NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F039532

Metagenome / Metatranscriptome Family F039532

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F039532
Family Type Metagenome / Metatranscriptome
Number of Sequences 163
Average Sequence Length 43 residues
Representative Sequence MSYLDYLPADGNFSEEELWEAIAEANGLDVSEIMDGDLVEWL
Number of Associated Samples 116
Number of Associated Scaffolds 163

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 84.66 %
% of genes near scaffold ends (potentially truncated) 14.11 %
% of genes from short scaffolds (< 2000 bps) 74.23 %
Associated GOLD sequencing projects 104
AlphaFold2 3D model prediction Yes
3D model pTM-score0.64

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (56.442 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(14.724 % of family members)
Environment Ontology (ENVO) Unclassified
(25.153 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(33.129 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 32.86%    β-sheet: 0.00%    Coil/Unstructured: 67.14%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.64
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 163 Family Scaffolds
PF02467Whib 19.63
PF00436SSB 2.45
PF06067DUF932 2.45
PF10108DNA_pol_B_exo2 1.23
PF13481AAA_25 0.61
PF08401ArdcN 0.61
PF00478IMPDH 0.61
PF16945Phage_r1t_holin 0.61
PF13392HNH_3 0.61
PF09723Zn-ribbon_8 0.61
PF01471PG_binding_1 0.61
PF02945Endonuclease_7 0.61
PF12957DUF3846 0.61
PF03767Acid_phosphat_B 0.61
PF01510Amidase_2 0.61

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 163 Family Scaffolds
COG0629Single-stranded DNA-binding proteinReplication, recombination and repair [L] 2.45
COG2965Primosomal replication protein NReplication, recombination and repair [L] 2.45
COG2503Predicted secreted acid phosphataseGeneral function prediction only [R] 0.61
COG3700Acid phosphatase, class BInorganic ion transport and metabolism [P] 0.61
COG4227Antirestriction protein ArdCReplication, recombination and repair [L] 0.61


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A56.44 %
All OrganismsrootAll Organisms43.56 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2236876023|PC6_p0169971All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Terapinvirus → Terapinvirus terapin894Open in IMG/M
2236876023|PC6_p0471821Not Available980Open in IMG/M
3300000385|PR_CR_10_Liq_1_inCRDRAFT_1001570Not Available12632Open in IMG/M
3300000385|PR_CR_10_Liq_1_inCRDRAFT_1002634Not Available8819Open in IMG/M
3300001336|ML7_10000045Not Available101743Open in IMG/M
3300001336|ML7_10147746All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage993Open in IMG/M
3300001336|ML7_10222069All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage576Open in IMG/M
3300001533|MLSed_10138197All Organisms → Viruses → Predicted Viral1053Open in IMG/M
3300001836|RCM27_1061680Not Available691Open in IMG/M
3300001839|RCM40_1045842All Organisms → Viruses → Predicted Viral1655Open in IMG/M
3300001970|GOS2248_10041741All Organisms → Viruses → Predicted Viral2579Open in IMG/M
3300001970|GOS2248_10049105All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter3855Open in IMG/M
3300002040|GOScombined01_100553177All Organisms → Viruses → Predicted Viral2068Open in IMG/M
3300002197|metazooDRAFT_1223020Not Available659Open in IMG/M
3300002201|metazooDRAFT_1275819Not Available946Open in IMG/M
3300002202|metazooDRAFT_1267681Not Available813Open in IMG/M
3300002408|B570J29032_108844967Not Available522Open in IMG/M
3300002408|B570J29032_109041438Not Available575Open in IMG/M
3300002733|codie8draft_1110961Not Available536Open in IMG/M
3300002835|B570J40625_100048748All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6084Open in IMG/M
3300002835|B570J40625_100162040All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2521Open in IMG/M
3300002835|B570J40625_101019082Not Available706Open in IMG/M
3300002856|draft_11518683All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5851Open in IMG/M
3300004279|Ga0066605_10224537Not Available712Open in IMG/M
3300004279|Ga0066605_10276345Not Available623Open in IMG/M
3300004481|Ga0069718_13640788Not Available637Open in IMG/M
3300005527|Ga0068876_10410704Not Available754Open in IMG/M
3300005582|Ga0049080_10004485All Organisms → Viruses → Predicted Viral4862Open in IMG/M
3300005611|Ga0074647_1038819Not Available601Open in IMG/M
3300005613|Ga0074649_1094432All Organisms → Viruses → Predicted Viral1100Open in IMG/M
3300005805|Ga0079957_1002329Not Available16754Open in IMG/M
3300006802|Ga0070749_10222099All Organisms → Viruses → Predicted Viral1077Open in IMG/M
3300006802|Ga0070749_10758884All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage516Open in IMG/M
3300006810|Ga0070754_10000713Not Available29376Open in IMG/M
3300007212|Ga0103958_1161622All Organisms → Viruses → Predicted Viral1710Open in IMG/M
3300007214|Ga0103959_1255555All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales1066Open in IMG/M
3300007216|Ga0103961_1145361All Organisms → Viruses → Predicted Viral1369Open in IMG/M
3300007538|Ga0099851_1024213All Organisms → Viruses → Predicted Viral2450Open in IMG/M
3300007538|Ga0099851_1033596All Organisms → Viruses → Predicted Viral2048Open in IMG/M
3300007538|Ga0099851_1331032Not Available534Open in IMG/M
3300007539|Ga0099849_1024059Not Available2638Open in IMG/M
