTLTLPASTGTL |
| Ga0208795_10357691 | 3300025655 | Aqueous | MASINLKGTTSGEITISAPAVAGTNTLTIPASTGTMIIND |
| Ga0208162_11132591 | 3300025674 | Aqueous | MSSIKLTGDTSGEITISAPAVAGTNTLTLPASTGTMAL |
| Ga0209715_10853631 | 3300025699 | Pelagic Marine | MSSIVLTGDTSGAITVSAPAVAGTNTITMPASSGTLAIGDSTGSVIE |
| Ga0208899_10722763 | 3300025759 | Aqueous | MASIKLTGDTSGEITISAPAVAGTNTLTLPATTGT |
| Ga0208767_12151391 | 3300025769 | Aqueous | MSSIKLQGSTSGEITISAPAVAGTNTLTLPAKTGTI |
| Ga0208867_10289083 | 3300025782 | Freshwater | MSSVVISGDTSGAITLSAPSVAGTNTATLPAATGTVMVSGN |
| Ga0209199_12912991 | 3300025809 | Pelagic Marine | MSSIVLTGDTSGAITVSAPAVAGTNTITMPASSGTLAIDSTGSVIEELHSL |
| Ga0208547_10508081 | 3300025828 | Aqueous | MASIKLTGDTSGEITISAPAVAGTNTLTLPATTGTVGIVGPA |
| Ga0208645_11146041 | 3300025853 | Aqueous | MASIKIAGDTSGEITVSVPSVAGTNTLTLPANTGNIITTGDS |
| Ga0208644_11807132 | 3300025889 | Aqueous | MASIKLRGDTSGELVIEAPAVAGTNTLTLPADTANILTDNS |
| Ga0209630_104571521 | 3300025892 | Pelagic Marine | MADIVLTGNTSGAITVAAPAVAGTNTLTLPANTGN |
| Ga0208916_105033841 | 3300025896 | Aqueous | MASLVVSGDTSGAITLSAPAVSGTNTVTLPAATDTLV |
| Ga0255155_10394103 | 3300026455 | Freshwater | MASLVLTGDTSGQVTLAAPAVAGTSTITLQAATATMSV |
| Ga0247604_10501741 | 3300026460 | Seawater | MASIKLTGDTSGEITISAPAVAGTNTLTLPASTGTM |
| Ga0209188_11401944 | 3300027708 | Freshwater Lake | MSSLVLTGDTSGQVTLAAPAVAGTTTITMPAVTGTM |
| Ga0209087_12226201 | 3300027734 | Freshwater Lake | MSSVVISGDTSGAITLAAPAIAGTYTQTLPQITGTLGTL |
| Ga0209355_11295773 | 3300027744 | Freshwater Lake | MSSVIISGDTSGAITVAAPAVSGTNTLTLQAATATSAVNTLATAK |
| Ga0209829_101554581 | 3300027777 | Freshwater Lake | MSSVVISGDTSGAVTLTVPAVSGTNTATLPAATGTVMVSGNMP |
| Ga0209829_104288531 | 3300027777 | Freshwater Lake | MSSLVLTGDTSGQVTLAAPAVAGSNTITMQAATGTMSV |
| Ga0209246_102333302 | 3300027785 | Freshwater Lake | MSSVIISGDTSGAITLSAPAVAGTNTLTLQAATATSSVNILATAKAY |
| Ga0209711_102330121 | 3300027788 | Marine | MSSIVIAGNTSGAITIAAPAEAGLNTLTLPASTGT |
| Ga0209353_102114701 | 3300027798 | Freshwater Lake | MASLVLTGDTSGQVTIAAPAVAGTNTITLPASTGTAIISDASA |
| Ga0209777_103389552 | 3300027896 | Freshwater Lake Sediment | MGGSMSSVIIGGDTSGAITLAAPAVAGTNTATLPAA |
| Ga0209777_105889653 | 3300027896 | Freshwater Lake Sediment | MSSVVISGDTSGTITLSAPSVAGTNTITLPAASGTMALYAAPQ |
