Basic Information | |
---|---|
Family ID | F039532 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 163 |
Average Sequence Length | 43 residues |
Representative Sequence | MSYLDYLPADGNFSEEELWEAIAEANGLDVSEIMDGDLVEWL |
Number of Associated Samples | 116 |
Number of Associated Scaffolds | 163 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 84.66 % |
% of genes near scaffold ends (potentially truncated) | 14.11 % |
% of genes from short scaffolds (< 2000 bps) | 74.23 % |
Associated GOLD sequencing projects | 104 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.64 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (56.442 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (14.724 % of family members) |
Environment Ontology (ENVO) | Unclassified (25.153 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (33.129 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.86% β-sheet: 0.00% Coil/Unstructured: 67.14% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.64 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 163 Family Scaffolds |
---|---|---|
PF02467 | Whib | 19.63 |
PF00436 | SSB | 2.45 |
PF06067 | DUF932 | 2.45 |
PF10108 | DNA_pol_B_exo2 | 1.23 |
PF13481 | AAA_25 | 0.61 |
PF08401 | ArdcN | 0.61 |
PF00478 | IMPDH | 0.61 |
PF16945 | Phage_r1t_holin | 0.61 |
PF13392 | HNH_3 | 0.61 |
PF09723 | Zn-ribbon_8 | 0.61 |
PF01471 | PG_binding_1 | 0.61 |
PF02945 | Endonuclease_7 | 0.61 |
PF12957 | DUF3846 | 0.61 |
PF03767 | Acid_phosphat_B | 0.61 |
PF01510 | Amidase_2 | 0.61 |
COG ID | Name | Functional Category | % Frequency in 163 Family Scaffolds |
---|---|---|---|
COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 2.45 |
COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 2.45 |
COG2503 | Predicted secreted acid phosphatase | General function prediction only [R] | 0.61 |
COG3700 | Acid phosphatase, class B | Inorganic ion transport and metabolism [P] | 0.61 |
COG4227 | Antirestriction protein ArdC | Replication, recombination and repair [L] | 0.61 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 56.44 % |
All Organisms | root | All Organisms | 43.56 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2236876023|PC6_p0169971 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Terapinvirus → Terapinvirus terapin | 894 | Open in IMG/M |
2236876023|PC6_p0471821 | Not Available | 980 | Open in IMG/M |
3300000385|PR_CR_10_Liq_1_inCRDRAFT_1001570 | Not Available | 12632 | Open in IMG/M |
3300000385|PR_CR_10_Liq_1_inCRDRAFT_1002634 | Not Available | 8819 | Open in IMG/M |
3300001336|ML7_10000045 | Not Available | 101743 | Open in IMG/M |
3300001336|ML7_10147746 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 993 | Open in IMG/M |
3300001336|ML7_10222069 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 576 | Open in IMG/M |
3300001533|MLSed_10138197 | All Organisms → Viruses → Predicted Viral | 1053 | Open in IMG/M |
3300001836|RCM27_1061680 | Not Available | 691 | Open in IMG/M |
3300001839|RCM40_1045842 | All Organisms → Viruses → Predicted Viral | 1655 | Open in IMG/M |
3300001970|GOS2248_10041741 | All Organisms → Viruses → Predicted Viral | 2579 | Open in IMG/M |
3300001970|GOS2248_10049105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter | 3855 | Open in IMG/M |
3300002040|GOScombined01_100553177 | All Organisms → Viruses → Predicted Viral | 2068 | Open in IMG/M |
3300002197|metazooDRAFT_1223020 | Not Available | 659 | Open in IMG/M |
3300002201|metazooDRAFT_1275819 | Not Available | 946 | Open in IMG/M |
3300002202|metazooDRAFT_1267681 | Not Available | 813 | Open in IMG/M |
3300002408|B570J29032_108844967 | Not Available | 522 | Open in IMG/M |
3300002408|B570J29032_109041438 | Not Available | 575 | Open in IMG/M |
3300002733|codie8draft_1110961 | Not Available | 536 | Open in IMG/M |
3300002835|B570J40625_100048748 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6084 | Open in IMG/M |
3300002835|B570J40625_100162040 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2521 | Open in IMG/M |
3300002835|B570J40625_101019082 | Not Available | 706 | Open in IMG/M |
3300002856|draft_11518683 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5851 | Open in IMG/M |
3300004279|Ga0066605_10224537 | Not Available | 712 | Open in IMG/M |
3300004279|Ga0066605_10276345 | Not Available | 623 | Open in IMG/M |
3300004481|Ga0069718_13640788 | Not Available | 637 | Open in IMG/M |
3300005527|Ga0068876_10410704 | Not Available | 754 | Open in IMG/M |
3300005582|Ga0049080_10004485 | All Organisms → Viruses → Predicted Viral | 4862 | Open in IMG/M |
3300005611|Ga0074647_1038819 | Not Available | 601 | Open in IMG/M |
3300005613|Ga0074649_1094432 | All Organisms → Viruses → Predicted Viral | 1100 | Open in IMG/M |
3300005805|Ga0079957_1002329 | Not Available | 16754 | Open in IMG/M |
3300006802|Ga0070749_10222099 | All Organisms → Viruses → Predicted Viral | 1077 | Open in IMG/M |
3300006802|Ga0070749_10758884 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 516 | Open in IMG/M |
3300006810|Ga0070754_10000713 | Not Available | 29376 | Open in IMG/M |
3300007212|Ga0103958_1161622 | All Organisms → Viruses → Predicted Viral | 1710 | Open in IMG/M |
3300007214|Ga0103959_1255555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales | 1066 | Open in IMG/M |
3300007216|Ga0103961_1145361 | All Organisms → Viruses → Predicted Viral | 1369 | Open in IMG/M |
