| Basic Information | |
|---|---|
| Family ID | F038940 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 164 |
| Average Sequence Length | 42 residues |
| Representative Sequence | VNSDILTANYGVKQSQFTKPTSEPRASDPKESNEAFDRAIR |
| Number of Associated Samples | 85 |
| Number of Associated Scaffolds | 164 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 17.68 % |
| % of genes near scaffold ends (potentially truncated) | 76.83 % |
| % of genes from short scaffolds (< 2000 bps) | 98.17 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (87.805 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (87.195 % of family members) |
| Environment Ontology (ENVO) | Unclassified (96.341 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (77.439 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.13% β-sheet: 0.00% Coil/Unstructured: 60.87% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 164 Family Scaffolds |
|---|---|---|
| PF00078 | RVT_1 | 0.61 |
| PF13180 | PDZ_2 | 0.61 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 87.80 % |
| All Organisms | root | All Organisms | 12.20 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005841|Ga0068863_102704373 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 505 | Open in IMG/M |
| 3300005844|Ga0068862_102782764 | Not Available | 501 | Open in IMG/M |
| 3300009980|Ga0105135_111753 | Not Available | 685 | Open in IMG/M |
| 3300009989|Ga0105131_123365 | Not Available | 626 | Open in IMG/M |
| 3300009994|Ga0105126_1036789 | Not Available | 592 | Open in IMG/M |
| 3300009994|Ga0105126_1044732 | Not Available | 552 | Open in IMG/M |
| 3300009995|Ga0105139_1058917 | Not Available | 691 | Open in IMG/M |
| 3300010401|Ga0134121_11838162 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 633 | Open in IMG/M |
| 3300014968|Ga0157379_11716344 | Not Available | 615 | Open in IMG/M |
| 3300015270|Ga0182183_1057469 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 593 | Open in IMG/M |
| 3300015273|Ga0182102_1028412 | Not Available | 579 | Open in IMG/M |
| 3300015280|Ga0182100_1075839 | Not Available | 555 | Open in IMG/M |
| 3300015290|Ga0182105_1056884 | Not Available | 632 | Open in IMG/M |
| 3300015293|Ga0182103_1017292 | Not Available | 869 | Open in IMG/M |
| 3300015301|Ga0182184_1094454 | Not Available | 515 | Open in IMG/M |
| 3300015306|Ga0182180_1065578 | Not Available | 574 | Open in IMG/M |
| 3300015309|Ga0182098_1126991 | Not Available | 504 | Open in IMG/M |
| 3300015310|Ga0182162_1049010 | Not Available | 715 | Open in IMG/M |
| 3300015311|Ga0182182_1011126 | Not Available | 1096 | Open in IMG/M |
| 3300015311|Ga0182182_1051190 | Not Available | 685 | Open in IMG/M |
| 3300015312|Ga0182168_1061584 | Not Available | 682 | Open in IMG/M |
| 3300015313|Ga0182164_1127636 | Not Available | 518 | Open in IMG/M |
| 3300015315|Ga0182120_1139769 | Not Available | 502 | Open in IMG/M |
| 3300015317|Ga0182136_1130641 | Not Available | 519 | Open in IMG/M |
| 3300015318|Ga0182181_1050668 | Not Available | 668 | Open in IMG/M |
| 3300015318|Ga0182181_1061482 | Not Available | 627 | Open in IMG/M |
| 3300015318|Ga0182181_1114660 | Not Available | 504 | Open in IMG/M |
| 3300015319|Ga0182130_1062124 | Not Available | 671 | Open in IMG/M |
| 3300015319|Ga0182130_1119623 | Not Available | 530 | Open in IMG/M |
| 3300015319|Ga0182130_1132801 | Not Available | 509 | Open in IMG/M |
| 3300015324|Ga0182134_1120731 | Not Available | 546 | Open in IMG/M |
| 3300015325|Ga0182148_1066250 | Not Available | 676 | Open in IMG/M |
| 3300015325|Ga0182148_1140211 | Not Available | 511 | Open in IMG/M |
| 3300015326|Ga0182166_1052420 | Not Available | 730 | Open in IMG/M |
| 3300015326|Ga0182166_1092019 | Not Available | 599 | Open in IMG/M |
| 3300015327|Ga0182114_1069999 | Not Available | 705 | Open in IMG/M |
| 3300015327|Ga0182114_1090103 | Not Available | 640 | Open in IMG/M |
| 3300015327|Ga0182114_1112014 | Not Available | 587 | Open in IMG/M |
| 3300015329|Ga0182135_1069771 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii | 685 | Open in IMG/M |
| 3300015329|Ga0182135_1143804 | Not Available | 518 | Open in IMG/M |
| 3300015331|Ga0182131_1022376 | Not Available | 1005 | Open in IMG/M |
| 3300015331|Ga0182131_1088273 | Not Available | 632 | Open in IMG/M |
| 3300015332|Ga0182117_1085886 | Not Available | 671 | Open in IMG/M |
| 3300015333|Ga0182147_1028550 | Not Available | 979 | Open in IMG/M |
| 3300015333|Ga0182147_1038188 | Not Available | 888 | Open in IMG/M |
| 3300015333|Ga0182147_1043982 | Not Available | 847 | Open in IMG/M |
| 3300015333|Ga0182147_1075096 | Not Available | 699 | Open in IMG/M |