3300007541|Ga0099848_1139621Not Available903Open in IMG/M
3300007542|Ga0099846_1226138Not Available654Open in IMG/M
3300007542|Ga0099846_1340771Not Available509Open in IMG/M
3300007725|Ga0102951_1127295Not Available719Open in IMG/M
3300007960|Ga0099850_1013655All Organisms → Viruses → Predicted Viral3645Open in IMG/M
3300007960|Ga0099850_1170420Not Available868Open in IMG/M
3300008110|Ga0114343_1086227Not Available1116Open in IMG/M
3300009081|Ga0105098_10077206All Organisms → Viruses → Predicted Viral1402Open in IMG/M
3300009081|Ga0105098_10113814All Organisms → Viruses → Predicted Viral1181Open in IMG/M
3300009124|Ga0118687_10391676Not Available536Open in IMG/M
3300009149|Ga0114918_10016863All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon5599Open in IMG/M
3300009169|Ga0105097_10113226All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1486Open in IMG/M
3300009243|Ga0103860_10041226Not Available895Open in IMG/M
3300009450|Ga0127391_1018999All Organisms → Viruses → Predicted Viral1422Open in IMG/M
3300009466|Ga0126448_1007167All Organisms → Viruses → Predicted Viral2876Open in IMG/M
3300009469|Ga0127401_1005538All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3635Open in IMG/M
3300009474|Ga0127390_1126195Not Available661Open in IMG/M
3300009563|Ga0130030_1035193Not Available769Open in IMG/M
3300010299|Ga0129342_1002842Not Available7715Open in IMG/M
3300010354|Ga0129333_10131107All Organisms → Viruses → Predicted Viral2305Open in IMG/M
3300010354|Ga0129333_10728780Not Available850Open in IMG/M
3300010389|Ga0136549_10013099Not Available5389Open in IMG/M
3300010389|Ga0136549_10055303All Organisms → Viruses → Predicted Viral2028Open in IMG/M
3300012665|Ga0157210_1022496All Organisms → Viruses → Predicted Viral1012Open in IMG/M
3300012717|Ga0157609_1089995Not Available520Open in IMG/M
3300012990|Ga0159060_1030556All Organisms → Viruses → Predicted Viral1394Open in IMG/M
3300012990|Ga0159060_1032437All Organisms → Viruses → Predicted Viral1353Open in IMG/M
3300013004|Ga0164293_10357978Not Available994Open in IMG/M
(restricted) 3300013122|Ga0172374_1034913All Organisms → Viruses → Predicted Viral2161Open in IMG/M
(restricted) 3300013126|Ga0172367_10668294Not Available550Open in IMG/M
(restricted) 3300013137|Ga0172375_10179978All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1670Open in IMG/M
3300013372|Ga0177922_10544972All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1151Open in IMG/M
3300013941|Ga0117792_1000193All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon7075Open in IMG/M
3300014962|Ga0134315_1000413All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage9646Open in IMG/M
3300014962|Ga0134315_1040152All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage723Open in IMG/M
3300016797|Ga0182090_1596632Not Available625Open in IMG/M
3300017736|Ga0181365_1031821Not Available1330Open in IMG/M
3300017777|Ga0181357_1005705All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon4990Open in IMG/M
3300017788|Ga0169931_10013666Not Available11063Open in IMG/M
3300017788|Ga0169931_10141641Not Available2181Open in IMG/M
3300017987|Ga0180431_10333835All Organisms → Viruses → Predicted Viral1096Open in IMG/M
3300017987|Ga0180431_10987456Not Available554Open in IMG/M
3300017989|Ga0180432_10172386Not Available1758Open in IMG/M
3300017989|Ga0180432_10270238Not Available1314Open in IMG/M
3300017989|Ga0180432_10349296All Organisms → Viruses → Predicted Viral1113Open in IMG/M
3300017989|Ga0180432_10550884Not Available830Open in IMG/M
3300017989|Ga0180432_10712092Not Available704Open in IMG/M
3300017991|Ga0180434_10127035All Organisms → Viruses → Predicted Viral2101Open in IMG/M
3300017991|Ga0180434_11357800Not Available531Open in IMG/M
3300017991|Ga0180434_11427633Not Available517Open in IMG/M
3300017992|Ga0180435_10770482Not Available813Open in IMG/M
3300018065|Ga0180430_10843187Not Available637Open in IMG/M
3300018065|Ga0180430_10876327All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes624Open in IMG/M
3300018065|Ga0180430_11229711Not Available526Open in IMG/M
3300018080|Ga0180433_11372749Not Available508Open in IMG/M
3300018420|Ga0181563_10558244Not Available639Open in IMG/M
3300019096|Ga0188835_1007902Not Available964Open in IMG/M
3300020048|Ga0207193_1199824Not Available1582Open in IMG/M
3300020312|Ga0211542_1075119Not Available598Open in IMG/M
3300020438|Ga0211576_10047418All Organisms → Viruses → Predicted Viral2467Open in IMG/M
3300020498|Ga0208050_1011216Not Available998Open in IMG/M
3300020551|Ga0208360_1029591Not Available713Open in IMG/M
3300020564|Ga0208719_1087535Not Available526Open in IMG/M
3300021347|Ga0213862_10179183Not Available746Open in IMG/M
3300021373|Ga0213865_10021998All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3601Open in IMG/M
3300021961|Ga0222714_10221658Not Available1078Open in IMG/M
3300021961|Ga0222714_10250759Not Available993Open in IMG/M
3300022176|Ga0212031_1089625Not Available525Open in IMG/M
3300022179|Ga0181353_1058243All Organisms → Viruses → Predicted Viral1002Open in IMG/M
3300022190|Ga0181354_1101349All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales938Open in IMG/M
3300022198|Ga0196905_1041817All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1333Open in IMG/M
3300022198|Ga0196905_1117577Not Available699Open in IMG/M
