Metagenome / Metatranscriptome Family F038940

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F038940
Family Type	Metagenome / Metatranscriptome
Number of Sequences	164
Average Sequence Length	42 residues
Representative Sequence	VNSDILTANYGVKQSQFTKPTSEPRASDPKESNEAFDRAIR
Number of Associated Samples	85
Number of Associated Scaffolds	164

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	17.68 %
% of genes near scaffold ends (potentially truncated)	76.83 %
% of genes from short scaffolds (< 2000 bps)	98.17 %
Associated GOLD sequencing projects	84
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.30

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (87.805 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (87.195 % of family members)
Environment Ontology (ENVO)	Unclassified (96.341 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (77.439 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 39.13% β-sheet: 0.00% Coil/Unstructured: 60.87%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.30
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.30
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 164 Family Scaffolds
PF00078	RVT_1	0.61
PF13180	PDZ_2	0.61

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	87.80 %
All Organisms	root	All Organisms	12.20 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	87.80 %
cellular organisms	root	All Organisms → cellular organisms	12.20 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	87.80 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	12.20 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	87.80 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	12.20 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	87.80 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	12.20 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	87.80 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	12.20 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	87.80 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	12.20 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	87.80 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	9.76 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	87.80 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	9.76 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	87.80 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	9.76 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	87.80 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	9.76 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	87.80 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	9.76 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	87.80 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	9.76 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	87.80 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	9.76 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	87.80 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	9.76 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	87.80 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	9.76 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	87.80 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	9.76 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	87.80 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	7.32 %
BOP clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade	0.61 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	87.80 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	6.10 %
Oryzoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae	0.61 %
Arundinoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae	0.61 %
Chloridoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae	0.61 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	87.80 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	5.49 %
Andropogonodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae	0.61 %
Eragrostideae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae	0.61 %
Arundineae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae	0.61 %
Oryzeae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae	0.61 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	87.80 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	5.49 %
Eragrostidinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae → Eragrostidinae	0.61 %
Oryzinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae	0.61 %
Arundo	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo	0.61 %
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	0.61 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	87.80 %