| 3300015333|Ga0182147_1075928 | Not Available | 696 | Open in IMG/M |
| 3300015334|Ga0182132_1018140 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 1130 | Open in IMG/M |
| 3300015334|Ga0182132_1062596 | Not Available | 750 | Open in IMG/M |
| 3300015334|Ga0182132_1078887 | Not Available | 688 | Open in IMG/M |
| 3300015334|Ga0182132_1143941 | Not Available | 539 | Open in IMG/M |
| 3300015335|Ga0182116_1123065 | Not Available | 594 | Open in IMG/M |
| 3300015335|Ga0182116_1124448 | Not Available | 591 | Open in IMG/M |
| 3300015336|Ga0182150_1015392 | Not Available | 1151 | Open in IMG/M |
| 3300015336|Ga0182150_1073995 | Not Available | 692 | Open in IMG/M |
| 3300015336|Ga0182150_1084454 | Not Available | 659 | Open in IMG/M |
| 3300015336|Ga0182150_1091086 | Not Available | 640 | Open in IMG/M |
| 3300015336|Ga0182150_1167914 | Not Available | 500 | Open in IMG/M |
| 3300015337|Ga0182151_1160806 | Not Available | 510 | Open in IMG/M |
| 3300015338|Ga0182137_1067545 | Not Available | 755 | Open in IMG/M |
| 3300015338|Ga0182137_1090879 | Not Available | 672 | Open in IMG/M |
| 3300015338|Ga0182137_1150363 | Not Available | 543 | Open in IMG/M |
| 3300015338|Ga0182137_1168792 | Not Available | 515 | Open in IMG/M |
| 3300015339|Ga0182149_1072002 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 719 | Open in IMG/M |
| 3300015339|Ga0182149_1172976 | Not Available | 504 | Open in IMG/M |
| 3300015340|Ga0182133_1104826 | Not Available | 652 | Open in IMG/M |
| 3300015340|Ga0182133_1122435 | Not Available | 612 | Open in IMG/M |
| 3300015348|Ga0182115_1008233 | Not Available | 2199 | Open in IMG/M |
| 3300015348|Ga0182115_1008554 | Not Available | 2177 | Open in IMG/M |
| 3300015348|Ga0182115_1166100 | Not Available | 708 | Open in IMG/M |
| 3300015348|Ga0182115_1174105 | Not Available | 690 | Open in IMG/M |
| 3300015348|Ga0182115_1185365 | Not Available | 667 | Open in IMG/M |
| 3300015348|Ga0182115_1220248 | Not Available | 607 | Open in IMG/M |
| 3300015348|Ga0182115_1231212 | Not Available | 590 | Open in IMG/M |
| 3300015348|Ga0182115_1240129 | Not Available | 577 | Open in IMG/M |
| 3300015348|Ga0182115_1271098 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis | 538 | Open in IMG/M |
| 3300015349|Ga0182185_1041726 | Not Available | 1174 | Open in IMG/M |
| 3300015349|Ga0182185_1064528 | Not Available | 995 | Open in IMG/M |
| 3300015349|Ga0182185_1098510 | Not Available | 837 | Open in IMG/M |
| 3300015349|Ga0182185_1162362 | Not Available | 668 | Open in IMG/M |
| 3300015349|Ga0182185_1247165 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii | 543 | Open in IMG/M |
| 3300015349|Ga0182185_1252203 | Not Available | 538 | Open in IMG/M |
| 3300015349|Ga0182185_1263441 | Not Available | 526 | Open in IMG/M |
| 3300015352|Ga0182169_1070808 | Not Available | 1084 | Open in IMG/M |
| 3300015352|Ga0182169_1118124 | Not Available | 857 | Open in IMG/M |
| 3300015352|Ga0182169_1122857 | Not Available | 840 | Open in IMG/M |
| 3300015352|Ga0182169_1242953 | Not Available | 586 | Open in IMG/M |
| 3300015352|Ga0182169_1246249 | Not Available | 581 | Open in IMG/M |
| 3300015352|Ga0182169_1302028 | Not Available | 516 | Open in IMG/M |
| 3300015352|Ga0182169_1308535 | Not Available | 509 | Open in IMG/M |
| 3300015353|Ga0182179_1020780 | Not Available | 1544 | Open in IMG/M |
| 3300015353|Ga0182179_1211961 | Not Available | 619 | Open in IMG/M |
| 3300015354|Ga0182167_1020865 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1953 | Open in IMG/M |
| 3300015354|Ga0182167_1043076 | Not Available | 1516 | Open in IMG/M |
| 3300015354|Ga0182167_1128340 | Not Available | 935 | Open in IMG/M |
| 3300015354|Ga0182167_1138138 | Not Available | 899 | Open in IMG/M |
| 3300015354|Ga0182167_1211301 | Not Available | 708 | Open in IMG/M |
| 3300015354|Ga0182167_1226462 | Not Available | 679 | Open in IMG/M |
| 3300015354|Ga0182167_1236893 | Not Available | 661 | Open in IMG/M |
| 3300015354|Ga0182167_1238686 | Not Available | 658 | Open in IMG/M |
| 3300015354|Ga0182167_1243527 | Not Available | 650 | Open in IMG/M |
| 3300015354|Ga0182167_1276049 | Not Available | 601 | Open in IMG/M |
| 3300017412|Ga0182199_1141079 | Not Available | 583 | Open in IMG/M |
| 3300017412|Ga0182199_1196261 | Not Available | 511 | Open in IMG/M |
| 3300017414|Ga0182195_1045376 | Not Available | 916 | Open in IMG/M |
| 3300017414|Ga0182195_1046580 | Not Available | 908 | Open in IMG/M |
| 3300017414|Ga0182195_1062634 | Not Available | 819 | Open in IMG/M |
| 3300017414|Ga0182195_1082925 | Not Available | 741 | Open in IMG/M |
| 3300017414|Ga0182195_1107038 | Not Available | 673 | Open in IMG/M |
| 3300017414|Ga0182195_1193606 | Not Available | 532 | Open in IMG/M |