3300007538|Ga0099851_1024213 | All Organisms → Viruses → Predicted Viral | 2450 | Open in IMG/M |
3300007538|Ga0099851_1033596 | All Organisms → Viruses → Predicted Viral | 2048 | Open in IMG/M |
3300007538|Ga0099851_1331032 | Not Available | 534 | Open in IMG/M |
3300007539|Ga0099849_1024059 | Not Available | 2638 | Open in IMG/M |
3300007541|Ga0099848_1139621 | Not Available | 903 | Open in IMG/M |
3300007542|Ga0099846_1226138 | Not Available | 654 | Open in IMG/M |
3300007542|Ga0099846_1340771 | Not Available | 509 | Open in IMG/M |
3300007725|Ga0102951_1127295 | Not Available | 719 | Open in IMG/M |
3300007960|Ga0099850_1013655 | All Organisms → Viruses → Predicted Viral | 3645 | Open in IMG/M |
3300007960|Ga0099850_1170420 | Not Available | 868 | Open in IMG/M |
3300008110|Ga0114343_1086227 | Not Available | 1116 | Open in IMG/M |
3300009081|Ga0105098_10077206 | All Organisms → Viruses → Predicted Viral | 1402 | Open in IMG/M |
3300009081|Ga0105098_10113814 | All Organisms → Viruses → Predicted Viral | 1181 | Open in IMG/M |
3300009124|Ga0118687_10391676 | Not Available | 536 | Open in IMG/M |
3300009149|Ga0114918_10016863 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 5599 | Open in IMG/M |
3300009169|Ga0105097_10113226 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1486 | Open in IMG/M |
3300009243|Ga0103860_10041226 | Not Available | 895 | Open in IMG/M |
3300009450|Ga0127391_1018999 | All Organisms → Viruses → Predicted Viral | 1422 | Open in IMG/M |
3300009466|Ga0126448_1007167 | All Organisms → Viruses → Predicted Viral | 2876 | Open in IMG/M |
3300009469|Ga0127401_1005538 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3635 | Open in IMG/M |
3300009474|Ga0127390_1126195 | Not Available | 661 | Open in IMG/M |
3300009563|Ga0130030_1035193 | Not Available | 769 | Open in IMG/M |
3300010299|Ga0129342_1002842 | Not Available | 7715 | Open in IMG/M |
3300010354|Ga0129333_10131107 | All Organisms → Viruses → Predicted Viral | 2305 | Open in IMG/M |
3300010354|Ga0129333_10728780 | Not Available | 850 | Open in IMG/M |
3300010389|Ga0136549_10013099 | Not Available | 5389 | Open in IMG/M |
3300010389|Ga0136549_10055303 | All Organisms → Viruses → Predicted Viral | 2028 | Open in IMG/M |
3300012665|Ga0157210_1022496 | All Organisms → Viruses → Predicted Viral | 1012 | Open in IMG/M |
3300012717|Ga0157609_1089995 | Not Available | 520 | Open in IMG/M |
3300012990|Ga0159060_1030556 | All Organisms → Viruses → Predicted Viral | 1394 | Open in IMG/M |
3300012990|Ga0159060_1032437 | All Organisms → Viruses → Predicted Viral | 1353 | Open in IMG/M |
3300013004|Ga0164293_10357978 | Not Available | 994 | Open in IMG/M |
(restricted) 3300013122|Ga0172374_1034913 | All Organisms → Viruses → Predicted Viral | 2161 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10668294 | Not Available | 550 | Open in IMG/M |
(restricted) 3300013137|Ga0172375_10179978 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1670 | Open in IMG/M |
3300013372|Ga0177922_10544972 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1151 | Open in IMG/M |
3300013941|Ga0117792_1000193 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 7075 | Open in IMG/M |
3300014962|Ga0134315_1000413 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9646 | Open in IMG/M |
3300014962|Ga0134315_1040152 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 723 | Open in IMG/M |
3300016797|Ga0182090_1596632 | Not Available | 625 | Open in IMG/M |
3300017736|Ga0181365_1031821 | Not Available | 1330 | Open in IMG/M |
3300017777|Ga0181357_1005705 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 4990 | Open in IMG/M |
3300017788|Ga0169931_10013666 | Not Available | 11063 | Open in IMG/M |
3300017788|Ga0169931_10141641 | Not Available | 2181 | Open in IMG/M |
3300017987|Ga0180431_10333835 | All Organisms → Viruses → Predicted Viral | 1096 | Open in IMG/M |
3300017987|Ga0180431_10987456 | Not Available | 554 | Open in IMG/M |
3300017989|Ga0180432_10172386 | Not Available | 1758 | Open in IMG/M |
3300017989|Ga0180432_10270238 | Not Available | 1314 | Open in IMG/M |
3300017989|Ga0180432_10349296 | All Organisms → Viruses → Predicted Viral | 1113 | Open in IMG/M |
3300017989|Ga0180432_10550884 | Not Available | 830 | Open in IMG/M |
3300017989|Ga0180432_10712092 | Not Available | 704 | Open in IMG/M |
3300017991|Ga0180434_10127035 | All Organisms → Viruses → Predicted Viral | 2101 | Open in IMG/M |
3300017991|Ga0180434_11357800 | Not Available | 531 | Open in IMG/M |
3300017991|Ga0180434_11427633 | Not Available | 517 | Open in IMG/M |
3300017992|Ga0180435_10770482 | Not Available | 813 | Open in IMG/M |
3300018065|Ga0180430_10843187 | Not Available | 637 | Open in IMG/M |
3300018065|Ga0180430_10876327 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 624 | Open in IMG/M |
3300018065|Ga0180430_11229711 | Not Available | 526 | Open in IMG/M |
3300018080|Ga0180433_11372749 | Not Available | 508 | Open in IMG/M |
3300018420|Ga0181563_10558244 | Not Available | 639 | Open in IMG/M |
3300019096|Ga0188835_1007902 | Not Available | 964 | Open in IMG/M |
3300020048|Ga0207193_1199824 | Not Available | 1582 | Open in IMG/M |
3300020312|Ga0211542_1075119 | Not Available | 598 | Open in IMG/M |
3300020438|Ga0211576_10047418 | All Organisms → Viruses → Predicted Viral | 2467 | Open in IMG/M |
3300020498|Ga0208050_1011216 | Not Available | 998 | Open in IMG/M |