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	4.88 %
Oryza	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	0.61 %
Saccharinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae	0.61 %
Arundo donax	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	0.61 %
Eragrostis	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae → Eragrostidinae → Eragrostis	0.61 %
Cenchrinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae	0.61 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	87.80 %
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	4.88 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria	0.61 %
Eragrostis curvula	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae → Eragrostidinae → Eragrostis → Eragrostis curvula	0.61 %
Miscanthus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus	0.61 %
Oryza	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	0.61 %
Arundo donax	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	0.61 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	87.80 %
Panicum sect. Hiantes	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes	3.05 %
Panicum sect. Panicum	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum	1.83 %
Setaria viridis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis	0.61 %
Miscanthus lutarioriparius	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	0.61 %
Eragrostis curvula	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae → Eragrostidinae → Eragrostis → Eragrostis curvula	0.61 %
Oryza	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	0.61 %
Arundo donax	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	0.61 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	87.80 %
Panicum virgatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	3.05 %
Panicum hallii	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii	1.83 %
Setaria viridis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis	0.61 %
Miscanthus lutarioriparius	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	0.61 %
Eragrostis curvula	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae → Eragrostidinae → Eragrostis → Eragrostis curvula	0.61 %
Oryza	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	0.61 %
Arundo donax	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	0.61 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300005841\|Ga0068863_102704373	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	505	Open in IMG/M
3300005844\|Ga0068862_102782764	Not Available	501	Open in IMG/M
3300009980\|Ga0105135_111753	Not Available	685	Open in IMG/M
3300009989\|Ga0105131_123365	Not Available	626	Open in IMG/M
3300009994\|Ga0105126_1036789	Not Available	592	Open in IMG/M
3300009994\|Ga0105126_1044732	Not Available	552	Open in IMG/M
3300009995\|Ga0105139_1058917	Not Available	691	Open in IMG/M
3300010401\|Ga0134121_11838162	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	633	Open in IMG/M
3300014968\|Ga0157379_11716344	Not Available	615	Open in IMG/M
3300015270\|Ga0182183_1057469	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	593	Open in IMG/M
3300015273\|Ga0182102_1028412	Not Available	579	Open in IMG/M
3300015280\|Ga0182100_1075839	Not Available	555	Open in IMG/M
3300015290\|Ga0182105_1056884	Not Available	632	Open in IMG/M
3300015293\|Ga0182103_1017292	Not Available	869	Open in IMG/M
3300015301\|Ga0182184_1094454	Not Available	515	Open in IMG/M
3300015306\|Ga0182180_1065578	Not Available	574	Open in IMG/M
3300015309\|Ga0182098_1126991	Not Available	504	Open in IMG/M
3300015310\|Ga0182162_1049010	Not Available	715	Open in IMG/M
3300015311\|Ga0182182_1011126	Not Available	1096	Open in IMG/M
3300015311\|Ga0182182_1051190	Not Available	685	Open in IMG/M
3300015312\|Ga0182168_1061584	Not Available	682	Open in IMG/M
3300015313\|Ga0182164_1127636	Not Available	518	Open in IMG/M
3300015315\|Ga0182120_1139769	Not Available	502	Open in IMG/M
3300015317\|Ga0182136_1130641	Not Available	519	Open in IMG/M
3300015318\|Ga0182181_1050668	Not Available	668	Open in IMG/M
3300015318\|Ga0182181_1061482	Not Available	627	Open in IMG/M
3300015318\|Ga0182181_1114660	Not Available	504	Open in IMG/M
3300015319\|Ga0182130_1062124	Not Available	671	Open in IMG/M
3300015319\|Ga0182130_1119623	Not Available	530	Open in IMG/M
3300015319\|Ga0182130_1132801	Not Available	509	Open in IMG/M
3300015324\|Ga0182134_1120731	Not Available	546	Open in IMG/M
3300015325\|Ga0182148_1066250	Not Available	676	Open in IMG/M
3300015325\|Ga0182148_1140211	Not Available	511	Open in IMG/M
3300015326\|Ga0182166_1052420	Not Available	730	Open in IMG/M