3300022198|Ga0196905_1121520Not Available684Open in IMG/M
3300022198|Ga0196905_1129596Not Available657Open in IMG/M
3300022200|Ga0196901_1240393Not Available565Open in IMG/M
3300022752|Ga0214917_10120009All Organisms → Viruses → Predicted Viral1470Open in IMG/M
(restricted) 3300023109|Ga0233432_10009763Not Available7804Open in IMG/M
(restricted) 3300023109|Ga0233432_10178302All Organisms → Viruses → Predicted Viral1083Open in IMG/M
(restricted) 3300023109|Ga0233432_10213048Not Available953Open in IMG/M
(restricted) 3300023109|Ga0233432_10429189Not Available570Open in IMG/M
3300024239|Ga0247724_1022543Not Available915Open in IMG/M
3300024239|Ga0247724_1022668Not Available912Open in IMG/M
(restricted) 3300024264|Ga0233444_10057660All Organisms → Viruses → Predicted Viral2262Open in IMG/M
3300024352|Ga0255142_1073415Not Available516Open in IMG/M
3300024503|Ga0255152_1033448Not Available952Open in IMG/M
3300025646|Ga0208161_1036646All Organisms → Viruses → Predicted Viral1678Open in IMG/M
3300025647|Ga0208160_1137912Not Available602Open in IMG/M
3300025655|Ga0208795_1050070All Organisms → Viruses → Predicted Viral1238Open in IMG/M
3300025671|Ga0208898_1011352All Organisms → Viruses → Predicted Viral4410Open in IMG/M
3300025674|Ga0208162_1093759Not Available905Open in IMG/M
3300025705|Ga0209374_1121136Not Available769Open in IMG/M
3300025705|Ga0209374_1164952Not Available614Open in IMG/M
3300025889|Ga0208644_1167983Not Available986Open in IMG/M
3300026097|Ga0209953_1032850All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage813Open in IMG/M
3300027721|Ga0209492_1144047All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage833Open in IMG/M
3300027805|Ga0209229_10003337All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon6650Open in IMG/M
3300027805|Ga0209229_10174552All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium965Open in IMG/M
3300027805|Ga0209229_10527272Not Available502Open in IMG/M
3300027956|Ga0209820_1206870Not Available548Open in IMG/M
3300031787|Ga0315900_10174982All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1943Open in IMG/M
3300031951|Ga0315904_11121266All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria612Open in IMG/M
3300031963|Ga0315901_10763326Not Available707Open in IMG/M
3300032116|Ga0315903_10178032All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1917Open in IMG/M
3300033979|Ga0334978_0198420Not Available985Open in IMG/M
3300033981|Ga0334982_0006217Not Available7244Open in IMG/M
3300033993|Ga0334994_0012334Not Available5831Open in IMG/M
3300033996|Ga0334979_0107254All Organisms → Viruses → Predicted Viral1731Open in IMG/M
3300034072|Ga0310127_001743All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage23773Open in IMG/M
3300034073|Ga0310130_0021418All Organisms → Viruses → Predicted Viral2058Open in IMG/M
3300034073|Ga0310130_0023733Not Available1935Open in IMG/M
3300034073|Ga0310130_0050003All Organisms → Viruses → Predicted Viral1252Open in IMG/M
3300034073|Ga0310130_0074631Not Available1010Open in IMG/M
3300034073|Ga0310130_0090683Not Available916Open in IMG/M
3300034073|Ga0310130_0312034Not Available502Open in IMG/M
3300034092|Ga0335010_0128831All Organisms → Viruses → Predicted Viral1636Open in IMG/M
3300034096|Ga0335025_0189089All Organisms → Viruses → Predicted Viral1170Open in IMG/M
3300034104|Ga0335031_0058451All Organisms → Viruses → Predicted Viral2769Open in IMG/M
3300034104|Ga0335031_0294558Not Available1058Open in IMG/M
3300034272|Ga0335049_0800877Not Available558Open in IMG/M
3300034279|Ga0335052_0208689All Organisms → Viruses → Predicted Viral1121Open in IMG/M
3300034279|Ga0335052_0517671Not Available614Open in IMG/M
3300034357|Ga0335064_0005825All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon6243Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous14.72%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater12.27%
Hypersaline Lake SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment9.20%
Fracking WaterEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water4.29%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater3.68%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake3.68%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine3.68%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment3.07%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater3.07%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater2.45%
Meromictic PondEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond2.45%
LakeEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake1.84%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment1.84%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.84%
Benthic LakeEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Benthic Lake1.84%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.84%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater1.23%
Marine PlanktonEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton1.23%
Surface WaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water1.23%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater1.23%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater1.23%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh1.23%
EnviromentalEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Enviromental1.23%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.23%