| 3300017421|Ga0182213_1224520 | Not Available | 537 | Open in IMG/M |
| 3300017432|Ga0182196_1156655 | Not Available | 502 | Open in IMG/M |
| 3300017439|Ga0182200_1075238 | Not Available | 662 | Open in IMG/M |
| 3300017439|Ga0182200_1105903 | Not Available | 588 | Open in IMG/M |
| 3300017445|Ga0182198_1090363 | Not Available | 687 | Open in IMG/M |
| 3300017445|Ga0182198_1136815 | Not Available | 588 | Open in IMG/M |
| 3300017445|Ga0182198_1146418 | Not Available | 573 | Open in IMG/M |
| 3300017445|Ga0182198_1175303 | Not Available | 533 | Open in IMG/M |
| 3300017445|Ga0182198_1198272 | Not Available | 507 | Open in IMG/M |
| 3300020023|Ga0182178_1003306 | Not Available | 957 | Open in IMG/M |
| 3300020033|Ga0182146_106978 | Not Available | 503 | Open in IMG/M |
| 3300025517|Ga0207869_1026753 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza | 839 | Open in IMG/M |
| 3300026088|Ga0207641_12212859 | Not Available | 550 | Open in IMG/M |
| 3300026088|Ga0207641_12403591 | Not Available | 526 | Open in IMG/M |
| 3300028049|Ga0268322_1052851 | Not Available | 516 | Open in IMG/M |
| 3300028056|Ga0268330_1024387 | Not Available | 702 | Open in IMG/M |
| 3300028153|Ga0268320_1010052 | Not Available | 696 | Open in IMG/M |
| 3300028470|Ga0268307_1002705 | Not Available | 954 | Open in IMG/M |
| 3300028470|Ga0268307_1018801 | Not Available | 549 | Open in IMG/M |
| 3300028472|Ga0268315_1012741 | Not Available | 641 | Open in IMG/M |
| 3300028472|Ga0268315_1027168 | Not Available | 507 | Open in IMG/M |
| 3300028476|Ga0268329_1004076 | Not Available | 879 | Open in IMG/M |
| 3300028477|Ga0268309_1010555 | Not Available | 621 | Open in IMG/M |
| 3300032465|Ga0214493_1112212 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 644 | Open in IMG/M |
| 3300032466|Ga0214503_1204187 | Not Available | 615 | Open in IMG/M |
| 3300032467|Ga0214488_1045276 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii | 968 | Open in IMG/M |
| 3300032467|Ga0214488_1068089 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 788 | Open in IMG/M |
| 3300032468|Ga0214482_1019927 | Not Available | 1217 | Open in IMG/M |
| 3300032469|Ga0214491_1161244 | Not Available | 519 | Open in IMG/M |
| 3300032502|Ga0214490_1146208 | Not Available | 534 | Open in IMG/M |
| 3300032548|Ga0214483_1036662 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 824 | Open in IMG/M |
| 3300032551|Ga0321339_1057958 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 888 | Open in IMG/M |
| 3300032551|Ga0321339_1070460 | Not Available | 805 | Open in IMG/M |
| 3300032551|Ga0321339_1103071 | Not Available | 649 | Open in IMG/M |
| 3300032591|Ga0214484_1077698 | Not Available | 697 | Open in IMG/M |
| 3300032592|Ga0214504_1064013 | Not Available | 721 | Open in IMG/M |
| 3300032697|Ga0214499_1077381 | Not Available | 1006 | Open in IMG/M |
| 3300032758|Ga0314746_1007561 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1957 | Open in IMG/M |
| 3300032789|Ga0314725_1039545 | Not Available | 561 | Open in IMG/M |
| 3300032792|Ga0314744_1003678 | Not Available | 2278 | Open in IMG/M |
| 3300032812|Ga0314745_1027814 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 1185 | Open in IMG/M |
| 3300032812|Ga0314745_1129321 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 510 | Open in IMG/M |
| 3300032822|Ga0314740_1029117 | Not Available | 827 | Open in IMG/M |
| 3300032823|Ga0314723_1106944 | Not Available | 517 | Open in IMG/M |
| 3300032844|Ga0314743_1136369 | Not Available | 546 | Open in IMG/M |
| 3300032914|Ga0314750_1119198 | Not Available | 615 | Open in IMG/M |
| 3300032914|Ga0314750_1166318 | Not Available | 512 | Open in IMG/M |
| 3300032934|Ga0314741_1012075 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae → Eragrostidinae → Eragrostis → Eragrostis curvula | 1709 | Open in IMG/M |
| 3300032966|Ga0314722_1018876 | Not Available | 1072 | Open in IMG/M |
| 3300033526|Ga0314761_1033314 | Not Available | 1110 | Open in IMG/M |
| 3300033532|Ga0314767_1128098 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 637 | Open in IMG/M |
| 3300033535|Ga0314759_1038902 | Not Available | 1383 | Open in IMG/M |
| 3300033535|Ga0314759_1222181 | Not Available | 600 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 87.20% |
| Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 5.49% |
| Switchgrass Associated | Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated | 3.05% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.44% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.61% |