| Ga0209191_12689651 | 3300027969 | Freshwater Lake | MSSVVISGDTSGAITLAAPAVAGTNTLTLPALTGTI |
| Ga0247723_10222741 | 3300028025 | Deep Subsurface Sediment | MSSVVISGDTSGAITLSAPAVSGTNTATLPAATGTVMVSGNQPA |
| Ga0247722_100606803 | 3300028027 | Deep Subsurface Sediment | MSSVVISGDTSGAITLSAPAVAGTNTATLPAATGTVM |
| Ga0247722_101218691 | 3300028027 | Deep Subsurface Sediment | MASIVLNGDTSGSVTLSPPAVAGTQTVTLPAATGTVMVSGNMPAFSAYRASASD |
| Ga0228642_10558313 | 3300028131 | Seawater | MADIVLTGNTSGAITIAAPAVAGTNTLTLPASTATV |
| Ga0228646_10987321 | 3300028280 | Seawater | MASIKLTGDTSGEITISAPAVAGTNTLTLPATTGTTVVLSG |
| Ga0247567_10504321 | 3300028338 | Seawater | MASIKLTGDTSGEITISAPAVAGTNTLTLPASTGTMA |
| Ga0307488_104541473 | 3300031519 | Sackhole Brine | MANIVLTGDTSGAITIAAPAAAGTNTLTLPAETGTML |
| Ga0307378_112839112 | 3300031566 | Soil | MASIKLAGDTSGEITISAPAVAGTNTLTLPASSGTIVTDTGA |
| Ga0307489_114102761 | 3300031569 | Sackhole Brine | MADIVLTGDTSGAITVAAPAVAGTNTITLPAETGTIVTST |
| Ga0308144_10408352 | 3300031570 | Marine | MASIKLTGDTSGVITVSAPASAGTNTLTLPATTGTILDTNSA |
| Ga0302126_102846572 | 3300031622 | Marine | MSSIVIAGNTSGAITIAAPAEAGLNTLTLPASTGTVA |
| Ga0302125_102618822 | 3300031638 | Marine | MSSIVIAGNTSGAITIAAPAEAGLNTLTLPASTGTVAL |
| Ga0302130_12505812 | 3300031700 | Marine | MSSIVIAGNTSGAITIAAPAEAGLNTLTLPASTGTVALT |
| Ga0315907_101133531 | 3300031758 | Freshwater | MSSVIISGDTSGAITVSAPAVAGTNTLTLPATTGTVLADSTV |
| Ga0315294_107634582 | 3300031952 | Sediment | MASVVISGDTSGAATISAPAVAGTPTLTLPTTTDTLVG |
| Ga0315284_122183931 | 3300032053 | Sediment | MASVVLSGDTSGTITVSAPAVAGSNTQTLPAASGTIVVGSAAVSAT |
| Ga0315315_106092061 | 3300032073 | Seawater | MASIKLTGDTSGVITVSAPAAAGTNTLTLPATTGTILDTNSA |
| Ga0316218_11504771 | 3300032117 | Freshwater | MGDSMSSMILNGDTSGAITVTVPSVAGTNTATLPAATGTVMV |
| Ga0335396_101810491 | 3300032462 | Freshwater | MANVVLSGDTSGAITIAAPAVAGTNTLTLPASTGTL |
| Ga0316231_11106161 | 3300032722 | Freshwater | MANVAISGDTSGAVTLTVPATAGTQTVTFPAATGTAMVSGNMPAFSA |
| Ga0334979_0385250_3_149 | 3300033996 | Freshwater | MSSVIISGDTSGAITVSAPAVAGTNTLTLQAATATSAVNKLETAVASTS |
| Ga0335056_0725040_1_141 | 3300034120 | Freshwater | MASLVVSGDTSGAITIAAPAVAGTNTLTLPASTGTLVVTGGAQTIEF |
| Ga0348335_029751_1_129 | 3300034374 | Aqueous | MASIKLTGDTSGEITISAPAVAGTNTLTLPATTGTTVVLSDWT |
| ⦗Top⦘ |