Saline Water Concentrator PondEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water Concentrator Pond1.23%
HypersalineEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline1.23%
Marine Methane Seep SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment1.23%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment1.23%
Hydrocarbon Resource EnvironmentsEngineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments1.23%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment0.61%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic0.61%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton0.61%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.61%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.61%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment0.61%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater0.61%
BenthicEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Benthic0.61%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water0.61%
Meromictic PondEnvironmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond0.61%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface0.61%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.61%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water0.61%
WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water0.61%
Saline Water And SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water And Sediment0.61%
Saline Water And SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment0.61%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment0.61%
Coal-Bed Methane WellEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Coal-Bed Methane Well0.61%
Epidermal MucusHost-Associated → Fish → Skin → Epidermal Mucus → Unclassified → Epidermal Mucus0.61%
Hydrocarbon Resource EnvironmentsEngineered → Biotransformation → Microbial Solubilization Of Coal → Unclassified → Unclassified → Hydrocarbon Resource Environments0.61%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2236876023Saline water concentrator pond microbial communities from Bras del Port saltern, Spain - PC6EnvironmentalOpen in IMG/M
3300000385Marine microbial community from Cabo Rojo, Puerto Rico - PR CR 10% Liquid 1EnvironmentalOpen in IMG/M
3300001336ML7EnvironmentalOpen in IMG/M
3300001533Benthic freshwater microbial communities from British Columbia, CanadaEnvironmentalOpen in IMG/M
3300001836Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM27, ROCA_DNA191_0.2um_MCP-N_C_3aEnvironmentalOpen in IMG/M
3300001839Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM40, ROCA_DNA238_2.0um_Ob_C_3bEnvironmentalOpen in IMG/M
3300001970Hypersaline microbial communities from Punta Cormorant, Floreana Island, Equador - GS033EnvironmentalOpen in IMG/M
3300002040GS000c - Sargasso Station 3EnvironmentalOpen in IMG/M
3300002197Freshwater microbial communities from San Paulo Zoo lake, Brazil - DEC 2012EnvironmentalOpen in IMG/M
3300002201Freshwater microbial communities from San Paulo Zoo lake, Brazil - SEP 2013EnvironmentalOpen in IMG/M
3300002202Freshwater microbial communities from San Paulo Zoo lake, Brazil - SEP 2012EnvironmentalOpen in IMG/M
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300002733Coal-bed methane well microbial communities from Surat Basin, Queensland, Australia, Sample - Codie-8 produced waterEnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300002856Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Tailing Pond Surface TP_surfaceEngineeredOpen in IMG/M
3300004279Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10mEnvironmentalOpen in IMG/M
3300004481Combined Assembly of Gp0112041, Gp0112042, Gp0112043EnvironmentalOpen in IMG/M
3300005527Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaGEnvironmentalOpen in IMG/M
3300005582Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRFEnvironmentalOpen in IMG/M
3300005611Saline surface water microbial communities from Etoliko Lagoon, GreeceEnvironmentalOpen in IMG/M
3300005613Saline sediment microbial communities from Etoliko Lagoon, Greece - sedimentEnvironmentalOpen in IMG/M
3300005805Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USAEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300007212Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Bottom layer) 7 sequencing projectsEnvironmentalOpen in IMG/M
3300007214Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface layer) 9 sequencing projectsEnvironmentalOpen in IMG/M
3300007216Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface and Bottom layer) 16 sequencing projectsEnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007541Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaGEnvironmentalOpen in IMG/M
3300007542Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaGEnvironmentalOpen in IMG/M
3300007725Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MGEnvironmentalOpen in IMG/M
3300007960Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaGEnvironmentalOpen in IMG/M
3300008110Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NAEnvironmentalOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009124Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsfEnvironmentalOpen in IMG/M
3300009149Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaGEnvironmentalOpen in IMG/M