3300015326\|Ga0182166_1092019	Not Available	599	Open in IMG/M
3300015327\|Ga0182114_1069999	Not Available	705	Open in IMG/M
3300015327\|Ga0182114_1090103	Not Available	640	Open in IMG/M
3300015327\|Ga0182114_1112014	Not Available	587	Open in IMG/M
3300015329\|Ga0182135_1069771	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii	685	Open in IMG/M
3300015329\|Ga0182135_1143804	Not Available	518	Open in IMG/M
3300015331\|Ga0182131_1022376	Not Available	1005	Open in IMG/M
3300015331\|Ga0182131_1088273	Not Available	632	Open in IMG/M
3300015332\|Ga0182117_1085886	Not Available	671	Open in IMG/M
3300015333\|Ga0182147_1028550	Not Available	979	Open in IMG/M
3300015333\|Ga0182147_1038188	Not Available	888	Open in IMG/M
3300015333\|Ga0182147_1043982	Not Available	847	Open in IMG/M
3300015333\|Ga0182147_1075096	Not Available	699	Open in IMG/M
3300015333\|Ga0182147_1075928	Not Available	696	Open in IMG/M
3300015334\|Ga0182132_1018140	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	1130	Open in IMG/M
3300015334\|Ga0182132_1062596	Not Available	750	Open in IMG/M
3300015334\|Ga0182132_1078887	Not Available	688	Open in IMG/M
3300015334\|Ga0182132_1143941	Not Available	539	Open in IMG/M
3300015335\|Ga0182116_1123065	Not Available	594	Open in IMG/M
3300015335\|Ga0182116_1124448	Not Available	591	Open in IMG/M
3300015336\|Ga0182150_1015392	Not Available	1151	Open in IMG/M
3300015336\|Ga0182150_1073995	Not Available	692	Open in IMG/M
3300015336\|Ga0182150_1084454	Not Available	659	Open in IMG/M
3300015336\|Ga0182150_1091086	Not Available	640	Open in IMG/M
3300015336\|Ga0182150_1167914	Not Available	500	Open in IMG/M
3300015337\|Ga0182151_1160806	Not Available	510	Open in IMG/M
3300015338\|Ga0182137_1067545	Not Available	755	Open in IMG/M
3300015338\|Ga0182137_1090879	Not Available	672	Open in IMG/M
3300015338\|Ga0182137_1150363	Not Available	543	Open in IMG/M
3300015338\|Ga0182137_1168792	Not Available	515	Open in IMG/M
3300015339\|Ga0182149_1072002	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	719	Open in IMG/M
3300015339\|Ga0182149_1172976	Not Available	504	Open in IMG/M
3300015340\|Ga0182133_1104826	Not Available	652	Open in IMG/M
3300015340\|Ga0182133_1122435	Not Available	612	Open in IMG/M
3300015348\|Ga0182115_1008233	Not Available	2199	Open in IMG/M
3300015348\|Ga0182115_1008554	Not Available	2177	Open in IMG/M
3300015348\|Ga0182115_1166100	Not Available	708	Open in IMG/M
3300015348\|Ga0182115_1174105	Not Available	690	Open in IMG/M
3300015348\|Ga0182115_1185365	Not Available	667	Open in IMG/M
3300015348\|Ga0182115_1220248	Not Available	607	Open in IMG/M
3300015348\|Ga0182115_1231212	Not Available	590	Open in IMG/M
3300015348\|Ga0182115_1240129	Not Available	577	Open in IMG/M
3300015348\|Ga0182115_1271098	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis	538	Open in IMG/M
3300015349\|Ga0182185_1041726	Not Available	1174	Open in IMG/M
3300015349\|Ga0182185_1064528	Not Available	995	Open in IMG/M
3300015349\|Ga0182185_1098510	Not Available	837	Open in IMG/M
3300015349\|Ga0182185_1162362	Not Available	668	Open in IMG/M
3300015349\|Ga0182185_1247165	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii	543	Open in IMG/M
3300015349\|Ga0182185_1252203	Not Available	538	Open in IMG/M
3300015349\|Ga0182185_1263441	Not Available	526	Open in IMG/M
3300015352\|Ga0182169_1070808	Not Available	1084	Open in IMG/M
3300015352\|Ga0182169_1118124	Not Available	857	Open in IMG/M
3300015352\|Ga0182169_1122857	Not Available	840	Open in IMG/M
3300015352\|Ga0182169_1242953	Not Available	586	Open in IMG/M
3300015352\|Ga0182169_1246249	Not Available	581	Open in IMG/M
3300015352\|Ga0182169_1302028	Not Available	516	Open in IMG/M
3300015352\|Ga0182169_1308535	Not Available	509	Open in IMG/M
3300015353\|Ga0182179_1020780	Not Available	1544	Open in IMG/M
3300015353\|Ga0182179_1211961	Not Available	619	Open in IMG/M
3300015354\|Ga0182167_1020865	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1953	Open in IMG/M
3300015354\|Ga0182167_1043076	Not Available	1516	Open in IMG/M
3300015354\|Ga0182167_1128340	Not Available	935	Open in IMG/M
3300015354\|Ga0182167_1138138	Not Available	899	Open in IMG/M
3300015354\|Ga0182167_1211301	Not Available	708	Open in IMG/M
3300015354\|Ga0182167_1226462	Not Available	679	Open in IMG/M
3300015354\|Ga0182167_1236893	Not Available	661	Open in IMG/M
3300015354\|Ga0182167_1238686	Not Available	658	Open in IMG/M
3300015354\|Ga0182167_1243527	Not Available	650	Open in IMG/M
3300015354\|Ga0182167_1276049	Not Available	601	Open in IMG/M
3300017412\|Ga0182199_1141079	Not Available	583	Open in IMG/M