3300020551|Ga0208360_1029591 | Not Available | 713 | Open in IMG/M |
3300020564|Ga0208719_1087535 | Not Available | 526 | Open in IMG/M |
3300021347|Ga0213862_10179183 | Not Available | 746 | Open in IMG/M |
3300021373|Ga0213865_10021998 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3601 | Open in IMG/M |
3300021961|Ga0222714_10221658 | Not Available | 1078 | Open in IMG/M |
3300021961|Ga0222714_10250759 | Not Available | 993 | Open in IMG/M |
3300022176|Ga0212031_1089625 | Not Available | 525 | Open in IMG/M |
3300022179|Ga0181353_1058243 | All Organisms → Viruses → Predicted Viral | 1002 | Open in IMG/M |
3300022190|Ga0181354_1101349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 938 | Open in IMG/M |
3300022198|Ga0196905_1041817 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1333 | Open in IMG/M |
3300022198|Ga0196905_1117577 | Not Available | 699 | Open in IMG/M |
3300022198|Ga0196905_1121520 | Not Available | 684 | Open in IMG/M |
3300022198|Ga0196905_1129596 | Not Available | 657 | Open in IMG/M |
3300022200|Ga0196901_1240393 | Not Available | 565 | Open in IMG/M |
3300022752|Ga0214917_10120009 | All Organisms → Viruses → Predicted Viral | 1470 | Open in IMG/M |
(restricted) 3300023109|Ga0233432_10009763 | Not Available | 7804 | Open in IMG/M |
(restricted) 3300023109|Ga0233432_10178302 | All Organisms → Viruses → Predicted Viral | 1083 | Open in IMG/M |
(restricted) 3300023109|Ga0233432_10213048 | Not Available | 953 | Open in IMG/M |
(restricted) 3300023109|Ga0233432_10429189 | Not Available | 570 | Open in IMG/M |
3300024239|Ga0247724_1022543 | Not Available | 915 | Open in IMG/M |
3300024239|Ga0247724_1022668 | Not Available | 912 | Open in IMG/M |
(restricted) 3300024264|Ga0233444_10057660 | All Organisms → Viruses → Predicted Viral | 2262 | Open in IMG/M |
3300024352|Ga0255142_1073415 | Not Available | 516 | Open in IMG/M |
3300024503|Ga0255152_1033448 | Not Available | 952 | Open in IMG/M |
3300025646|Ga0208161_1036646 | All Organisms → Viruses → Predicted Viral | 1678 | Open in IMG/M |
3300025647|Ga0208160_1137912 | Not Available | 602 | Open in IMG/M |
3300025655|Ga0208795_1050070 | All Organisms → Viruses → Predicted Viral | 1238 | Open in IMG/M |
3300025671|Ga0208898_1011352 | All Organisms → Viruses → Predicted Viral | 4410 | Open in IMG/M |
3300025674|Ga0208162_1093759 | Not Available | 905 | Open in IMG/M |
3300025705|Ga0209374_1121136 | Not Available | 769 | Open in IMG/M |
3300025705|Ga0209374_1164952 | Not Available | 614 | Open in IMG/M |
3300025889|Ga0208644_1167983 | Not Available | 986 | Open in IMG/M |
3300026097|Ga0209953_1032850 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 813 | Open in IMG/M |
3300027721|Ga0209492_1144047 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 833 | Open in IMG/M |
3300027805|Ga0209229_10003337 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 6650 | Open in IMG/M |
3300027805|Ga0209229_10174552 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 965 | Open in IMG/M |
3300027805|Ga0209229_10527272 | Not Available | 502 | Open in IMG/M |
3300027956|Ga0209820_1206870 | Not Available | 548 | Open in IMG/M |
3300031787|Ga0315900_10174982 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1943 | Open in IMG/M |
3300031951|Ga0315904_11121266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 612 | Open in IMG/M |
3300031963|Ga0315901_10763326 | Not Available | 707 | Open in IMG/M |
3300032116|Ga0315903_10178032 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1917 | Open in IMG/M |
3300033979|Ga0334978_0198420 | Not Available | 985 | Open in IMG/M |
3300033981|Ga0334982_0006217 | Not Available | 7244 | Open in IMG/M |
3300033993|Ga0334994_0012334 | Not Available | 5831 | Open in IMG/M |
3300033996|Ga0334979_0107254 | All Organisms → Viruses → Predicted Viral | 1731 | Open in IMG/M |
3300034072|Ga0310127_001743 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 23773 | Open in IMG/M |
3300034073|Ga0310130_0021418 | All Organisms → Viruses → Predicted Viral | 2058 | Open in IMG/M |
3300034073|Ga0310130_0023733 | Not Available | 1935 | Open in IMG/M |
3300034073|Ga0310130_0050003 | All Organisms → Viruses → Predicted Viral | 1252 | Open in IMG/M |
3300034073|Ga0310130_0074631 | Not Available | 1010 | Open in IMG/M |
3300034073|Ga0310130_0090683 | Not Available | 916 | Open in IMG/M |
3300034073|Ga0310130_0312034 | Not Available | 502 | Open in IMG/M |
3300034092|Ga0335010_0128831 | All Organisms → Viruses → Predicted Viral | 1636 | Open in IMG/M |
3300034096|Ga0335025_0189089 | All Organisms → Viruses → Predicted Viral | 1170 | Open in IMG/M |
3300034104|Ga0335031_0058451 | All Organisms → Viruses → Predicted Viral | 2769 | Open in IMG/M |
3300034104|Ga0335031_0294558 | Not Available | 1058 | Open in IMG/M |
3300034272|Ga0335049_0800877 | Not Available | 558 | Open in IMG/M |
3300034279|Ga0335052_0208689 | All Organisms → Viruses → Predicted Viral | 1121 | Open in IMG/M |
3300034279|Ga0335052_0517671 | Not Available | 614 | Open in IMG/M |
3300034357|Ga0335064_0005825 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 6243 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 14.72% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 12.27% |
Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 9.20% |
Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 4.29% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.68% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 3.68% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 3.68% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 3.07% |
Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 3.07% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.45% |
Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 2.45% |
Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 1.84% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 1.84% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.84% |
Benthic Lake | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Benthic Lake | 1.84% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.84% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.23% |
Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 1.23% |
Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 1.23% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.23% |
Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.23% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.23% |
Enviromental | Environmental → Aquatic → Marine → Unclassified → Unclassified → Enviromental | 1.23% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.23% |
Saline Water Concentrator Pond | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water Concentrator Pond | 1.23% |
Hypersaline | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline | 1.23% |
Marine Methane Seep Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment | 1.23% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.23% |
Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 1.23% |
Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.61% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.61% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.61% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.61% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.61% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.61% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.61% |
Benthic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Benthic | 0.61% |
River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 0.61% |
Meromictic Pond | Environmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond | 0.61% |
Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.61% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.61% |
Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.61% |
Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 0.61% |
Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water And Sediment | 0.61% |
Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 0.61% |
Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.61% |
Coal-Bed Methane Well | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Coal-Bed Methane Well | 0.61% |
Epidermal Mucus | Host-Associated → Fish → Skin → Epidermal Mucus → Unclassified → Epidermal Mucus | 0.61% |
Hydrocarbon Resource Environments | Engineered → Biotransformation → Microbial Solubilization Of Coal → Unclassified → Unclassified → Hydrocarbon Resource Environments | 0.61% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2236876023 | Saline water concentrator pond microbial communities from Bras del Port saltern, Spain - PC6 | Environmental | Open in IMG/M |
3300000385 | Marine microbial community from Cabo Rojo, Puerto Rico - PR CR 10% Liquid 1 | Environmental | Open in IMG/M |
3300001336 | ML7 | Environmental | Open in IMG/M |
3300001533 | Benthic freshwater microbial communities from British Columbia, Canada | Environmental | Open in IMG/M |
3300001836 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM27, ROCA_DNA191_0.2um_MCP-N_C_3a | Environmental | Open in IMG/M |
3300001839 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM40, ROCA_DNA238_2.0um_Ob_C_3b | Environmental | Open in IMG/M |
3300001970 | Hypersaline microbial communities from Punta Cormorant, Floreana Island, Equador - GS033 | Environmental | Open in IMG/M |
3300002040 | GS000c - Sargasso Station 3 | Environmental | Open in IMG/M |
3300002197 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - DEC 2012 | Environmental | Open in IMG/M |
3300002201 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - SEP 2013 | Environmental | Open in IMG/M |
3300002202 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - SEP 2012 | Environmental | Open in IMG/M |
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300002733 | Coal-bed methane well microbial communities from Surat Basin, Queensland, Australia, Sample - Codie-8 produced water | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300002856 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Tailing Pond Surface TP_surface | Engineered | Open in IMG/M |
3300004279 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10m | Environmental | Open in IMG/M |
3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005611 | Saline surface water microbial communities from Etoliko Lagoon, Greece | Environmental | Open in IMG/M |
3300005613 | Saline sediment microbial communities from Etoliko Lagoon, Greece - sediment | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
3300007212 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Bottom layer) 7 sequencing projects | Environmental | Open in IMG/M |
3300007214 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface layer) 9 sequencing projects | Environmental | Open in IMG/M |