3300009169Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015EnvironmentalOpen in IMG/M
3300009243Microbial communities of water from Amazon river, Brazil - RCM13EnvironmentalOpen in IMG/M
3300009450Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 4m depth; DNA IDBA-UDEnvironmentalOpen in IMG/M
3300009466Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 2m depth; DNA IDBA-UDEnvironmentalOpen in IMG/M
3300009469Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 6m depth; DNA IDBA-UDEnvironmentalOpen in IMG/M
3300009474Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 3m depth; DNA IDBA-UDEnvironmentalOpen in IMG/M
3300009563Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 5, Depth 6m; RNA IDBA-UDEnvironmentalOpen in IMG/M
3300010299Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNAEnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010389Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsfEnvironmentalOpen in IMG/M
3300012665Freshwater microbial communities from Talbot River, Ontario, Canada - S11EnvironmentalOpen in IMG/M
3300012717Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES135 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012990Tailings pond microbial communities from Northern Alberta -TP6_2010 BML May 2015EngineeredOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300013122 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10.3mEnvironmentalOpen in IMG/M
3300013126 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10mEnvironmentalOpen in IMG/M
3300013137 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1mEnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300013941Epidermal mucus viral and microbial communities from European eel in Spain - water from Alfacada pond (Ebro delta)Host-AssociatedOpen in IMG/M
3300014962Surface water microbial communities from Bangladesh - BaraHaldiaSW0309EnvironmentalOpen in IMG/M
3300016797Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041408BS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017736Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.NEnvironmentalOpen in IMG/M
3300017777Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017788Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20LEnvironmentalOpen in IMG/M
3300017987Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_MS_1 metaGEnvironmentalOpen in IMG/M
3300017989Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_MS_2 metaGEnvironmentalOpen in IMG/M
3300017991Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_2 metaGEnvironmentalOpen in IMG/M
3300017992Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_S_1 metaGEnvironmentalOpen in IMG/M
3300018065Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_S_2 metaGEnvironmentalOpen in IMG/M
3300018080Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_1 metaGEnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019096Metatranscriptome of marine microbial communities from Baltic Sea - GS676_0p1EnvironmentalOpen in IMG/M
3300020048Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915EnvironmentalOpen in IMG/M
3300020312Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX556125-ERR598977)EnvironmentalOpen in IMG/M
3300020438Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942)EnvironmentalOpen in IMG/M
3300020498Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020551Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes)EnvironmentalOpen in IMG/M
3300020564Freshwater microbial communities from Lake Mendota, WI - 30JUL2009 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021347Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266EnvironmentalOpen in IMG/M
3300021373Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282EnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300022176Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2)EnvironmentalOpen in IMG/M
3300022179Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.NEnvironmentalOpen in IMG/M
3300022190Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.NEnvironmentalOpen in IMG/M
3300022198Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022200Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022752Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BBEnvironmentalOpen in IMG/M
3300023109 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MGEnvironmentalOpen in IMG/M
3300024239Subsurface sediment microbial communities from gas well in Oklahoma, United States - OK STACK MC-2-EEnvironmentalOpen in IMG/M
3300024264 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MGEnvironmentalOpen in IMG/M
3300024352Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_0hEnvironmentalOpen in IMG/M
3300024503Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8hEnvironmentalOpen in IMG/M
3300025646Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025647Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025655Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025671Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes)EnvironmentalOpen in IMG/M
3300025674Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025705Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10m (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300026097Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_restored_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300027721Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027805Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)EnvironmentalOpen in IMG/M