3300017412\|Ga0182199_1196261	Not Available	511	Open in IMG/M
3300017414\|Ga0182195_1045376	Not Available	916	Open in IMG/M
3300017414\|Ga0182195_1046580	Not Available	908	Open in IMG/M
3300017414\|Ga0182195_1062634	Not Available	819	Open in IMG/M
3300017414\|Ga0182195_1082925	Not Available	741	Open in IMG/M
3300017414\|Ga0182195_1107038	Not Available	673	Open in IMG/M
3300017414\|Ga0182195_1193606	Not Available	532	Open in IMG/M
3300017421\|Ga0182213_1224520	Not Available	537	Open in IMG/M
3300017432\|Ga0182196_1156655	Not Available	502	Open in IMG/M
3300017439\|Ga0182200_1075238	Not Available	662	Open in IMG/M
3300017439\|Ga0182200_1105903	Not Available	588	Open in IMG/M
3300017445\|Ga0182198_1090363	Not Available	687	Open in IMG/M
3300017445\|Ga0182198_1136815	Not Available	588	Open in IMG/M
3300017445\|Ga0182198_1146418	Not Available	573	Open in IMG/M
3300017445\|Ga0182198_1175303	Not Available	533	Open in IMG/M
3300017445\|Ga0182198_1198272	Not Available	507	Open in IMG/M
3300020023\|Ga0182178_1003306	Not Available	957	Open in IMG/M
3300020033\|Ga0182146_106978	Not Available	503	Open in IMG/M
3300025517\|Ga0207869_1026753	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	839	Open in IMG/M
3300026088\|Ga0207641_12212859	Not Available	550	Open in IMG/M
3300026088\|Ga0207641_12403591	Not Available	526	Open in IMG/M
3300028049\|Ga0268322_1052851	Not Available	516	Open in IMG/M
3300028056\|Ga0268330_1024387	Not Available	702	Open in IMG/M
3300028153\|Ga0268320_1010052	Not Available	696	Open in IMG/M
3300028470\|Ga0268307_1002705	Not Available	954	Open in IMG/M
3300028470\|Ga0268307_1018801	Not Available	549	Open in IMG/M
3300028472\|Ga0268315_1012741	Not Available	641	Open in IMG/M
3300028472\|Ga0268315_1027168	Not Available	507	Open in IMG/M
3300028476\|Ga0268329_1004076	Not Available	879	Open in IMG/M
3300028477\|Ga0268309_1010555	Not Available	621	Open in IMG/M
3300032465\|Ga0214493_1112212	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	644	Open in IMG/M
3300032466\|Ga0214503_1204187	Not Available	615	Open in IMG/M
3300032467\|Ga0214488_1045276	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii	968	Open in IMG/M
3300032467\|Ga0214488_1068089	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	788	Open in IMG/M
3300032468\|Ga0214482_1019927	Not Available	1217	Open in IMG/M
3300032469\|Ga0214491_1161244	Not Available	519	Open in IMG/M
3300032502\|Ga0214490_1146208	Not Available	534	Open in IMG/M
3300032548\|Ga0214483_1036662	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	824	Open in IMG/M
3300032551\|Ga0321339_1057958	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	888	Open in IMG/M
3300032551\|Ga0321339_1070460	Not Available	805	Open in IMG/M
3300032551\|Ga0321339_1103071	Not Available	649	Open in IMG/M
3300032591\|Ga0214484_1077698	Not Available	697	Open in IMG/M
3300032592\|Ga0214504_1064013	Not Available	721	Open in IMG/M
3300032697\|Ga0214499_1077381	Not Available	1006	Open in IMG/M
3300032758\|Ga0314746_1007561	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1957	Open in IMG/M
3300032789\|Ga0314725_1039545	Not Available	561	Open in IMG/M
3300032792\|Ga0314744_1003678	Not Available	2278	Open in IMG/M
3300032812\|Ga0314745_1027814	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	1185	Open in IMG/M
3300032812\|Ga0314745_1129321	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	510	Open in IMG/M
3300032822\|Ga0314740_1029117	Not Available	827	Open in IMG/M
3300032823\|Ga0314723_1106944	Not Available	517	Open in IMG/M
3300032844\|Ga0314743_1136369	Not Available	546	Open in IMG/M
3300032914\|Ga0314750_1119198	Not Available	615	Open in IMG/M
3300032914\|Ga0314750_1166318	Not Available	512	Open in IMG/M
3300032934\|Ga0314741_1012075	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae → Eragrostidinae → Eragrostis → Eragrostis curvula	1709	Open in IMG/M
3300032966\|Ga0314722_1018876	Not Available	1072	Open in IMG/M
3300033526\|Ga0314761_1033314	Not Available	1110	Open in IMG/M
3300033532\|Ga0314767_1128098	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	637	Open in IMG/M
3300033535\|Ga0314759_1038902	Not Available	1383	Open in IMG/M
3300033535\|Ga0314759_1222181	Not Available	600	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	98.78%
Environmental	Environmental	0.61%
Engineered	Engineered	0.61%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	98.78%
Terrestrial	Environmental → Terrestrial	0.61%
Lab Enrichment	Engineered → Lab Enrichment	0.61%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	92.68%