3300007216 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface and Bottom layer) 16 sequencing projects | Environmental | Open in IMG/M |
3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
3300007725 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MG | Environmental | Open in IMG/M |
3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009124 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsf | Environmental | Open in IMG/M |
3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009243 | Microbial communities of water from Amazon river, Brazil - RCM13 | Environmental | Open in IMG/M |
3300009450 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 4m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
3300009466 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 2m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
3300009469 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 6m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
3300009474 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 3m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
3300009563 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 5, Depth 6m; RNA IDBA-UD | Environmental | Open in IMG/M |
3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010389 | Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsf | Environmental | Open in IMG/M |
3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
3300012717 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES135 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012990 | Tailings pond microbial communities from Northern Alberta -TP6_2010 BML May 2015 | Engineered | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013122 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10.3m | Environmental | Open in IMG/M |
3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
3300013137 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1m | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300013941 | Epidermal mucus viral and microbial communities from European eel in Spain - water from Alfacada pond (Ebro delta) | Host-Associated | Open in IMG/M |
3300014962 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0309 | Environmental | Open in IMG/M |
3300016797 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041408BS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
3300017987 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_MS_1 metaG | Environmental | Open in IMG/M |
3300017989 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_MS_2 metaG | Environmental | Open in IMG/M |
3300017991 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_2 metaG | Environmental | Open in IMG/M |
3300017992 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_S_1 metaG | Environmental | Open in IMG/M |
3300018065 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_S_2 metaG | Environmental | Open in IMG/M |
3300018080 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_1 metaG | Environmental | Open in IMG/M |
3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300019096 | Metatranscriptome of marine microbial communities from Baltic Sea - GS676_0p1 | Environmental | Open in IMG/M |
3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
3300020312 | Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX556125-ERR598977) | Environmental | Open in IMG/M |
3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020551 | Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
3300020564 | Freshwater microbial communities from Lake Mendota, WI - 30JUL2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021347 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266 | Environmental | Open in IMG/M |
3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300022176 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2) | Environmental | Open in IMG/M |
3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
3300023109 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MG | Environmental | Open in IMG/M |
3300024239 | Subsurface sediment microbial communities from gas well in Oklahoma, United States - OK STACK MC-2-E | Environmental | Open in IMG/M |
3300024264 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MG | Environmental | Open in IMG/M |
3300024352 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_0h | Environmental | Open in IMG/M |
3300024503 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8h | Environmental | Open in IMG/M |
3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025705 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10m (SPAdes) | Environmental | Open in IMG/M |
3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
3300026097 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_restored_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300033979 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003 | Environmental | Open in IMG/M |
3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034072 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-A | Environmental | Open in IMG/M |
3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
3300034096 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15Oct2015-rr0098 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
3300034279 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163 | Environmental | Open in IMG/M |