3300027956Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300031787Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300031963Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300033979Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003EnvironmentalOpen in IMG/M
3300033981Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011EnvironmentalOpen in IMG/M
3300033993Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037EnvironmentalOpen in IMG/M
3300033996Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004EnvironmentalOpen in IMG/M
3300034072Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-AEnvironmentalOpen in IMG/M
3300034073Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XLEnvironmentalOpen in IMG/M
3300034092Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069EnvironmentalOpen in IMG/M
3300034096Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15Oct2015-rr0098EnvironmentalOpen in IMG/M
3300034104Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120EnvironmentalOpen in IMG/M
3300034272Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156EnvironmentalOpen in IMG/M
3300034279Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163EnvironmentalOpen in IMG/M
3300034357Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME12May2017-rr0187EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
PC6_016997132236876023Saline Water Concentrator PondMAPNYYDYLPEGPFTEDDLWDAIAEAAGLDASEIADGDLAEWL
PC6_047182122236876023Saline Water Concentrator PondMAPNYYDYLPEGNFTEDDLWEAIAEAAGVDVSEIADGDLVEWL
PR_CR_10_Liq_1_inCRDRAFT_1001570113300000385EnviromentalMSEPYWKYLPEGTFTEEELWEAIAEARGVDVSEIADGDLVEYL*
PR_CR_10_Liq_1_inCRDRAFT_1002634163300000385EnviromentalMAPNYYDYLPEGNFTEDDLWEAIAEAAGVDASEISDGDLVEWL*
ML7_100000451113300001336Benthic LakeMSYIDYLPEDGRFTEEELWEAIAEANGLDVNEIMDGDLVEWI*
ML7_1014774653300001336Benthic LakeMSYLDYLPEDGNFTEEELWEAIAESKGIDVNEIMDGDLVEWL*
ML7_1022206913300001336Benthic LakeMSYLDYLPEDGKFTEEELWEAIAEARGVDVNEIMDGDLCEFI*
MLSed_1013819763300001533BenthicMSYLDYLPEDGNFTEEQLWEAIAEARGVDVNEIMDGDLVEWL*
RCM27_106168013300001836Marine PlanktonHTRRLVLPSYIDFLPDSPFTEEELWQAIADANDLDYADIADGDLVDYL*
RCM40_104584253300001839Marine PlanktonSYIDFLPDSPFTEEELWQAIADANDLDYADIADGDLVDYL*
GOS2248_10041741103300001970HypersalineWKYLPEGTFTEDDLWEAIAESRGVDVSEIADGDLVEYL*
GOS2248_1004910593300001970HypersalineMAPNYYDYLPEGSYTEDDLWDAIAEAAGLDVSEIADGDLVEWL*
GOScombined01_10055317743300002040MarineMAPNYYDYLPEGSYTEDDLWDAIAEAAGLDASEIADGDLAEWL*
metazooDRAFT_122302023300002197LakeMSYLDYLPEDGNFTEEELWEAIADSIGVDMSEIMDGDLIDYI*
metazooDRAFT_127581943300002201LakeTFLEGLMSYLDYPPEDGNFTEEELWEAIADSIGVDMSEIMDGDLIDYI*
metazooDRAFT_126768113300002202LakeMSYIDYLPEDGNFSEEDLWEAIAESLGVDYSEIADEDLV
B570J29032_10884496713300002408FreshwaterYLPADGNFSEEELWEAIAEANGLEVSEIMDGDLVEWI*
B570J29032_10904143813300002408FreshwaterYLDYLPADGNFSEDELWEAIAEDLGVDPSEIMDGDLVDFI*
codie8draft_111096123300002733Coal-Bed Methane WellMSNPSYFDYLPDDGDFTEDDLWEAIAEANGLDVSEIMDGDLVDYL*
B570J40625_100048748173300002835FreshwaterMSYLDYLPADGNFSEDELWEAIAEDLGVDPSEIMDGDLVDFI*
B570J40625_10016204093300002835FreshwaterMNYLDYLPADGNFSEEELWEAIAEANGLEVSEIMDGDLVEWI*
B570J40625_10101908223300002835FreshwaterVSEKAKKKTHYTDHLPENGLFTEDDLWQAIADANGVDVSEIADGDLVDWL*
draft_11518683193300002856Hydrocarbon Resource EnvironmentsMKDYLDYLPEDGIFSEEELWEAIAEAKGVDVSEIMDGDLVDYL*
Ga0066605_1022453723300004279MarineMSYLDYLPEDGKFSEEELWEAIAESKGIDLNEIMDGDLAEWV*
Ga0066605_1027634533300004279MarineMKRSYVEYLPEDGNFTEDDLWEAVAESQGIDVNEIMDGDLAEWL*
Ga0069718_1364078823300004481SedimentMASYMEFLPADGNFTEDDLWEAIAEAAGLDVSEIADGDLVEWL*
Ga0068876_1041070433300005527Freshwater LakeMSYFDYLPADGDFTEDELWEAIAEDLGVDPPEIMDGDLVDFI*
Ga0049080_10004485173300005582Freshwater LenticMSYLDYLPADGNFSEDELWEAIAEDLGIDPSEIMDGDLVDFI*
Ga0074647_103881913300005611Saline Water And SedimentKGYMALLPEDGNFTEDDLWEAIAESNGVDVSEIMDGDLVEWL*
Ga0074649_109443233300005613Saline Water And SedimentMSYIDYLPEDGKFSEEQLWEAIAESLGVDANEIMDGDLVDYI*
Ga0079957_1002329143300005805LakeMASYMEFLPEDGNFTEEDLWDAIAEANGLDASEIMDGDLAEWL*
Ga0070749_1022209953300006802AqueousMSYFDYLPADGYFSEEELWEAIAEANGLDVSEIMDGDLVEWI*
Ga0070749_1075888413300006802AqueousMNKPTYYDYLPEDGKFTEDDLWEAIAEANGVDYSEIADGDLCEWL*
Ga0070754_10000713303300006810AqueousMSKPTYYDYLPEDGKFTEDDLWEAIAEANGVDYSEIADGDLCEWL*
Ga0103958_116162233300007212Freshwater LakeMPNYFDYLPEDGNFTEEELWEAIADANGLDVDDIMDGDLVEYL*
Ga0103959_125555543300007214Freshwater LakeMSYIDYLPEDGNFTEDDLWEAIADSLGIDPSEIMDGDLVDYL*
Ga0103961_114536123300007216Freshwater LakeMPSYFDYLPEDGNFTEEELWEAIADANGLDVDDIMDGDLVEYL*
Ga0099851_1024213113300007538AqueousMSYLDYLPADGNFSEEELWEAIAEANGLDVNEIMDGDLVEWI*
Ga0099851_103359623300007538AqueousMSYLDYLPADGNFSEEELWEAIAEANGLDVNEIMDGDLVEWL*
Ga0099851_133103223300007538AqueousMSYLDYLPADGNFSEEELWEAIAEANGLDVSEIMDGDLVEWI*
Ga0099849_102405963300007539AqueousMAPNYYDYLPEGNFTEDDLWSAIAEAAGVDASEISDGDLVEWL*
Ga0099848_113962123300007541AqueousMSYLDYLPEDGNFSEEELWEAIAEDLGIDPSEIMDGDLVDFI*
Ga0099846_122613813300007542AqueousMSYIDFLPADGNFSEDELWEAIAEANGLDVSEIMDGDLVEWL*
Ga0099846_134077113300007542AqueousMSYIDFLPADGNFSEDELWEAIAEANGLDVSEIMDGDLVEWI*