| Ionic Liquid And High Solid Enriched | Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Ionic Liquid And High Solid Enriched | 0.61% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300009980 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaG | Host-Associated | Open in IMG/M |
| 3300009989 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaG | Host-Associated | Open in IMG/M |
| 3300009994 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaG | Host-Associated | Open in IMG/M |
| 3300009995 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG | Host-Associated | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015270 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015273 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015280 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015290 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015293 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015301 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015306 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015309 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015310 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015311 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015312 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015313 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015315 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015317 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015318 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015319 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015324 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015325 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015326 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015327 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015329 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015331 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015332 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015333 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015334 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015335 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015336 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015337 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015338 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015339 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015340 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015348 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015349 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015352 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015353 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015354 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017412 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017414 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017421 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017432 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017439 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017445 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300020023 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_22AUG2016_LD2 MG | Host-Associated | Open in IMG/M |
| 3300020033 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12JUL2016_LD2 MG | Host-Associated | Open in IMG/M |
| 3300025517 | Ionic liquid and high solid enriched microbial communities from the Joint BioEnergy Institute, USA - AR20-5-D (SPAdes) | Engineered | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028049 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028056 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028153 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028470 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028472 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028476 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028477 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300032465 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032466 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12SEP2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032467 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_31MAY2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032468 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032469 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032502 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032548 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032551 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_31MAY2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032591 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032592 