Unclassified	Host-Associated → Plants → Unclassified	3.05%
Rhizoplane	Host-Associated → Plants → Rhizoplane	2.44%
Soil	Environmental → Terrestrial → Soil	0.61%
Rhizosphere	Host-Associated → Plants → Rhizosphere	0.61%
Defined Media	Engineered → Lab Enrichment → Defined Media	0.61%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	92.68%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified	3.05%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	2.44%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	0.61%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	0.61%
Unclassified	Engineered → Lab Enrichment → Defined Media → Unclassified	0.61%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	92.68%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified → Unclassified	3.05%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	2.44%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	0.61%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	0.61%
Unclassified	Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified	0.61%

Habitat	Taxonomy	Distribution
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	87.20%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	5.49%
Switchgrass Associated	Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated	3.05%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.44%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.61%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.61%
Ionic Liquid And High Solid Enriched	Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Ionic Liquid And High Solid Enriched	0.61%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated	Open in IMG/M
3300009980	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaG	Host-Associated	Open in IMG/M
3300009989	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaG	Host-Associated	Open in IMG/M
3300009994	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaG	Host-Associated	Open in IMG/M
3300009995	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG	Host-Associated	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated	Open in IMG/M
3300015270	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015273	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015280	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015290	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015293	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015301	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015306	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015309	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015310	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015311	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015312	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015313	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015315	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015317	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015318	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015319	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015324	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015325	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015326	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015327	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015329	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015331	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015332	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015333	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015334	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015335	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015336	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015337	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015338	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015339	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015340	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015348	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015349	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015352	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015353	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015354	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017412	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017414	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017421	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017432	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017439	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017445	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300020023	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_22AUG2016_LD2 MG	Host-Associated	Open in IMG/M