Ga0102951_112729533300007725WaterMSYLDYLPEDGKFSEEELWEAIAESKGIDVNEIMDGDLVEWL*
Ga0099850_1013655133300007960AqueousMSYLDYLPSDGNFSEEELWEAIAEDLGIDPSEIMDGDLVDFI*
Ga0099850_117042043300007960AqueousMSYLDYLPADGNFSEDELWEAIAEANGLDVNEIMDGDLVEWI*
Ga0114343_108622743300008110Freshwater, PlanktonMSYFDYLPADGDFTEDELWEAIAEDLGIDPSEIMDGDLVDFI*
Ga0105098_1007720623300009081Freshwater SedimentMSYLDHLPKCGKFSEEDLWEAIAEANGLDVNEIMDGDLVEWI*
Ga0105098_1011381443300009081Freshwater SedimentMKKQSYYEYLPEDGKFTEEDLWEAIAEANGVDYSEIADGDLAEWL*
Ga0118687_1039167623300009124SedimentMKMSEPYWNYLPEGTFSEDELWEAIAESKGIDVNEIMDGDLAEWL*
Ga0114918_10016863133300009149Deep SubsurfaceMDFLPEDGNFTEDDLWEAIAEANGVDASEIMDGDFVEWL*
Ga0105097_1011322643300009169Freshwater SedimentMSYLDYLPQDGNFTEEELWEAIAEANGVDVYEIMDGDLVDFI*
Ga0103860_1004122623300009243River WaterLASYIDFLPDSPFTEEELWQAIADANDLDYADIADGDLVDYL*
Ga0127391_101899933300009450Meromictic PondMSYLDYLPENGNFSEEELWEAIAEDLGIDPSEIMDGDLVDFI*
Ga0126448_1007167103300009466Meromictic PondMSYLDYLPADGNFSEEELWEAIAEDLGIDPSEIMDGDLVDFI*
Ga0127401_100553893300009469Meromictic PondMSYLNYLPADGNFSEDELWEAIAEANGLDVSEIMDGDLVEWI*
Ga0127390_112619513300009474Meromictic PondMSYIDYLPEDGNFSEDELWEAIAESLGVDPSEIADGDLTEYL*
Ga0130030_103519323300009563Meromictic PondMSYLDYLPADGNFSEDELWEAIAEANGLDVSEIMDGDLVEWI*
Ga0129342_1002842163300010299Freshwater To Marine Saline GradientMTDDQKPKKKSYLDYLPDGQFTEDDLWEAIAAANDVDYSEIADGDLVDWL*
Ga0129333_1013110743300010354Freshwater To Marine Saline GradientMSYIDFLPADGNFSEEELWEAIAEANGLDVNEIMDGDLVEWI*
Ga0129333_1072878043300010354Freshwater To Marine Saline GradientSRMSYLDYLPADGNFSEDELWEAIAEANGLDVNEIMDGDLVEWI*
Ga0136549_10013099133300010389Marine Methane Seep SedimentMSYIDYLPEDGRFSEEELWEAIAEANGLDVSEIMDGDLVEWI*
Ga0136549_1005530353300010389Marine Methane Seep SedimentMPSYLDYLPEDGKFSEEELWEAIAESKGIDVNEIMDGDLCEFI*
Ga0157210_102249613300012665FreshwaterVKKNPAYYDLLPEDGNFTEDDLWEAIAEANGMDASEIMDGDLCEWL*
Ga0157609_108999513300012717FreshwaterVSEETKKKTHYTEHLPESGLFTEDDLWQAIADANGVDVSEIADGDLVDWL*
Ga0159060_103055613300012990Hydrocarbon Resource EnvironmentsMSYLDYLPEDGKFSEEELWEAIAESMGVDVNEIMDGDLVEFI*
Ga0159060_103243733300012990Hydrocarbon Resource EnvironmentsMNNPYWEYLPEGTFTESELWEAIAELQGVDVSEIMDGDLVEFI*
Ga0164293_1035797823300013004FreshwaterMSNEPNTNYLDHLPENGAFDEDDLWQAIADANGVDVSEIADGDLVDWI*
(restricted) Ga0172374_103491383300013122FreshwaterMSYLDYLPEDGNFTEDDLWEAIADSLGIDPSEIMDGDLVDYL*
(restricted) Ga0172367_1066829423300013126FreshwaterMEFLPADGNFTEDDLWEAIAEANGLDVSEIADGDLVEWL*
(restricted) Ga0172375_1017997813300013137FreshwaterEDGNFTEDDLWEAIADSLGIDPSEIMDGDLVDYL*
Ga0177922_1054497233300013372FreshwaterMSYLDYLPADGDFTEDELWEAIAEDLGIDPSEIMDGDLVDFI*
Ga0117792_1000193113300013941Epidermal MucusMSYVDYLPEDGNFTEDELWDAIAESLGVDPSEIADGDLVEFL*
Ga0134315_1000413243300014962Surface WaterMSYIDYLPEDGNFTEDELWEAIAESLGVDYSEIADGDLVDFL*
Ga0134315_104015233300014962Surface WaterMSYFDYLPEDGNFTEEDLWEAIAENLGLDVNEIMDGDLVDYL*
Ga0182090_159663223300016797Salt MarshMSYMDFLPEDGNFTEGDLWEAIAEANGVDASEIMDGDLVEWL
Ga0181365_103182133300017736Freshwater LakeMGKSYMDSLPADGNFTEEELWEAIAESLGVEANEIMDGDLHEYL
Ga0181357_100570553300017777Freshwater LakeMGKSYMDSLPADGNFTEEELWEAIAESLGVEPEDIFDGDLVEYL
Ga0169931_10013666203300017788FreshwaterVSYLDYLPEDGIFTEFDLWEAIADNLGVDMSEIMDGDLIDYI
Ga0169931_1014164133300017788FreshwaterMSYLDYLPEDGNFTEDDLWEAIADSLGIDPSEIMDGDLVDYL
Ga0180431_1033383553300017987Hypersaline Lake SedimentMSEPYWKYLPEGTFSEDELWEAIAESKGIDVNEIMDGDLAEWL
Ga0180431_1098745613300017987Hypersaline Lake SedimentDRTMSYIDYLPEDGCFTEDELWEAIAEANGLDVSEIADGDLVEWI
Ga0180432_1017238663300017989Hypersaline Lake SedimentMSEPYWKYLPEGTFSEEELWEAIAESKGIDVNEIMDGDLAEWL
Ga0180432_1027023843300017989Hypersaline Lake SedimentMSYLDYLPEDGRFSEEELWEAIAEDMGVDVYEIMDGDLVDFI
Ga0180432_1034929643300017989Hypersaline Lake SedimentMSEPYWKYLPEDGNFTEEELWEAIAESKGIDVNEIMDGDLAEWL
Ga0180432_1055088433300017989Hypersaline Lake SedimentMSYIDYLPEDGRFTEEELWEAIAEANGLDVSEIMDGDLVEWL
Ga0180432_1071209223300017989Hypersaline Lake SedimentMALLPESGNFTEDDLWEAIAEANGVDVQEIADGDLVEWL
Ga0180434_1012703563300017991Hypersaline Lake SedimentMSYIDYLPEDGRFTEDELWEAIAEANGLDVSEIMDGDLVEWL
Ga0180434_1135780023300017991Hypersaline Lake SedimentMSYLDYLPEDGRFSEEELWEAIAEANGLDVSEIMDGDLVEWI
Ga0180434_1142763323300017991Hypersaline Lake SedimentMPSYLDYLPEDGKFTEEELWEAIAESKGIDVNEIMDGDLAEWL
Ga0180435_1077048213300017992Hypersaline Lake SedimentMSYLDYLPEDGKFTEEELWEAIAESKGIDVNEIMDGDLVEWL
Ga0180430_1084318723300018065Hypersaline Lake SedimentMSYLDYLPEDGKFTEEELWEAIAESKGIDVNEIMDGDLAEWL
Ga0180430_1087632713300018065Hypersaline Lake SedimentMAPKYHDYLPEGPFTEDDLWEAIAEAAGLDVSEIADGDLAERL
Ga0180430_1122971123300018065Hypersaline Lake SedimentMSEPYWKYLPEGTFTEDDLWEAIAEARGVDVSEIADGDLVEYL
Ga0180433_1137274923300018080Hypersaline Lake SedimentMPSYLDYLPEDGRFTEEELWEAIAESKGIDVNEIMDGDLAEWL
Ga0181563_1055824413300018420Salt MarshMSYLDYLPKDGKFSEEDLWEAIAESMGVDVNEIMDGDLVDFI
Ga0188835_100790213300019096Freshwater LakeMSYVDYLPEDGNFSEDELWEAIAESLGIDPSEIADGDLAEYL
Ga0207193_119982423300020048Freshwater Lake SedimentMTEENKKKHYFDFLPETGGFTEDDLWQAIADANDVDVSEIADGDLVDWL
Ga0211542_107511923300020312MarineMKPKTYLDYLPEDGNFTEDDLWEAIALAEGVDYDLSDGDLADYL
Ga0211576_1004741863300020438MarineMSKPYWENLPKDGNFTEEDLWDAIAESLGVDSSEISDQDLVDYI
Ga0208050_101121613300020498FreshwaterMSYLDYLPADGNFSEDELWEAIAEDLGVDPSEIMDGDLVDFI