3300034357 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME12May2017-rr0187 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
PC6_01699713 | 2236876023 | Saline Water Concentrator Pond | MAPNYYDYLPEGPFTEDDLWDAIAEAAGLDASEIADGDLAEWL |
PC6_04718212 | 2236876023 | Saline Water Concentrator Pond | MAPNYYDYLPEGNFTEDDLWEAIAEAAGVDVSEIADGDLVEWL |
PR_CR_10_Liq_1_inCRDRAFT_100157011 | 3300000385 | Enviromental | MSEPYWKYLPEGTFTEEELWEAIAEARGVDVSEIADGDLVEYL* |
PR_CR_10_Liq_1_inCRDRAFT_100263416 | 3300000385 | Enviromental | MAPNYYDYLPEGNFTEDDLWEAIAEAAGVDASEISDGDLVEWL* |
ML7_10000045111 | 3300001336 | Benthic Lake | MSYIDYLPEDGRFTEEELWEAIAEANGLDVNEIMDGDLVEWI* |
ML7_101477465 | 3300001336 | Benthic Lake | MSYLDYLPEDGNFTEEELWEAIAESKGIDVNEIMDGDLVEWL* |
ML7_102220691 | 3300001336 | Benthic Lake | MSYLDYLPEDGKFTEEELWEAIAEARGVDVNEIMDGDLCEFI* |
MLSed_101381976 | 3300001533 | Benthic | MSYLDYLPEDGNFTEEQLWEAIAEARGVDVNEIMDGDLVEWL* |
RCM27_10616801 | 3300001836 | Marine Plankton | HTRRLVLPSYIDFLPDSPFTEEELWQAIADANDLDYADIADGDLVDYL* |
RCM40_10458425 | 3300001839 | Marine Plankton | SYIDFLPDSPFTEEELWQAIADANDLDYADIADGDLVDYL* |
GOS2248_1004174110 | 3300001970 | Hypersaline | WKYLPEGTFTEDDLWEAIAESRGVDVSEIADGDLVEYL* |
GOS2248_100491059 | 3300001970 | Hypersaline | MAPNYYDYLPEGSYTEDDLWDAIAEAAGLDVSEIADGDLVEWL* |
GOScombined01_1005531774 | 3300002040 | Marine | MAPNYYDYLPEGSYTEDDLWDAIAEAAGLDASEIADGDLAEWL* |
metazooDRAFT_12230202 | 3300002197 | Lake | MSYLDYLPEDGNFTEEELWEAIADSIGVDMSEIMDGDLIDYI* |
metazooDRAFT_12758194 | 3300002201 | Lake | TFLEGLMSYLDYPPEDGNFTEEELWEAIADSIGVDMSEIMDGDLIDYI* |
metazooDRAFT_12676811 | 3300002202 | Lake | MSYIDYLPEDGNFSEEDLWEAIAESLGVDYSEIADEDLV |
B570J29032_1088449671 | 3300002408 | Freshwater | YLPADGNFSEEELWEAIAEANGLEVSEIMDGDLVEWI* |
B570J29032_1090414381 | 3300002408 | Freshwater | YLDYLPADGNFSEDELWEAIAEDLGVDPSEIMDGDLVDFI* |
codie8draft_11109612 | 3300002733 | Coal-Bed Methane Well | MSNPSYFDYLPDDGDFTEDDLWEAIAEANGLDVSEIMDGDLVDYL* |
B570J40625_10004874817 | 3300002835 | Freshwater | MSYLDYLPADGNFSEDELWEAIAEDLGVDPSEIMDGDLVDFI* |
B570J40625_1001620409 | 3300002835 | Freshwater | MNYLDYLPADGNFSEEELWEAIAEANGLEVSEIMDGDLVEWI* |
B570J40625_1010190822 | 3300002835 | Freshwater | VSEKAKKKTHYTDHLPENGLFTEDDLWQAIADANGVDVSEIADGDLVDWL* |
draft_1151868319 | 3300002856 | Hydrocarbon Resource Environments | MKDYLDYLPEDGIFSEEELWEAIAEAKGVDVSEIMDGDLVDYL* |
Ga0066605_102245372 | 3300004279 | Marine | MSYLDYLPEDGKFSEEELWEAIAESKGIDLNEIMDGDLAEWV* |
Ga0066605_102763453 | 3300004279 | Marine | MKRSYVEYLPEDGNFTEDDLWEAVAESQGIDVNEIMDGDLAEWL* |
Ga0069718_136407882 | 3300004481 | Sediment | MASYMEFLPADGNFTEDDLWEAIAEAAGLDVSEIADGDLVEWL* |
Ga0068876_104107043 | 3300005527 | Freshwater Lake | MSYFDYLPADGDFTEDELWEAIAEDLGVDPPEIMDGDLVDFI* |
Ga0049080_1000448517 | 3300005582 | Freshwater Lentic | MSYLDYLPADGNFSEDELWEAIAEDLGIDPSEIMDGDLVDFI* |
Ga0074647_10388191 | 3300005611 | Saline Water And Sediment | KGYMALLPEDGNFTEDDLWEAIAESNGVDVSEIMDGDLVEWL* |
Ga0074649_10944323 | 3300005613 | Saline Water And Sediment | MSYIDYLPEDGKFSEEQLWEAIAESLGVDANEIMDGDLVDYI* |
Ga0079957_100232914 | 3300005805 | Lake | MASYMEFLPEDGNFTEEDLWDAIAEANGLDASEIMDGDLAEWL* |
Ga0070749_102220995 | 3300006802 | Aqueous | MSYFDYLPADGYFSEEELWEAIAEANGLDVSEIMDGDLVEWI* |
Ga0070749_107588841 | 3300006802 | Aqueous | MNKPTYYDYLPEDGKFTEDDLWEAIAEANGVDYSEIADGDLCEWL* |
Ga0070754_1000071330 | 3300006810 | Aqueous | MSKPTYYDYLPEDGKFTEDDLWEAIAEANGVDYSEIADGDLCEWL* |
Ga0103958_11616223 | 3300007212 | Freshwater Lake | MPNYFDYLPEDGNFTEEELWEAIADANGLDVDDIMDGDLVEYL* |
Ga0103959_12555554 | 3300007214 | Freshwater Lake | MSYIDYLPEDGNFTEDDLWEAIADSLGIDPSEIMDGDLVDYL* |
Ga0103961_11453612 | 3300007216 | Freshwater Lake | MPSYFDYLPEDGNFTEEELWEAIADANGLDVDDIMDGDLVEYL* |
Ga0099851_102421311 | 3300007538 | Aqueous | MSYLDYLPADGNFSEEELWEAIAEANGLDVNEIMDGDLVEWI* |
Ga0099851_10335962 | 3300007538 | Aqueous | MSYLDYLPADGNFSEEELWEAIAEANGLDVNEIMDGDLVEWL* |
Ga0099851_13310322 | 3300007538 | Aqueous | MSYLDYLPADGNFSEEELWEAIAEANGLDVSEIMDGDLVEWI* |
Ga0099849_10240596 | 3300007539 | Aqueous | MAPNYYDYLPEGNFTEDDLWSAIAEAAGVDASEISDGDLVEWL* |
Ga0099848_11396212 | 3300007541 | Aqueous | MSYLDYLPEDGNFSEEELWEAIAEDLGIDPSEIMDGDLVDFI* |
Ga0099846_12261381 | 3300007542 | Aqueous | MSYIDFLPADGNFSEDELWEAIAEANGLDVSEIMDGDLVEWL* |
Ga0099846_13407711 | 3300007542 | Aqueous | MSYIDFLPADGNFSEDELWEAIAEANGLDVSEIMDGDLVEWI* |
Ga0102951_11272953 | 3300007725 | Water | MSYLDYLPEDGKFSEEELWEAIAESKGIDVNEIMDGDLVEWL* |
Ga0099850_101365513 | 3300007960 | Aqueous | MSYLDYLPSDGNFSEEELWEAIAEDLGIDPSEIMDGDLVDFI* |
Ga0099850_11704204 | 3300007960 | Aqueous | MSYLDYLPADGNFSEDELWEAIAEANGLDVNEIMDGDLVEWI* |
Ga0114343_10862274 | 3300008110 | Freshwater, Plankton | MSYFDYLPADGDFTEDELWEAIAEDLGIDPSEIMDGDLVDFI* |
Ga0105098_100772062 | 3300009081 | Freshwater Sediment | MSYLDHLPKCGKFSEEDLWEAIAEANGLDVNEIMDGDLVEWI* |
Ga0105098_101138144 | 3300009081 | Freshwater Sediment | MKKQSYYEYLPEDGKFTEEDLWEAIAEANGVDYSEIADGDLAEWL* |
Ga0118687_103916762 | 3300009124 | Sediment | MKMSEPYWNYLPEGTFSEDELWEAIAESKGIDVNEIMDGDLAEWL* |
Ga0114918_1001686313 | 3300009149 | Deep Subsurface | MDFLPEDGNFTEDDLWEAIAEANGVDASEIMDGDFVEWL* |
Ga0105097_101132264 | 3300009169 | Freshwater Sediment | MSYLDYLPQDGNFTEEELWEAIAEANGVDVYEIMDGDLVDFI* |
Ga0103860_100412262 | 3300009243 | River Water | LASYIDFLPDSPFTEEELWQAIADANDLDYADIADGDLVDYL* |
Ga0127391_10189993 | 3300009450 | Meromictic Pond | MSYLDYLPENGNFSEEELWEAIAEDLGIDPSEIMDGDLVDFI* |