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_12SEP2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032697 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032758 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032789 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032792 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032812 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032822 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032823 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032844 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032914 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032934 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032966 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_15MAY2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033526 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033532 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_18SEP2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033535 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0068863_1027043732 | 3300005841 | Switchgrass Rhizosphere | MNSDVLTVNYDVKQRQFTKPTPEPHASDLEESNKAFDRVIEDGYCSITVA |
| Ga0068862_1027827642 | 3300005844 | Switchgrass Rhizosphere | TLTANYGVKQSQFTKPTSEPRASDPEESNEAFDRTIRGWLL* |
| Ga0105135_1117531 | 3300009980 | Switchgrass Associated | MNSDILTTNYGVKQSQFTKPTSEPRASDLEESNETFDRV |
| Ga0105131_1233651 | 3300009989 | Switchgrass Associated | NYDVKQSQFTKPTPEPRVRNPKESNEAFDHVIRG* |
| Ga0105126_10367891 | 3300009994 | Switchgrass Associated | MNSDILTANYGVKQSQFTKSTPEPRASDLEESNKIFDRAIRG* |
| Ga0105126_10447321 | 3300009994 | Switchgrass Associated | VKQSQFTKQTSGPGASDYKESNEAFDRAIRGWLL* |
| Ga0105139_10589171 | 3300009995 | Switchgrass Associated | VLMNSDILTDNYGVKQNQFTKSTSEPRASDPEESNEVFDCAIREWVL* |
| Ga0134121_118381621 | 3300010401 | Terrestrial Soil | ILTVNYGVKQSQLTKLTLEPRASDPEESNKVFDRVIRGWLL* |
| Ga0157379_117163442 | 3300014968 | Switchgrass Rhizosphere | ANYGDKQSQFTKPTSEPRASDPEESNETFNRVIRE* |
| Ga0182183_10574692 | 3300015270 | Switchgrass Phyllosphere | MLINSDILTANYGIKQSQFTKSTPEPRASDPEEFNKVFDRAIR* |
| Ga0182102_10284121 | 3300015273 | Switchgrass Phyllosphere | WFRRAPVNSDILIVYYGVRQNQFIKPTPESRASDHKESNEAFDRTIRGWLL* |
| Ga0182100_10758391 | 3300015280 | Switchgrass Phyllosphere | INYGVKQNQFTKPTSEPRASDPEESNETFDRAIRGWLL* |
| Ga0182105_10568841 | 3300015290 | Switchgrass Phyllosphere | INYGVKQSQFTKPTSEPRASDPEESNEAFDRAIRGWLL* |
| Ga0182103_10172921 | 3300015293 | Switchgrass Phyllosphere | MLNNSDILTANYGVKQSQFIKPTPEPRASDPEESNEAFDRVIRGWLL* |
| Ga0182184_10944541 | 3300015301 | Switchgrass Phyllosphere | AYYGVKQSEFTKPTLEPRASDPEESNEAFDRAIRG* |
| Ga0182180_10655781 | 3300015306 | Switchgrass Phyllosphere | MPNLVLSCLRNSNIFTANYGVKQNQFTKLTLEPRARNPEESNEIFDRVIR |
| Ga0182098_11269911 | 3300015309 | Switchgrass Phyllosphere | VNSDTLTANYGVKQSQFTKPTSEPRASDPEESNKAFDRVIRGWLL* |
| Ga0182162_10490101 | 3300015310 | Switchgrass Phyllosphere | ANYGVKQSQFTKPTSEPRASDPEESNETFDRGWLL* |
| Ga0182182_10111262 | 3300015311 | Switchgrass Phyllosphere | MNSDILTADYGIKQSQFTKPTPEPRASDLEESNKAFDRAIKGWLL* |
| Ga0182182_10511901 | 3300015311 | Switchgrass Phyllosphere | VLVNSDILTANYSVKQSQLTKLTSEPRARNPEESNKTFDRTI |
| Ga0182168_10615841 | 3300015312 | Switchgrass Phyllosphere | NLIVNYGAKQSQFTKSTSEPRASDPEESNEDFDRAIRGWLL* |
| Ga0182164_11276361 | 3300015313 | Switchgrass Phyllosphere | LTVNYGVKQSQFTKLTPEPCAKNLEESIEGFDRVVRVWYCSITV |
| Ga0182120_11397691 | 3300015315 | Switchgrass Phyllosphere | SIRGVKQIQFSKLTPEPCARNTEEFNEVFDRVIRGWLL* |
| Ga0182136_11306411 | 3300015317 | Switchgrass Phyllosphere | LRARNSDILTANYGVKQIQFIKPTSESRASDPEESNEFFGRTIRGWLL* |
| Ga0182181_10506681 | 3300015318 | Switchgrass Phyllosphere | TVNYGVKQNQFTKSTPEPCARNPEESNEAFDHVIRG* |
| Ga0182181_10614821 | 3300015318 | Switchgrass Phyllosphere | NSNSLTANYGVKQNQFIKPISEPRASDPEESDEVFDRAIR* |
| Ga0182181_11146601 | 3300015318 | Switchgrass Phyllosphere | LVNSDILTANYDVKQSQFTKPTSEPHASDPEESNEVFNRAISG* |
| Ga0182130_10621241 | 3300015319 | Switchgrass Phyllosphere | LTINYSVKQSQFTKPISEPRASDPEESNEAFDRAIR |
| Ga0182130_11196231 | 3300015319 | Switchgrass Phyllosphere | MLHLGVPGNLTANYSVKQRQFTKPTPEPRASGASDLEESNKAFVRAIR |
| Ga0182130_11328011 | 3300015319 | Switchgrass Phyllosphere | MHNDILTANYGVKQSQFIKPTSEPRASDPEEYNEAFYRAIRE* |
| Ga0182134_11207311 | 3300015324 | Switchgrass Phyllosphere | VNSITLIVNYDVKQSQFIKSTSEFRASDHEECNEAFDR |
| Ga0182148_10662501 | 3300015325 | Switchgrass Phyllosphere | NSDILTANYGVKQNQFTKPTSKPRVSDPEESNEAFDRAIRGWLL* |
| Ga0182148_11402111 | 3300015325 | Switchgrass Phyllosphere | VKQSQFTKSTSEPRASDPEESNEVFDSAIREWLL* |
| Ga0182166_10524201 | 3300015326 | Switchgrass Phyllosphere | STHTSRKILTANYGVKQNQFAKPTSKPCASDYKESNEAFDRAIRG* |