3300020033	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12JUL2016_LD2 MG	Host-Associated	Open in IMG/M
3300025517	Ionic liquid and high solid enriched microbial communities from the Joint BioEnergy Institute, USA - AR20-5-D (SPAdes)	Engineered	Open in IMG/M
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028049	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028056	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028153	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028470	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_15MAY2017_LD1	Host-Associated	Open in IMG/M
3300028472	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300028476	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028477	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300032465	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032466	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032467	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_31MAY2016_LR2 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032468	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032469	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032502	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032548	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032551	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_31MAY2016_LR2 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032591	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032592	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032697	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032758	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032789	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032792	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032812	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032822	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032823	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032844	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032914	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032934	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032966	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_15MAY2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033526	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033532	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_18SEP2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033535	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0068863_1027043732	3300005841	Switchgrass Rhizosphere	MNSDVLTVNYDVKQRQFTKPTPEPHASDLEESNKAFDRVIEDGYCSITVA
Ga0068862_1027827642	3300005844	Switchgrass Rhizosphere	TLTANYGVKQSQFTKPTSEPRASDPEESNEAFDRTIRGWLL*
Ga0105135_1117531	3300009980	Switchgrass Associated	MNSDILTTNYGVKQSQFTKPTSEPRASDLEESNETFDRV
Ga0105131_1233651	3300009989	Switchgrass Associated	NYDVKQSQFTKPTPEPRVRNPKESNEAFDHVIRG*
Ga0105126_10367891	3300009994	Switchgrass Associated	MNSDILTANYGVKQSQFTKSTPEPRASDLEESNKIFDRAIRG*
Ga0105126_10447321	3300009994	Switchgrass Associated	VKQSQFTKQTSGPGASDYKESNEAFDRAIRGWLL*
Ga0105139_10589171	3300009995	Switchgrass Associated	VLMNSDILTDNYGVKQNQFTKSTSEPRASDPEESNEVFDCAIREWVL*
Ga0134121_118381621	3300010401	Terrestrial Soil	ILTVNYGVKQSQLTKLTLEPRASDPEESNKVFDRVIRGWLL*
Ga0157379_117163442	3300014968	Switchgrass Rhizosphere	ANYGDKQSQFTKPTSEPRASDPEESNETFNRVIRE*
Ga0182183_10574692	3300015270	Switchgrass Phyllosphere	MLINSDILTANYGIKQSQFTKSTPEPRASDPEEFNKVFDRAIR*
Ga0182102_10284121	3300015273	Switchgrass Phyllosphere	WFRRAPVNSDILIVYYGVRQNQFIKPTPESRASDHKESNEAFDRTIRGWLL*
Ga0182100_10758391	3300015280	Switchgrass Phyllosphere	INYGVKQNQFTKPTSEPRASDPEESNETFDRAIRGWLL*
Ga0182105_10568841	3300015290	Switchgrass Phyllosphere	INYGVKQSQFTKPTSEPRASDPEESNEAFDRAIRGWLL*
Ga0182103_10172921	3300015293	Switchgrass Phyllosphere	MLNNSDILTANYGVKQSQFIKPTPEPRASDPEESNEAFDRVIRGWLL*
Ga0182184_10944541	3300015301	Switchgrass Phyllosphere	AYYGVKQSEFTKPTLEPRASDPEESNEAFDRAIRG*
Ga0182180_10655781	3300015306	Switchgrass Phyllosphere	MPNLVLSCLRNSNIFTANYGVKQNQFTKLTLEPRARNPEESNEIFDRVIR
Ga0182098_11269911	3300015309	Switchgrass Phyllosphere	VNSDTLTANYGVKQSQFTKPTSEPRASDPEESNKAFDRVIRGWLL*
Ga0182162_10490101	3300015310	Switchgrass Phyllosphere	ANYGVKQSQFTKPTSEPRASDPEESNETFDRGWLL*
Ga0182182_10111262	3300015311	Switchgrass Phyllosphere	MNSDILTADYGIKQSQFTKPTPEPRASDLEESNKAFDRAIKGWLL*
Ga0182182_10511901	3300015311	Switchgrass Phyllosphere	VLVNSDILTANYSVKQSQLTKLTSEPRARNPEESNKTFDRTI