Ga0126448_100716710 | 3300009466 | Meromictic Pond | MSYLDYLPADGNFSEEELWEAIAEDLGIDPSEIMDGDLVDFI* |
Ga0127401_10055389 | 3300009469 | Meromictic Pond | MSYLNYLPADGNFSEDELWEAIAEANGLDVSEIMDGDLVEWI* |
Ga0127390_11261951 | 3300009474 | Meromictic Pond | MSYIDYLPEDGNFSEDELWEAIAESLGVDPSEIADGDLTEYL* |
Ga0130030_10351932 | 3300009563 | Meromictic Pond | MSYLDYLPADGNFSEDELWEAIAEANGLDVSEIMDGDLVEWI* |
Ga0129342_100284216 | 3300010299 | Freshwater To Marine Saline Gradient | MTDDQKPKKKSYLDYLPDGQFTEDDLWEAIAAANDVDYSEIADGDLVDWL* |
Ga0129333_101311074 | 3300010354 | Freshwater To Marine Saline Gradient | MSYIDFLPADGNFSEEELWEAIAEANGLDVNEIMDGDLVEWI* |
Ga0129333_107287804 | 3300010354 | Freshwater To Marine Saline Gradient | SRMSYLDYLPADGNFSEDELWEAIAEANGLDVNEIMDGDLVEWI* |
Ga0136549_1001309913 | 3300010389 | Marine Methane Seep Sediment | MSYIDYLPEDGRFSEEELWEAIAEANGLDVSEIMDGDLVEWI* |
Ga0136549_100553035 | 3300010389 | Marine Methane Seep Sediment | MPSYLDYLPEDGKFSEEELWEAIAESKGIDVNEIMDGDLCEFI* |
Ga0157210_10224961 | 3300012665 | Freshwater | VKKNPAYYDLLPEDGNFTEDDLWEAIAEANGMDASEIMDGDLCEWL* |
Ga0157609_10899951 | 3300012717 | Freshwater | VSEETKKKTHYTEHLPESGLFTEDDLWQAIADANGVDVSEIADGDLVDWL* |
Ga0159060_10305561 | 3300012990 | Hydrocarbon Resource Environments | MSYLDYLPEDGKFSEEELWEAIAESMGVDVNEIMDGDLVEFI* |
Ga0159060_10324373 | 3300012990 | Hydrocarbon Resource Environments | MNNPYWEYLPEGTFTESELWEAIAELQGVDVSEIMDGDLVEFI* |
Ga0164293_103579782 | 3300013004 | Freshwater | MSNEPNTNYLDHLPENGAFDEDDLWQAIADANGVDVSEIADGDLVDWI* |
(restricted) Ga0172374_10349138 | 3300013122 | Freshwater | MSYLDYLPEDGNFTEDDLWEAIADSLGIDPSEIMDGDLVDYL* |
(restricted) Ga0172367_106682942 | 3300013126 | Freshwater | MEFLPADGNFTEDDLWEAIAEANGLDVSEIADGDLVEWL* |
(restricted) Ga0172375_101799781 | 3300013137 | Freshwater | EDGNFTEDDLWEAIADSLGIDPSEIMDGDLVDYL* |
Ga0177922_105449723 | 3300013372 | Freshwater | MSYLDYLPADGDFTEDELWEAIAEDLGIDPSEIMDGDLVDFI* |
Ga0117792_100019311 | 3300013941 | Epidermal Mucus | MSYVDYLPEDGNFTEDELWDAIAESLGVDPSEIADGDLVEFL* |
Ga0134315_100041324 | 3300014962 | Surface Water | MSYIDYLPEDGNFTEDELWEAIAESLGVDYSEIADGDLVDFL* |
Ga0134315_10401523 | 3300014962 | Surface Water | MSYFDYLPEDGNFTEEDLWEAIAENLGLDVNEIMDGDLVDYL* |
Ga0182090_15966322 | 3300016797 | Salt Marsh | MSYMDFLPEDGNFTEGDLWEAIAEANGVDASEIMDGDLVEWL |
Ga0181365_10318213 | 3300017736 | Freshwater Lake | MGKSYMDSLPADGNFTEEELWEAIAESLGVEANEIMDGDLHEYL |
Ga0181357_10057055 | 3300017777 | Freshwater Lake | MGKSYMDSLPADGNFTEEELWEAIAESLGVEPEDIFDGDLVEYL |
Ga0169931_1001366620 | 3300017788 | Freshwater | VSYLDYLPEDGIFTEFDLWEAIADNLGVDMSEIMDGDLIDYI |
Ga0169931_101416413 | 3300017788 | Freshwater | MSYLDYLPEDGNFTEDDLWEAIADSLGIDPSEIMDGDLVDYL |
Ga0180431_103338355 | 3300017987 | Hypersaline Lake Sediment | MSEPYWKYLPEGTFSEDELWEAIAESKGIDVNEIMDGDLAEWL |
Ga0180431_109874561 | 3300017987 | Hypersaline Lake Sediment | DRTMSYIDYLPEDGCFTEDELWEAIAEANGLDVSEIADGDLVEWI |
Ga0180432_101723866 | 3300017989 | Hypersaline Lake Sediment | MSEPYWKYLPEGTFSEEELWEAIAESKGIDVNEIMDGDLAEWL |
Ga0180432_102702384 | 3300017989 | Hypersaline Lake Sediment | MSYLDYLPEDGRFSEEELWEAIAEDMGVDVYEIMDGDLVDFI |
Ga0180432_103492964 | 3300017989 | Hypersaline Lake Sediment | MSEPYWKYLPEDGNFTEEELWEAIAESKGIDVNEIMDGDLAEWL |
Ga0180432_105508843 | 3300017989 | Hypersaline Lake Sediment | MSYIDYLPEDGRFTEEELWEAIAEANGLDVSEIMDGDLVEWL |
Ga0180432_107120922 | 3300017989 | Hypersaline Lake Sediment | MALLPESGNFTEDDLWEAIAEANGVDVQEIADGDLVEWL |
Ga0180434_101270356 | 3300017991 | Hypersaline Lake Sediment | MSYIDYLPEDGRFTEDELWEAIAEANGLDVSEIMDGDLVEWL |
Ga0180434_113578002 | 3300017991 | Hypersaline Lake Sediment | MSYLDYLPEDGRFSEEELWEAIAEANGLDVSEIMDGDLVEWI |
Ga0180434_114276332 | 3300017991 | Hypersaline Lake Sediment | MPSYLDYLPEDGKFTEEELWEAIAESKGIDVNEIMDGDLAEWL |
Ga0180435_107704821 | 3300017992 | Hypersaline Lake Sediment | MSYLDYLPEDGKFTEEELWEAIAESKGIDVNEIMDGDLVEWL |
Ga0180430_108431872 | 3300018065 | Hypersaline Lake Sediment | MSYLDYLPEDGKFTEEELWEAIAESKGIDVNEIMDGDLAEWL |
Ga0180430_108763271 | 3300018065 | Hypersaline Lake Sediment | MAPKYHDYLPEGPFTEDDLWEAIAEAAGLDVSEIADGDLAERL |
Ga0180430_112297112 | 3300018065 | Hypersaline Lake Sediment | MSEPYWKYLPEGTFTEDDLWEAIAEARGVDVSEIADGDLVEYL |
Ga0180433_113727492 | 3300018080 | Hypersaline Lake Sediment | MPSYLDYLPEDGRFTEEELWEAIAESKGIDVNEIMDGDLAEWL |
Ga0181563_105582441 | 3300018420 | Salt Marsh | MSYLDYLPKDGKFSEEDLWEAIAESMGVDVNEIMDGDLVDFI |
Ga0188835_10079021 | 3300019096 | Freshwater Lake | MSYVDYLPEDGNFSEDELWEAIAESLGIDPSEIADGDLAEYL |
Ga0207193_11998242 | 3300020048 | Freshwater Lake Sediment | MTEENKKKHYFDFLPETGGFTEDDLWQAIADANDVDVSEIADGDLVDWL |
Ga0211542_10751192 | 3300020312 | Marine | MKPKTYLDYLPEDGNFTEDDLWEAIALAEGVDYDLSDGDLADYL |
Ga0211576_100474186 | 3300020438 | Marine | MSKPYWENLPKDGNFTEEDLWDAIAESLGVDSSEISDQDLVDYI |
Ga0208050_10112161 | 3300020498 | Freshwater | MSYLDYLPADGNFSEDELWEAIAEDLGVDPSEIMDGDLVDFI |
Ga0208360_10295912 | 3300020551 | Freshwater | MNYLDYLPADGNFSEEELWEAIAEANGLEVSEIMDGDLVEWI |
Ga0208719_10875352 | 3300020564 | Freshwater | MSNEPNTNYLDHLPENGAFDEDDLWQAIADANGVDVSEIADGDLVDWI |
Ga0213862_101791831 | 3300021347 | Seawater | MKPKTYLDYLPEDGNFTEEDLWEAIAIAEGSEYDLSDGDLADYL |
Ga0213865_100219982 | 3300021373 | Seawater | MSYLDYLPADGNFSEEELWEAIAEDLGIDPSEIMDGDLVDFI |
Ga0222714_102216582 | 3300021961 | Estuarine Water | MSYLDYLPADGDFTEDELWEAIAEDLGIDPSEIMDGDLVDFI |
Ga0222714_102507592 | 3300021961 | Estuarine Water | MAYFDYLPDRPFTEDELWDAIAEDLGVDPSEIADGDLVDYL |