| Ga0182166_10920191 | 3300015326 | Switchgrass Phyllosphere | MNNNILTANYGVKQNQFTKLTPELRASDPEESNEVFDRAIRG* |
| Ga0182114_10699992 | 3300015327 | Switchgrass Phyllosphere | VNSDSLTANYDIKQSQFTKLTSEPRASDPEESNDVFDRAIREWLL* |
| Ga0182114_10901031 | 3300015327 | Switchgrass Phyllosphere | LTINYGVKQNQFTKPISELRVSDPEESNKVFNCVIALVTLKNL |
| Ga0182114_11120142 | 3300015327 | Switchgrass Phyllosphere | LTANYSVKQSQLTKLTSEPRARNPEESNEAFDRTIRE* |
| Ga0182135_10697712 | 3300015329 | Switchgrass Phyllosphere | VNYGVKQRQFTKPTSEPHVSDPEESNEVFDRAIRG* |
| Ga0182135_11438041 | 3300015329 | Switchgrass Phyllosphere | NSMLINSDILTVNYGVKQSQFTKLTLEPRASDPEKSNKVFDRAIRG* |
| Ga0182131_10223761 | 3300015331 | Switchgrass Phyllosphere | MNSDILSANYGVKQSQFTKPTLAPRASDLEESNKTFDRVIR* |
| Ga0182131_10882731 | 3300015331 | Switchgrass Phyllosphere | ALVNSDTLGVYYGVKQSQFTKSTPEPRASDLEESNEAFHRAIRGWLL* |
| Ga0182117_10858861 | 3300015332 | Switchgrass Phyllosphere | TINYSVKQSQFTKPISEPRASDSEESNEVFDRAIRGRLL* |
| Ga0182147_10285501 | 3300015333 | Switchgrass Phyllosphere | MNSDIFTANYGVKQSQFIKSTPEPRVSDPEESNEAFDRAIRGWLL* |
| Ga0182147_10381881 | 3300015333 | Switchgrass Phyllosphere | VNSGTLTAYYGVKQNQFTKPTPEPRASDPEESNEAF |
| Ga0182147_10439821 | 3300015333 | Switchgrass Phyllosphere | IVTTLTTNYDVKQSQFTKPTLELRARDPEESNEAFDHAIRG* |
| Ga0182147_10750961 | 3300015333 | Switchgrass Phyllosphere | TNYGVKQSQFTKPTSEPRASDLEESNETFDRAIR* |
| Ga0182147_10759281 | 3300015333 | Switchgrass Phyllosphere | VNSDILTANYGVKQSQFTKPTSEPRASDPKESNEAFDRAIR* |
| Ga0182132_10181402 | 3300015334 | Switchgrass Phyllosphere | TLTANYGVKQSQFTKPTSEPRARNPEDSNEAFDRVI* |
| Ga0182132_10625961 | 3300015334 | Switchgrass Phyllosphere | VKQSQFTKPTSEPRASDPEESNETFDRVIRGWVL* |
| Ga0182132_10788871 | 3300015334 | Switchgrass Phyllosphere | NSDTLTANYGVKQSQFTKPTSEPRASDPKESNEVFDRAI* |
| Ga0182132_11439412 | 3300015334 | Switchgrass Phyllosphere | MLVNSDSLTVNYGVKQSQFTKLTSEPRANDPEESNETFGRVIRGWLL* |
| Ga0182116_11230651 | 3300015335 | Switchgrass Phyllosphere | ILTANYGVKQSQLQNQLQNPLASDAEESNKTFDHAIRE* |
| Ga0182116_11244481 | 3300015335 | Switchgrass Phyllosphere | ITSVKLSQFTKPTSEPLRYRNPEESNEAFDRVIRGWLL* |
| Ga0182150_10153921 | 3300015336 | Switchgrass Phyllosphere | LTANYGVKQNYFSKSTSEPRASDPEESNEAFDRAI |
| Ga0182150_10739952 | 3300015336 | Switchgrass Phyllosphere | NVLVVNSDILAVNYRVKQNQFTKLTSEPRASDPEESNEFFDRAIKGWLL* |
| Ga0182150_10844541 | 3300015336 | Switchgrass Phyllosphere | SDILTANYGVKQSQFTKQTSEPRASYPEESNEAFDRAIRGWLL* |
| Ga0182150_10910861 | 3300015336 | Switchgrass Phyllosphere | VKQIQFIKSTSEPRASDPKESNEVFDRAIRGWLP* |
| Ga0182150_11679141 | 3300015336 | Switchgrass Phyllosphere | ILTVNYGVKQNQFTKPTPEPRASDPEESNKAFDRAIRG* |
| Ga0182151_11608061 | 3300015337 | Switchgrass Phyllosphere | TTSATNYSVKQNQFTKSTLESRASDFEESNKVFDRAIRG* |
| Ga0182137_10675451 | 3300015338 | Switchgrass Phyllosphere | FRVTLTANYGIKQSQFIKSTSELHASDPEESNKIFDRTIRRWLL* |
| Ga0182137_10908791 | 3300015338 | Switchgrass Phyllosphere | NILTGNYGVKQSQFTKPTSEPCVRNPEDSNEAFDRVI* |
| Ga0182137_11503631 | 3300015338 | Switchgrass Phyllosphere | VLVNSDILTANYGVKQSQFTKPTSEPRASDPEEFNETFDRAIRGWLL* |
| Ga0182137_11687921 | 3300015338 | Switchgrass Phyllosphere | NSDSLTANYDVKQSQFTKPTSEPRASDPEESNEVFDRAIRGWLL* |
| Ga0182149_10720022 | 3300015339 | Switchgrass Phyllosphere | MNSDILIANYGVKQSQFTKPTSELRTSDPEESNEVFDRAIRGWLL* |
| Ga0182149_11729762 | 3300015339 | Switchgrass Phyllosphere | MNSDILTANYGIKQRQFTKLTPEPRASDLEESNKAFERTIRGWLL* |
| Ga0182133_11048261 | 3300015340 | Switchgrass Phyllosphere | VNSDILTVNYGAKQNQFTKPTLQPCASDSEESNETF |
| Ga0182133_11224351 | 3300015340 | Switchgrass Phyllosphere | NYSIKQSQFIKPTSEPRASGPEESNEAFDRAIRGWLL* |
| Ga0182115_10082332 | 3300015348 | Switchgrass Phyllosphere | LRCAIEYNTLTVNYNVKQNQLTKLTSEPRARNPKESNEAFDYAIRELLL* |
| Ga0182115_10085541 | 3300015348 | Switchgrass Phyllosphere | MNSDILTVNYDIKQRQFTKPTPEPRASDVEESNKAFDRAIRG* |
| Ga0182115_11661002 | 3300015348 | Switchgrass Phyllosphere | INSDILTANYSVKQSQFIKPIPEPRASDAEESNKTFDRAIRG* |
| Ga0182115_11741051 | 3300015348 | Switchgrass Phyllosphere | LVCVVLINSNTLTANYGVKQIQFTKLTSEPRASDPEESNE |
| Ga0182115_11853651 | 3300015348 | Switchgrass Phyllosphere | SCSAYVVPMNSDILTANYGIKQSQFTKLTSKPPDPEESNEVFDHAIR* |
| Ga0182115_12202482 | 3300015348 | Switchgrass Phyllosphere | VCFRSAFTVYYGVKQSQFTKSTPEPRASDSEESNEVFDRAIRGWLL* |
| Ga0182115_12312121 | 3300015348 | Switchgrass Phyllosphere | VKQSQITKPTSEPRASDSEESNETFERTVRGWLV* |
| Ga0182115_12401291 | 3300015348 | Switchgrass Phyllosphere | VLKNSNILNANYDVNQSQFTKPTSEPYDYKESNEAFDRTIKKWYCS |
| Ga0182115_12710981 | 3300015348 | Switchgrass Phyllosphere | MNSDILTAYYGVKQSQFTKPTPEPRASDSEESNNAFDRVIRGWL |