Ga0208360_102959123300020551FreshwaterMNYLDYLPADGNFSEEELWEAIAEANGLEVSEIMDGDLVEWI
Ga0208719_108753523300020564FreshwaterMSNEPNTNYLDHLPENGAFDEDDLWQAIADANGVDVSEIADGDLVDWI
Ga0213862_1017918313300021347SeawaterMKPKTYLDYLPEDGNFTEEDLWEAIAIAEGSEYDLSDGDLADYL
Ga0213865_1002199823300021373SeawaterMSYLDYLPADGNFSEEELWEAIAEDLGIDPSEIMDGDLVDFI
Ga0222714_1022165823300021961Estuarine WaterMSYLDYLPADGDFTEDELWEAIAEDLGIDPSEIMDGDLVDFI
Ga0222714_1025075923300021961Estuarine WaterMAYFDYLPDRPFTEDELWDAIAEDLGVDPSEIADGDLVDYL
Ga0212031_108962513300022176AqueousMSYLDYLPADGNFSEEELWEAIAEANGLDVSEIMDGDLVEWL
Ga0181353_105824313300022179Freshwater LakeMSYLDYLPADGNFSEDELWEAIAEDLGIDPSEIMDGDLVDFI
Ga0181354_110134913300022190Freshwater LakePSKGYMEYLPADGNFTEDDLWEAIAEANGVDASEIMDGDLCEWL
Ga0196905_104181743300022198AqueousMSYLDYLPADGNFSEEELWEAIAEANGLDVNEIMDGDLVEWL
Ga0196905_111757723300022198AqueousMSYLDYLPSDGNFSEEELWEAIAEANGLDVSEIMDGDLVEWI
Ga0196905_112152013300022198AqueousLWIGVSRMSYLDYLPSDGNFSEEELWEAIAEANGLDVSEIMDGDLVEWL
Ga0196905_112959623300022198AqueousMSYLDYLPSDGNFSEEELWEAIAEDLGIDPSEIMDGDLVDFI
Ga0196901_124039313300022200AqueousMSYIDFLPADGNFSEDELWEAIAEANGLDVNEIMDGDLVEWL
Ga0214917_1012000923300022752FreshwaterMPNPNYFDYLPDRNFTEGELWDAIAEANGLDVYDIMDGDLAEFL
(restricted) Ga0233432_10009763123300023109SeawaterMSYLDYLPEDGKFSEEELWEAIAESKGIDVNEIMDGDLVEWL
(restricted) Ga0233432_1017830253300023109SeawaterMKRSYVEYLPEDGKFSEEELWEAIAESQGIDVNEIMDGDLAEWL
(restricted) Ga0233432_1021304863300023109SeawaterMKRSYVEYLPEDGNFTEDDLWEAVAESQGIDVNEIMD
(restricted) Ga0233432_1042918933300023109SeawaterMKRSYVEYLPEDGNFTEDDLWEAIAESKGIDVNEIMDGDLAEWL
Ga0247724_102254313300024239Deep Subsurface SedimentMSYLDYLPEDGNFSEDELWEAIAEDLGVDPSEIMDGDLVDFI
Ga0247724_102266853300024239Deep Subsurface SedimentMSYIDFLPADGNFSEDELWEAIAEANGLDVSEIMDGDLVEWI
(restricted) Ga0233444_1005766013300024264SeawaterMSYLDYLPEDGKFSEEELWESIAESKGIDVNEIMDGDLAEWL
Ga0255142_107341533300024352FreshwaterMKNPSYYDYLPEDGNFTEEDLWEAIAEANGVDYSEIADGDLV
Ga0255152_103344823300024503FreshwaterMKNPSYYDYLPEDGNFTEEDLWEAIAEANGVDYSEIADGDLVDYL
Ga0208161_103664613300025646AqueousYIDFLPADGNFSEDELWEAIAEANGLDVNEIMDGDLVEWI
Ga0208160_113791223300025647AqueousMSYLDYLPSDGNFSEEELWEAIAEANGLDVSEIMDGDLVEWL
Ga0208795_105007023300025655AqueousMSYLDYLPADGNFSEEELWEAIAEANGLDVNEIMDGDLVEWI
Ga0208898_101135243300025671AqueousMSKPTYYDYLPEDGKFTEDDLWEAIAEANGVDYSEIADGDLCEWL
Ga0208162_109375923300025674AqueousMAPNYYDYLPEGNFTEDDLWSAIAEAAGVDASEISDGDLVEWL
Ga0209374_112113623300025705MarineMSYLDYLPEDGKFSEEELWEAIAESKGIDLNEIMDGDLAEWV
Ga0209374_116495233300025705MarineVEYLPEDGNFTEDDLWEAVAESQGIDVNEIMDGDLAEWL
Ga0208644_116798323300025889AqueousMSYFDYLPADGYFSEEELWEAIAEANGLDVSEIMDGDLVEWI
Ga0209953_103285023300026097Pond WaterMAPNYYDHLPEGDFTEDDLWEAIAEAAGLDASEIMDGDLAEWL
Ga0209492_114404723300027721Freshwater SedimentMSYLDYLPQDGNFTEEELWEAIAEANGVDVYEIMDGDLVDFI
Ga0209229_10003337163300027805Freshwater And SedimentMASYMEFLPADGNFTEDDLWEAIAEAAGLDVSEIADGDLVEWL
Ga0209229_1017455213300027805Freshwater And SedimentMSYIDFLPADGNFSEEELWEAIAEANGLDVNEIMDGDLVEWI
Ga0209229_1052727213300027805Freshwater And SedimentMSYLDYLPADGDFTEEELWEAIAEDLGIDPSEIMDGDLVDFI
Ga0209820_120687023300027956Freshwater SedimentMSYLDHLPKCGKFSEEDLWEAIAEANGLDVNEIMDGDLVEWI
Ga0315900_1017498243300031787FreshwaterSRMSYFDYLPADGDFTEDELWEAIAEDLGVDPSEIMDGDLVDFI
Ga0315904_1112126633300031951FreshwaterYIDYLPEDGNFTEDELWEAIAESLGVEYSEIADGDLAEFL
Ga0315901_1076332633300031963FreshwaterMSYFDYLPEDGNFTEDELWEAIAEDLGIDPSEIMDGDLVDFI
Ga0315903_1017803263300032116FreshwaterMSYFDYLPADGDFTEDELWEAIAEDLGIDPSEIMDGDLVDFI
Ga0334978_0198420_514_6333300033979FreshwaterMEFLPEDGNFTEEDLWDAIAEANGLDASEIMDGDLAEWL
Ga0334982_0006217_4321_44493300033981FreshwaterMSYLDFLPADGNFSEDELWEAIAEDLGIDPSEIMDGDLVDFI
Ga0334994_0012334_3079_32313300033993FreshwaterVSEKAKKKTHYTDHLPENGLFTEDDLWQAIADANGVDVSEIADGDLVDWL
Ga0334979_0107254_1193_13453300033996FreshwaterVSEETKKKTHYTEHLPESGLFTEDDLWQAIADANGVDVSEIADGDLVDWL
Ga0310127_001743_22185_223133300034072Fracking WaterMSYIDFLPADGNFSEEELWEAIAEANGLDVSEIMDGDLVEWI
Ga0310130_0021418_1071_11993300034073Fracking WaterMSYIDYLPADGNFSEDELWEAIAEANGLDVNEIMDGDLVEWL
Ga0310130_0023733_1645_17793300034073Fracking WaterMSKPYWHYLPEDGKFSEEDLWEAIAESRGIDVNEIMDGDLCEFI
Ga0310130_0050003_835_9633300034073Fracking WaterMSYLDYLPEDGRFTEEELWEAIAEDMGVDVYEIMDGDLVDFI
Ga0310130_0074631_701_8353300034073Fracking WaterMSKPYWHYLPEDGKFSEEDLWEAIAESRGVDVNEIMDGDLCEFI
Ga0310130_0090683_163_3183300034073Fracking WaterMRNTKGNSMNNPYWEYLPEGTFTEEELWEAIAESKGIDVNEIMDGDLVEFL
Ga0310130_0312034_378_5003300034073Fracking WaterMSYLDYLPEDGNFSEDELWEAIAEDLGIDPSEIMDGDLVDF
Ga0335010_0128831_1485_16343300034092FreshwaterSEKAKKKTHYTDHLPENGLFTEDDLWQAIADANGVDVSEIADGDLVDWL
Ga0335025_0189089_920_10393300034096FreshwaterMEFLPADGNFTEDDLWEAIAEAAGLDVSEIADGDLVEWL
Ga0335031_0058451_2518_26463300034104FreshwaterMSYIDYLPADGNFSEDELWEAIAEANGLDVSEIMDGDLVEWL
Ga0335031_0294558_391_5193300034104FreshwaterMSYFDYLPEDGDFTEDELWEAIAEDLGIDPSEIMDGDLVDFI
Ga0335049_0800877_452_5563300034272FreshwaterMSYIDFLPADGDFTEDELWEAIAEDLGIDPSEIMD
Ga0335052_0208689_686_8143300034279FreshwaterMTYIDYLPADGNFSEEELWEAIAEDLGVDPSEIMDGDLVDFI
Ga0335052_0517671_2_1273300034279FreshwaterSYLDFLPADGNFSEDELWEAIAEDLGIDPSEIMDGDLVDFI
Ga0335064_0005825_476_6133300034357FreshwaterMKKQSYYEYLPEDGNFTEEDLWEAIAEANGVDYSEIADGDLAEWL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.