Ga0212031_10896251 | 3300022176 | Aqueous | MSYLDYLPADGNFSEEELWEAIAEANGLDVSEIMDGDLVEWL |
Ga0181353_10582431 | 3300022179 | Freshwater Lake | MSYLDYLPADGNFSEDELWEAIAEDLGIDPSEIMDGDLVDFI |
Ga0181354_11013491 | 3300022190 | Freshwater Lake | PSKGYMEYLPADGNFTEDDLWEAIAEANGVDASEIMDGDLCEWL |
Ga0196905_10418174 | 3300022198 | Aqueous | MSYLDYLPADGNFSEEELWEAIAEANGLDVNEIMDGDLVEWL |
Ga0196905_11175772 | 3300022198 | Aqueous | MSYLDYLPSDGNFSEEELWEAIAEANGLDVSEIMDGDLVEWI |
Ga0196905_11215201 | 3300022198 | Aqueous | LWIGVSRMSYLDYLPSDGNFSEEELWEAIAEANGLDVSEIMDGDLVEWL |
Ga0196905_11295962 | 3300022198 | Aqueous | MSYLDYLPSDGNFSEEELWEAIAEDLGIDPSEIMDGDLVDFI |
Ga0196901_12403931 | 3300022200 | Aqueous | MSYIDFLPADGNFSEDELWEAIAEANGLDVNEIMDGDLVEWL |
Ga0214917_101200092 | 3300022752 | Freshwater | MPNPNYFDYLPDRNFTEGELWDAIAEANGLDVYDIMDGDLAEFL |
(restricted) Ga0233432_1000976312 | 3300023109 | Seawater | MSYLDYLPEDGKFSEEELWEAIAESKGIDVNEIMDGDLVEWL |
(restricted) Ga0233432_101783025 | 3300023109 | Seawater | MKRSYVEYLPEDGKFSEEELWEAIAESQGIDVNEIMDGDLAEWL |
(restricted) Ga0233432_102130486 | 3300023109 | Seawater | MKRSYVEYLPEDGNFTEDDLWEAVAESQGIDVNEIMD |
(restricted) Ga0233432_104291893 | 3300023109 | Seawater | MKRSYVEYLPEDGNFTEDDLWEAIAESKGIDVNEIMDGDLAEWL |
Ga0247724_10225431 | 3300024239 | Deep Subsurface Sediment | MSYLDYLPEDGNFSEDELWEAIAEDLGVDPSEIMDGDLVDFI |
Ga0247724_10226685 | 3300024239 | Deep Subsurface Sediment | MSYIDFLPADGNFSEDELWEAIAEANGLDVSEIMDGDLVEWI |
(restricted) Ga0233444_100576601 | 3300024264 | Seawater | MSYLDYLPEDGKFSEEELWESIAESKGIDVNEIMDGDLAEWL |
Ga0255142_10734153 | 3300024352 | Freshwater | MKNPSYYDYLPEDGNFTEEDLWEAIAEANGVDYSEIADGDLV |
Ga0255152_10334482 | 3300024503 | Freshwater | MKNPSYYDYLPEDGNFTEEDLWEAIAEANGVDYSEIADGDLVDYL |
Ga0208161_10366461 | 3300025646 | Aqueous | YIDFLPADGNFSEDELWEAIAEANGLDVNEIMDGDLVEWI |
Ga0208160_11379122 | 3300025647 | Aqueous | MSYLDYLPSDGNFSEEELWEAIAEANGLDVSEIMDGDLVEWL |
Ga0208795_10500702 | 3300025655 | Aqueous | MSYLDYLPADGNFSEEELWEAIAEANGLDVNEIMDGDLVEWI |
Ga0208898_10113524 | 3300025671 | Aqueous | MSKPTYYDYLPEDGKFTEDDLWEAIAEANGVDYSEIADGDLCEWL |
Ga0208162_10937592 | 3300025674 | Aqueous | MAPNYYDYLPEGNFTEDDLWSAIAEAAGVDASEISDGDLVEWL |
Ga0209374_11211362 | 3300025705 | Marine | MSYLDYLPEDGKFSEEELWEAIAESKGIDLNEIMDGDLAEWV |
Ga0209374_11649523 | 3300025705 | Marine | VEYLPEDGNFTEDDLWEAVAESQGIDVNEIMDGDLAEWL |
Ga0208644_11679832 | 3300025889 | Aqueous | MSYFDYLPADGYFSEEELWEAIAEANGLDVSEIMDGDLVEWI |
Ga0209953_10328502 | 3300026097 | Pond Water | MAPNYYDHLPEGDFTEDDLWEAIAEAAGLDASEIMDGDLAEWL |
Ga0209492_11440472 | 3300027721 | Freshwater Sediment | MSYLDYLPQDGNFTEEELWEAIAEANGVDVYEIMDGDLVDFI |
Ga0209229_1000333716 | 3300027805 | Freshwater And Sediment | MASYMEFLPADGNFTEDDLWEAIAEAAGLDVSEIADGDLVEWL |
Ga0209229_101745521 | 3300027805 | Freshwater And Sediment | MSYIDFLPADGNFSEEELWEAIAEANGLDVNEIMDGDLVEWI |
Ga0209229_105272721 | 3300027805 | Freshwater And Sediment | MSYLDYLPADGDFTEEELWEAIAEDLGIDPSEIMDGDLVDFI |
Ga0209820_12068702 | 3300027956 | Freshwater Sediment | MSYLDHLPKCGKFSEEDLWEAIAEANGLDVNEIMDGDLVEWI |
Ga0315900_101749824 | 3300031787 | Freshwater | SRMSYFDYLPADGDFTEDELWEAIAEDLGVDPSEIMDGDLVDFI |
Ga0315904_111212663 | 3300031951 | Freshwater | YIDYLPEDGNFTEDELWEAIAESLGVEYSEIADGDLAEFL |
Ga0315901_107633263 | 3300031963 | Freshwater | MSYFDYLPEDGNFTEDELWEAIAEDLGIDPSEIMDGDLVDFI |
Ga0315903_101780326 | 3300032116 | Freshwater | MSYFDYLPADGDFTEDELWEAIAEDLGIDPSEIMDGDLVDFI |
Ga0334978_0198420_514_633 | 3300033979 | Freshwater | MEFLPEDGNFTEEDLWDAIAEANGLDASEIMDGDLAEWL |
Ga0334982_0006217_4321_4449 | 3300033981 | Freshwater | MSYLDFLPADGNFSEDELWEAIAEDLGIDPSEIMDGDLVDFI |
Ga0334994_0012334_3079_3231 | 3300033993 | Freshwater | VSEKAKKKTHYTDHLPENGLFTEDDLWQAIADANGVDVSEIADGDLVDWL |
Ga0334979_0107254_1193_1345 | 3300033996 | Freshwater | VSEETKKKTHYTEHLPESGLFTEDDLWQAIADANGVDVSEIADGDLVDWL |
Ga0310127_001743_22185_22313 | 3300034072 | Fracking Water | MSYIDFLPADGNFSEEELWEAIAEANGLDVSEIMDGDLVEWI |
Ga0310130_0021418_1071_1199 | 3300034073 | Fracking Water | MSYIDYLPADGNFSEDELWEAIAEANGLDVNEIMDGDLVEWL |
Ga0310130_0023733_1645_1779 | 3300034073 | Fracking Water | MSKPYWHYLPEDGKFSEEDLWEAIAESRGIDVNEIMDGDLCEFI |
Ga0310130_0050003_835_963 | 3300034073 | Fracking Water | MSYLDYLPEDGRFTEEELWEAIAEDMGVDVYEIMDGDLVDFI |
Ga0310130_0074631_701_835 | 3300034073 | Fracking Water | MSKPYWHYLPEDGKFSEEDLWEAIAESRGVDVNEIMDGDLCEFI |
Ga0310130_0090683_163_318 | 3300034073 | Fracking Water | MRNTKGNSMNNPYWEYLPEGTFTEEELWEAIAESKGIDVNEIMDGDLVEFL |
Ga0310130_0312034_378_500 | 3300034073 | Fracking Water | MSYLDYLPEDGNFSEDELWEAIAEDLGIDPSEIMDGDLVDF |
Ga0335010_0128831_1485_1634 | 3300034092 | Freshwater | SEKAKKKTHYTDHLPENGLFTEDDLWQAIADANGVDVSEIADGDLVDWL |
Ga0335025_0189089_920_1039 | 3300034096 | Freshwater | MEFLPADGNFTEDDLWEAIAEAAGLDVSEIADGDLVEWL |
Ga0335031_0058451_2518_2646 | 3300034104 | Freshwater | MSYIDYLPADGNFSEDELWEAIAEANGLDVSEIMDGDLVEWL |
Ga0335031_0294558_391_519 | 3300034104 | Freshwater | MSYFDYLPEDGDFTEDELWEAIAEDLGIDPSEIMDGDLVDFI |
Ga0335049_0800877_452_556 | 3300034272 | Freshwater | MSYIDFLPADGDFTEDELWEAIAEDLGIDPSEIMD |
Ga0335052_0208689_686_814 | 3300034279 | Freshwater | MTYIDYLPADGNFSEEELWEAIAEDLGVDPSEIMDGDLVDFI |
Ga0335052_0517671_2_127 | 3300034279 | Freshwater | SYLDFLPADGNFSEDELWEAIAEDLGIDPSEIMDGDLVDFI |
Ga0335064_0005825_476_613 | 3300034357 | Freshwater | MKKQSYYEYLPEDGNFTEEDLWEAIAEANGVDYSEIADGDLAEWL |
⦗Top⦘ |