| Ga0182185_10417262 | 3300015349 | Switchgrass Phyllosphere | VKQSQFTKPTSEPRVSDPEESNEAFDRAIREWLL* |
| Ga0182185_10645281 | 3300015349 | Switchgrass Phyllosphere | TTLIANYGVKQSQFTKPTSELRVSDLEESNEAFDCAIRGWLL* |
| Ga0182185_10985101 | 3300015349 | Switchgrass Phyllosphere | NYSVKQSQFTKPTSEPRASDPEESNEAFDRAIREWLL* |
| Ga0182185_11623621 | 3300015349 | Switchgrass Phyllosphere | TLIINYGVKQSQFTKSTLEPRASDPEESNEIFDCAIRGWLL* |
| Ga0182185_12471652 | 3300015349 | Switchgrass Phyllosphere | TANYSVKQRQFTKPTSEPHASNPEESNEVFDRAIR* |
| Ga0182185_12522031 | 3300015349 | Switchgrass Phyllosphere | MNSDILTDNYGVKQNQFTKSTSEPRVSDSKKSNEVFNHAIR* |
| Ga0182185_12634411 | 3300015349 | Switchgrass Phyllosphere | ANYGVKQSQFTKLTSGPRANDPEESNETFGRVIRGWLL* |
| Ga0182169_10708081 | 3300015352 | Switchgrass Phyllosphere | VNNDNFTVNYGVKQSKFIKPTSEPRASDPEESNEAFD |
| Ga0182169_11181241 | 3300015352 | Switchgrass Phyllosphere | ANYGVKQSQFTKPTLEPRASDHKESNEAVDRTIRGWLL* |
| Ga0182169_11228572 | 3300015352 | Switchgrass Phyllosphere | MLVNSDILTANYCIKQSQFTKPTSEPRASDSEKFNE |
| Ga0182169_12429531 | 3300015352 | Switchgrass Phyllosphere | NYDIKQSQFTKPTSEPRASDLEESNETFDRAIREWLL* |
| Ga0182169_12462491 | 3300015352 | Switchgrass Phyllosphere | PVWFCSALVNSDTLTVYYGVKQSQFTKPTPEPRASDPEEFNEVFDRAIRG* |
| Ga0182169_13020281 | 3300015352 | Switchgrass Phyllosphere | YGVKQNQFTKPTSEPRASDLEESNEAFDRAIRRWLL* |
| Ga0182169_13085352 | 3300015352 | Switchgrass Phyllosphere | LLVNSDNLIVNYGVKQSQFTKPTSEPRASDSEESNEAFDHTI*GRLL* |
| Ga0182179_10207802 | 3300015353 | Switchgrass Phyllosphere | VLMNSDILTANNCVKQSQFTKPTSEPRASDPEESNEVFDRAIRG* |
| Ga0182179_12119611 | 3300015353 | Switchgrass Phyllosphere | NYGVKQSQFTKPTSEPRASDLEESNETFNRAIRG* |
| Ga0182167_10208651 | 3300015354 | Switchgrass Phyllosphere | ILIANYGVKQSQFTKPTSEPRASDPEESNDAFDRAIRR* |
| Ga0182167_10430762 | 3300015354 | Switchgrass Phyllosphere | MLVNNDIFTVNYGVKQSQFTEPTSEPRASDPEESNEPFDRTIRG* |
| Ga0182167_11283401 | 3300015354 | Switchgrass Phyllosphere | TTNYGVKQSQFTKSTLEPRASDAEEFNKAFDRVIRG* |
| Ga0182167_11381382 | 3300015354 | Switchgrass Phyllosphere | LTANYSVKQSQFIKPTPEPRASDAEESNKTFDRAIRG* |
| Ga0182167_12113011 | 3300015354 | Switchgrass Phyllosphere | VNSDIWTANYGVKQIQFTKPTSEPRASDPEEFNETFDCAIRGW |
| Ga0182167_12264621 | 3300015354 | Switchgrass Phyllosphere | VLCQSVLVNSNILTLNYGIKQSQFTKLTSEPHISDPEESDEAFDRAIRGG* |
| Ga0182167_12368931 | 3300015354 | Switchgrass Phyllosphere | MNSDILTVNYGVKQNQFKKPNLEPRASDLEESNTAFDRAIRGWLL* |
| Ga0182167_12386861 | 3300015354 | Switchgrass Phyllosphere | NTLTVNYGVKQSQFTKPISKSRARNPKDSNEIFDHVI* |
| Ga0182167_12435272 | 3300015354 | Switchgrass Phyllosphere | DSLTINYGIKQNQFTKPTSKPRASDPEESNVAFDRAIRRWLL* |
| Ga0182167_12760491 | 3300015354 | Switchgrass Phyllosphere | QLVNSDTLTTNYGVKQSQFTKPISEPRASDSEESNKAFDRAIREWLL* |
| Ga0182199_11410791 | 3300017412 | Switchgrass Phyllosphere | MNSDILTVNYGVKQSQFTKPTPEPRASDAEESNKIFDRVIR |
| Ga0182199_11962611 | 3300017412 | Switchgrass Phyllosphere | LTANCGTKQSRFTKSISEPRASNPEESNEIFDRAIRG |
| Ga0182195_10453761 | 3300017414 | Switchgrass Phyllosphere | VNSDTLTVYYGVKQNQFTKLTPEPRASDLEESNEAFDRAIKGW |
| Ga0182195_10465801 | 3300017414 | Switchgrass Phyllosphere | SDILTANYGVKQSQFIKQTSEPRTSDPEESNETVDYGSRE |
| Ga0182195_10626342 | 3300017414 | Switchgrass Phyllosphere | VNSNILTINYGIKQSQFTKLTSEPHASDPEESNEAFDRAIREG |
| Ga0182195_10829251 | 3300017414 | Switchgrass Phyllosphere | ANYGVKQNQFTKPTSEPRASDPEEFNETFDRAIRGWLL |
| Ga0182195_11070382 | 3300017414 | Switchgrass Phyllosphere | SMLVNSDSLTVNYGVKQNQFIKPTSEPPASDSEESNETFNCAIRG |
| Ga0182195_11936062 | 3300017414 | Switchgrass Phyllosphere | MLRIVTTLTINYGVKQSQFIKTTSEPRASDPKESNETFDRAI |
| Ga0182213_12245201 | 3300017421 | Switchgrass Phyllosphere | MGYGLTANYDIKQTRFTKPTLEPRARNPKNFNEAF |
| Ga0182196_11566551 | 3300017432 | Switchgrass Phyllosphere | MALTANYSIQQSQFIKSTLEPRASNPQESNKIFDRAIRGWLL |
| Ga0182200_10752383 | 3300017439 | Switchgrass Phyllosphere | APSLNSDILTATYGVKQSQFTKPTSEPRTSDPEESNEAFDRMIREWLL |
| Ga0182200_11059031 | 3300017439 | Switchgrass Phyllosphere | MNSDILTINYDIKQKQFTKPTPEPRASDPEESNEAFDRAIRGWLL |
| Ga0182198_10903632 | 3300017445 | Switchgrass Phyllosphere | ILTINYGIKQSQFTKLTSEPHASDPEESNEAFDRAIRGG |
| Ga0182198_11368151 | 3300017445 | Switchgrass Phyllosphere | MNSDILVKQDQFTKPTPESRANDFEESNKAFDRAIRD |
| Ga0182198_11464181 | 3300017445 | Switchgrass Phyllosphere | VNSDILTVNYGVKQNQLTKLTLEPRASDPEESNKVFD |
| Ga0182198_11753032 | 3300017445 | Switchgrass Phyllosphere | MLVNSDSLTANYGVKQSQFTKLTSEPRANDPEESNETFGRAIR |
| Ga0182198_11982721 | 3300017445 | Switchgrass Phyllosphere | MNSNILIANYGVKQSQITKPTSEPRASDSEESQEAFDHAIRV |
| Ga0182178_10033062 | 3300020023 | Switchgrass Phyllosphere | NYGVKQSQFTKPTSEPRASNPEESNKAFDRAIRGWLL |