Ga0182168_10615841	3300015312	Switchgrass Phyllosphere	NLIVNYGAKQSQFTKSTSEPRASDPEESNEDFDRAIRGWLL*
Ga0182164_11276361	3300015313	Switchgrass Phyllosphere	LTVNYGVKQSQFTKLTPEPCAKNLEESIEGFDRVVRVWYCSITV
Ga0182120_11397691	3300015315	Switchgrass Phyllosphere	SIRGVKQIQFSKLTPEPCARNTEEFNEVFDRVIRGWLL*
Ga0182136_11306411	3300015317	Switchgrass Phyllosphere	LRARNSDILTANYGVKQIQFIKPTSESRASDPEESNEFFGRTIRGWLL*
Ga0182181_10506681	3300015318	Switchgrass Phyllosphere	TVNYGVKQNQFTKSTPEPCARNPEESNEAFDHVIRG*
Ga0182181_10614821	3300015318	Switchgrass Phyllosphere	NSNSLTANYGVKQNQFIKPISEPRASDPEESDEVFDRAIR*
Ga0182181_11146601	3300015318	Switchgrass Phyllosphere	LVNSDILTANYDVKQSQFTKPTSEPHASDPEESNEVFNRAISG*
Ga0182130_10621241	3300015319	Switchgrass Phyllosphere	LTINYSVKQSQFTKPISEPRASDPEESNEAFDRAIR
Ga0182130_11196231	3300015319	Switchgrass Phyllosphere	MLHLGVPGNLTANYSVKQRQFTKPTPEPRASGASDLEESNKAFVRAIR
Ga0182130_11328011	3300015319	Switchgrass Phyllosphere	MHNDILTANYGVKQSQFIKPTSEPRASDPEEYNEAFYRAIRE*
Ga0182134_11207311	3300015324	Switchgrass Phyllosphere	VNSITLIVNYDVKQSQFIKSTSEFRASDHEECNEAFDR
Ga0182148_10662501	3300015325	Switchgrass Phyllosphere	NSDILTANYGVKQNQFTKPTSKPRVSDPEESNEAFDRAIRGWLL*
Ga0182148_11402111	3300015325	Switchgrass Phyllosphere	VKQSQFTKSTSEPRASDPEESNEVFDSAIREWLL*
Ga0182166_10524201	3300015326	Switchgrass Phyllosphere	STHTSRKILTANYGVKQNQFAKPTSKPCASDYKESNEAFDRAIRG*
Ga0182166_10920191	3300015326	Switchgrass Phyllosphere	MNNNILTANYGVKQNQFTKLTPELRASDPEESNEVFDRAIRG*
Ga0182114_10699992	3300015327	Switchgrass Phyllosphere	VNSDSLTANYDIKQSQFTKLTSEPRASDPEESNDVFDRAIREWLL*
Ga0182114_10901031	3300015327	Switchgrass Phyllosphere	LTINYGVKQNQFTKPISELRVSDPEESNKVFNCVIALVTLKNL
Ga0182114_11120142	3300015327	Switchgrass Phyllosphere	LTANYSVKQSQLTKLTSEPRARNPEESNEAFDRTIRE*
Ga0182135_10697712	3300015329	Switchgrass Phyllosphere	VNYGVKQRQFTKPTSEPHVSDPEESNEVFDRAIRG*
Ga0182135_11438041	3300015329	Switchgrass Phyllosphere	NSMLINSDILTVNYGVKQSQFTKLTLEPRASDPEKSNKVFDRAIRG*
Ga0182131_10223761	3300015331	Switchgrass Phyllosphere	MNSDILSANYGVKQSQFTKPTLAPRASDLEESNKTFDRVIR*
Ga0182131_10882731	3300015331	Switchgrass Phyllosphere	ALVNSDTLGVYYGVKQSQFTKSTPEPRASDLEESNEAFHRAIRGWLL*
Ga0182117_10858861	3300015332	Switchgrass Phyllosphere	TINYSVKQSQFTKPISEPRASDSEESNEVFDRAIRGRLL*
Ga0182147_10285501	3300015333	Switchgrass Phyllosphere	MNSDIFTANYGVKQSQFIKSTPEPRVSDPEESNEAFDRAIRGWLL*
Ga0182147_10381881	3300015333	Switchgrass Phyllosphere	VNSGTLTAYYGVKQNQFTKPTPEPRASDPEESNEAF
Ga0182147_10439821	3300015333	Switchgrass Phyllosphere	IVTTLTTNYDVKQSQFTKPTLELRARDPEESNEAFDHAIRG*
Ga0182147_10750961	3300015333	Switchgrass Phyllosphere	TNYGVKQSQFTKPTSEPRASDLEESNETFDRAIR*
Ga0182147_10759281	3300015333	Switchgrass Phyllosphere	VNSDILTANYGVKQSQFTKPTSEPRASDPKESNEAFDRAIR*
Ga0182132_10181402	3300015334	Switchgrass Phyllosphere	TLTANYGVKQSQFTKPTSEPRARNPEDSNEAFDRVI*
Ga0182132_10625961	3300015334	Switchgrass Phyllosphere	VKQSQFTKPTSEPRASDPEESNETFDRVIRGWVL*
Ga0182132_10788871	3300015334	Switchgrass Phyllosphere	NSDTLTANYGVKQSQFTKPTSEPRASDPKESNEVFDRAI*
Ga0182132_11439412	3300015334	Switchgrass Phyllosphere	MLVNSDSLTVNYGVKQSQFTKLTSEPRANDPEESNETFGRVIRGWLL*
Ga0182116_11230651	3300015335	Switchgrass Phyllosphere	ILTANYGVKQSQLQNQLQNPLASDAEESNKTFDHAIRE*
Ga0182116_11244481	3300015335	Switchgrass Phyllosphere	ITSVKLSQFTKPTSEPLRYRNPEESNEAFDRVIRGWLL*
Ga0182150_10153921	3300015336	Switchgrass Phyllosphere	LTANYGVKQNYFSKSTSEPRASDPEESNEAFDRAI
Ga0182150_10739952	3300015336	Switchgrass Phyllosphere	NVLVVNSDILAVNYRVKQNQFTKLTSEPRASDPEESNEFFDRAIKGWLL*
Ga0182150_10844541	3300015336	Switchgrass Phyllosphere	SDILTANYGVKQSQFTKQTSEPRASYPEESNEAFDRAIRGWLL*
Ga0182150_10910861	3300015336	Switchgrass Phyllosphere	VKQIQFIKSTSEPRASDPKESNEVFDRAIRGWLP*
Ga0182150_11679141	3300015336	Switchgrass Phyllosphere	ILTVNYGVKQNQFTKPTPEPRASDPEESNKAFDRAIRG*
Ga0182151_11608061	3300015337	Switchgrass Phyllosphere	TTSATNYSVKQNQFTKSTLESRASDFEESNKVFDRAIRG*
Ga0182137_10675451	3300015338	Switchgrass Phyllosphere	FRVTLTANYGIKQSQFIKSTSELHASDPEESNKIFDRTIRRWLL*
Ga0182137_10908791	3300015338	Switchgrass Phyllosphere	NILTGNYGVKQSQFTKPTSEPCVRNPEDSNEAFDRVI*
Ga0182137_11503631	3300015338	Switchgrass Phyllosphere	VLVNSDILTANYGVKQSQFTKPTSEPRASDPEEFNETFDRAIRGWLL*
Ga0182137_11687921	3300015338	Switchgrass Phyllosphere	NSDSLTANYDVKQSQFTKPTSEPRASDPEESNEVFDRAIRGWLL*
Ga0182149_10720022	3300015339	Switchgrass Phyllosphere	MNSDILIANYGVKQSQFTKPTSELRTSDPEESNEVFDRAIRGWLL*
Ga0182149_11729762	3300015339	Switchgrass Phyllosphere	MNSDILTANYGIKQRQFTKLTPEPRASDLEESNKAFERTIRGWLL*
Ga0182133_11048261	3300015340	Switchgrass Phyllosphere	VNSDILTVNYGAKQNQFTKPTLQPCASDSEESNETF