| Ga0182146_1069781 | 3300020033 | Switchgrass Phyllosphere | VNSDSLIANYGVKQSQFTKPTSNSRASDPEESNEAFDRAIREW |
| Ga0207869_10267531 | 3300025517 | Ionic Liquid And High Solid Enriched | YGVKQSQFTKSTSEPRASDPEESNEAFDRAIRGWLL |
| Ga0207641_122128591 | 3300026088 | Switchgrass Rhizosphere | VLVNSDSLTANYGVKQNQFTKPTLKPRASDPKESNEDFDRAIREWLL |
| Ga0207641_124035911 | 3300026088 | Switchgrass Rhizosphere | MLINSDILTANYGIKQSQFTKPTPEPRANDAEESNKAFDRTIRG |
| Ga0268322_10528511 | 3300028049 | Phyllosphere | VLVNSDSLTANYGIKQSQFTKLTLEPRASDPKESNEA |
| Ga0268330_10243871 | 3300028056 | Phyllosphere | MLMHSDILTANYGVKQSQFIKQTSEPRTSDPEESNETVD |
| Ga0268320_10100521 | 3300028153 | Phyllosphere | FYGVKQSQFTKPTSEPGASDYKESNEAFDRAIRGWLL |
| Ga0268307_10027051 | 3300028470 | Phyllosphere | LTANYGVKQSQFTKPTSEPRARNPEDSNEFFDSAIWG |
| Ga0268307_10188011 | 3300028470 | Phyllosphere | MNSDILTDNYGVKQNQFTKSTSEPRASDPEESNEVFDCAIREWLL |
| Ga0268315_10127411 | 3300028472 | Phyllosphere | ILTANYGIKQSQFTKSTPEPRASDPEEFNKIFDRAIR |
| Ga0268315_10271681 | 3300028472 | Phyllosphere | MHTSRKILTVNYGVKQSQFTKPTSEPYASDYKESNEAFDRAIR |
| Ga0268329_10040761 | 3300028476 | Phyllosphere | VLVNSDSLTTNYDVKQSQFTKPTSEPRASDPEESNGDFDYAIR |
| Ga0268309_10105551 | 3300028477 | Phyllosphere | LTANYGVKQSQFTKPTSEPRASDPEESNEAFDRTIRGWL |
| Ga0214493_11122121 | 3300032465 | Switchgrass Phyllosphere | MNSDILIANYGVKQSQFIKPTLEPPYRTGDSEEPNKIFNH |
| Ga0214503_12041871 | 3300032466 | Switchgrass Phyllosphere | MFSVLFVRAMLVNNNILIANYGVKQNQFTKLTSEPRASDLEECNEVFDRAIRG |
| Ga0214488_10452762 | 3300032467 | Switchgrass Phyllosphere | MLVNSDILTANYGVKQNQFTKPTSEPRASDPEEYNEAFDRVIRE |
| Ga0214488_10680892 | 3300032467 | Switchgrass Phyllosphere | VLVNSETLTTNYGVKQSQFTKPTLEPHASDLEESNKTFDRAI |
| Ga0214482_10199272 | 3300032468 | Switchgrass Phyllosphere | LVWFCSALVNSDTLTTYYGVKQSQFTKPTPESRASDPEESNEAFDRAIGGWLL |
| Ga0214491_11612442 | 3300032469 | Switchgrass Phyllosphere | MNSDILTANYGIKQSQFTKPTPEPRASDLEESNKAFDRAIRGWLL |
| Ga0214490_11462081 | 3300032502 | Switchgrass Phyllosphere | DILIANYGVKQSQFIKQTSEPRASDPEESNKTVDCGIRE |
| Ga0214483_10366622 | 3300032548 | Switchgrass Phyllosphere | MLVNRDILIANYGVKQSQFTKPTSEPRASDPEEFNEAFDRAIRG |
| Ga0321339_10579581 | 3300032551 | Switchgrass Phyllosphere | ILTVNYGVKQSKFTKPTPESRASDASDPEESNKAFDPAIRGWLL |
| Ga0321339_10704601 | 3300032551 | Switchgrass Phyllosphere | VNSDTLTTYYGVKQSQFTKPTPESRASDPEESNEAFDRAIGEWLL |
| Ga0321339_11030711 | 3300032551 | Switchgrass Phyllosphere | VNSDTLTTYYGVKQNQFKKPTPEPRASDPEESNEAFDRAIGEWLL |
| Ga0214484_10776981 | 3300032591 | Switchgrass Phyllosphere | VNSDTLTAYYSVKQTQFTKPTPEPRASDPEESNETFDRAIGGWLL |
| Ga0214504_10640131 | 3300032592 | Switchgrass Phyllosphere | VNSDTLTAYYGVKQSQFTKPTPESRASDPEESNEAFDRAIGEWLL |
| Ga0214499_10773812 | 3300032697 | Switchgrass Phyllosphere | MNSDTLTAYYGVKQSQFTKPTPKPRASDPEESNEAFDRAIGEWLL |
| Ga0314746_10075612 | 3300032758 | Switchgrass Phyllosphere | MNSDILTANYGIKQSQFTKTTPEPRASDLEESNKAFDRAIRG |
| Ga0314725_10395451 | 3300032789 | Switchgrass Phyllosphere | MNSDIFTANYGVKQSQFTKPTPEPRASDASDPEESNEPFDPASRGWLL |
| Ga0314744_10036782 | 3300032792 | Switchgrass Phyllosphere | MLVWFWSALVNSDTLTAYYGVKQSQFIKPTPEPRASDPEESNEAFDRAIGGWLL |
| Ga0314745_10278142 | 3300032812 | Switchgrass Phyllosphere | VPVNSDSLTVNYGVKQNQFTKPTSEPRTSDPEESNEAFDRAIRERLL |
| Ga0314745_11293212 | 3300032812 | Switchgrass Phyllosphere | RVNSDILTANYSIKQSQFTKLISEPRARNPEKSNEAFDRAIRE |
| Ga0314740_10291172 | 3300032822 | Switchgrass Phyllosphere | MNSDTLTAYYGVKQSQFTKPTPEPRASDPEESNEAFDRAIGGLLL |
| Ga0314723_11069441 | 3300032823 | Switchgrass Phyllosphere | LVNSDTLTAYYGVKQNQFTKPTPEPRASDPEESNEAFDRAIGEWLL |
| Ga0314743_11363692 | 3300032844 | Switchgrass Phyllosphere | MNSDILTANYGVKQSQFTKPTPEPRANDLEESNKVFDCAIRGCL |
| Ga0314750_11191982 | 3300032914 | Switchgrass Phyllosphere | VYYGVKQNQFTKLTPEPRASDLKEFNEAFDRAIKGWLL |
| Ga0314750_11663182 | 3300032914 | Switchgrass Phyllosphere | VNSDTLTAYYSVKQTQFTKPTPEPRASDPEESNEAFDRAIGGLLL |
| Ga0314741_10120752 | 3300032934 | Switchgrass Phyllosphere | MSNEPPSSNVSDFVWFCSALVNSDTLTAYYGVKQSQFTKPTPEPRASDPEESNEAFDRAIGGLLL |
| Ga0314722_10188762 | 3300032966 | Switchgrass Phyllosphere | MNSDTLTAYYGVKQSQFTKPTPKPRASDPEESNETFDRAIGGWLL |
| Ga0314761_10333141 | 3300033526 | Switchgrass Phyllosphere | YGVKQSHFIKPTPEPCANDLEESNKASNRAIRGWLL |
| Ga0314767_11280982 | 3300033532 | Switchgrass Phyllosphere | MNSDILTANYGVKQRQFTNQLQNSRASDPEESNEDFDCAIRGWLLYH |
| Ga0314759_10389021 | 3300033535 | Switchgrass Phyllosphere | MRARILALVNSATLTANYGVKQSQFTKPTSKSCARNPEDSNEAFDRVIXG |
| Ga0314759_12221811 | 3300033535 | Switchgrass Phyllosphere | VIMNSDILTANYGIKQSQFTKPTPEPRASDLEESNKAFDRAIRG |
| ⦗Top⦘ |