Ga0182133_11224351	3300015340	Switchgrass Phyllosphere	NYSIKQSQFIKPTSEPRASGPEESNEAFDRAIRGWLL*
Ga0182115_10082332	3300015348	Switchgrass Phyllosphere	LRCAIEYNTLTVNYNVKQNQLTKLTSEPRARNPKESNEAFDYAIRELLL*
Ga0182115_10085541	3300015348	Switchgrass Phyllosphere	MNSDILTVNYDIKQRQFTKPTPEPRASDVEESNKAFDRAIRG*
Ga0182115_11661002	3300015348	Switchgrass Phyllosphere	INSDILTANYSVKQSQFIKPIPEPRASDAEESNKTFDRAIRG*
Ga0182115_11741051	3300015348	Switchgrass Phyllosphere	LVCVVLINSNTLTANYGVKQIQFTKLTSEPRASDPEESNE
Ga0182115_11853651	3300015348	Switchgrass Phyllosphere	SCSAYVVPMNSDILTANYGIKQSQFTKLTSKPPDPEESNEVFDHAIR*
Ga0182115_12202482	3300015348	Switchgrass Phyllosphere	VCFRSAFTVYYGVKQSQFTKSTPEPRASDSEESNEVFDRAIRGWLL*
Ga0182115_12312121	3300015348	Switchgrass Phyllosphere	VKQSQITKPTSEPRASDSEESNETFERTVRGWLV*
Ga0182115_12401291	3300015348	Switchgrass Phyllosphere	VLKNSNILNANYDVNQSQFTKPTSEPYDYKESNEAFDRTIKKWYCS
Ga0182115_12710981	3300015348	Switchgrass Phyllosphere	MNSDILTAYYGVKQSQFTKPTPEPRASDSEESNNAFDRVIRGWL
Ga0182185_10417262	3300015349	Switchgrass Phyllosphere	VKQSQFTKPTSEPRVSDPEESNEAFDRAIREWLL*
Ga0182185_10645281	3300015349	Switchgrass Phyllosphere	TTLIANYGVKQSQFTKPTSELRVSDLEESNEAFDCAIRGWLL*
Ga0182185_10985101	3300015349	Switchgrass Phyllosphere	NYSVKQSQFTKPTSEPRASDPEESNEAFDRAIREWLL*
Ga0182185_11623621	3300015349	Switchgrass Phyllosphere	TLIINYGVKQSQFTKSTLEPRASDPEESNEIFDCAIRGWLL*
Ga0182185_12471652	3300015349	Switchgrass Phyllosphere	TANYSVKQRQFTKPTSEPHASNPEESNEVFDRAIR*
Ga0182185_12522031	3300015349	Switchgrass Phyllosphere	MNSDILTDNYGVKQNQFTKSTSEPRVSDSKKSNEVFNHAIR*
Ga0182185_12634411	3300015349	Switchgrass Phyllosphere	ANYGVKQSQFTKLTSGPRANDPEESNETFGRVIRGWLL*
Ga0182169_10708081	3300015352	Switchgrass Phyllosphere	VNNDNFTVNYGVKQSKFIKPTSEPRASDPEESNEAFD
Ga0182169_11181241	3300015352	Switchgrass Phyllosphere	ANYGVKQSQFTKPTLEPRASDHKESNEAVDRTIRGWLL*
Ga0182169_11228572	3300015352	Switchgrass Phyllosphere	MLVNSDILTANYCIKQSQFTKPTSEPRASDSEKFNE
Ga0182169_12429531	3300015352	Switchgrass Phyllosphere	NYDIKQSQFTKPTSEPRASDLEESNETFDRAIREWLL*
Ga0182169_12462491	3300015352	Switchgrass Phyllosphere	PVWFCSALVNSDTLTVYYGVKQSQFTKPTPEPRASDPEEFNEVFDRAIRG*
Ga0182169_13020281	3300015352	Switchgrass Phyllosphere	YGVKQNQFTKPTSEPRASDLEESNEAFDRAIRRWLL*
Ga0182169_13085352	3300015352	Switchgrass Phyllosphere	LLVNSDNLIVNYGVKQSQFTKPTSEPRASDSEESNEAFDHTIGRLL
Ga0182179_10207802	3300015353	Switchgrass Phyllosphere	VLMNSDILTANNCVKQSQFTKPTSEPRASDPEESNEVFDRAIRG*
Ga0182179_12119611	3300015353	Switchgrass Phyllosphere	NYGVKQSQFTKPTSEPRASDLEESNETFNRAIRG*
Ga0182167_10208651	3300015354	Switchgrass Phyllosphere	ILIANYGVKQSQFTKPTSEPRASDPEESNDAFDRAIRR*
Ga0182167_10430762	3300015354	Switchgrass Phyllosphere	MLVNNDIFTVNYGVKQSQFTEPTSEPRASDPEESNEPFDRTIRG*
Ga0182167_11283401	3300015354	Switchgrass Phyllosphere	TTNYGVKQSQFTKSTLEPRASDAEEFNKAFDRVIRG*
Ga0182167_11381382	3300015354	Switchgrass Phyllosphere	LTANYSVKQSQFIKPTPEPRASDAEESNKTFDRAIRG*
Ga0182167_12113011	3300015354	Switchgrass Phyllosphere	VNSDIWTANYGVKQIQFTKPTSEPRASDPEEFNETFDCAIRGW
Ga0182167_12264621	3300015354	Switchgrass Phyllosphere	VLCQSVLVNSNILTLNYGIKQSQFTKLTSEPHISDPEESDEAFDRAIRGG*
Ga0182167_12368931	3300015354	Switchgrass Phyllosphere	MNSDILTVNYGVKQNQFKKPNLEPRASDLEESNTAFDRAIRGWLL*
Ga0182167_12386861	3300015354	Switchgrass Phyllosphere	NTLTVNYGVKQSQFTKPISKSRARNPKDSNEIFDHVI*
Ga0182167_12435272	3300015354	Switchgrass Phyllosphere	DSLTINYGIKQNQFTKPTSKPRASDPEESNVAFDRAIRRWLL*
Ga0182167_12760491	3300015354	Switchgrass Phyllosphere	QLVNSDTLTTNYGVKQSQFTKPISEPRASDSEESNKAFDRAIREWLL*
Ga0182199_11410791	3300017412	Switchgrass Phyllosphere	MNSDILTVNYGVKQSQFTKPTPEPRASDAEESNKIFDRVIR
Ga0182199_11962611	3300017412	Switchgrass Phyllosphere	LTANCGTKQSRFTKSISEPRASNPEESNEIFDRAIRG
Ga0182195_10453761	3300017414	Switchgrass Phyllosphere	VNSDTLTVYYGVKQNQFTKLTPEPRASDLEESNEAFDRAIKGW
Ga0182195_10465801	3300017414	Switchgrass Phyllosphere	SDILTANYGVKQSQFIKQTSEPRTSDPEESNETVDYGSRE
Ga0182195_10626342	3300017414	Switchgrass Phyllosphere	VNSNILTINYGIKQSQFTKLTSEPHASDPEESNEAFDRAIREG
Ga0182195_10829251	3300017414	Switchgrass Phyllosphere	ANYGVKQNQFTKPTSEPRASDPEEFNETFDRAIRGWLL
Ga0182195_11070382	3300017414	Switchgrass Phyllosphere	SMLVNSDSLTVNYGVKQNQFIKPTSEPPASDSEESNETFNCAIRG
Ga0182195_11936062	3300017414	Switchgrass Phyllosphere	MLRIVTTLTINYGVKQSQFIKTTSEPRASDPKESNETFDRAI
Ga0182213_12245201	3300017421	Switchgrass Phyllosphere	MGYGLTANYDIKQTRFTKPTLEPRARNPKNFNEAF
Ga0182196_11566551	3300017432	Switchgrass Phyllosphere	MALTANYSIQQSQFIKSTLEPRASNPQESNKIFDRAIRGWLL
Ga0182200_10752383	3300017439	Switchgrass Phyllosphere	APSLNSDILTATYGVKQSQFTKPTSEPRTSDPEESNEAFDRMIREWLL
Ga0182200_11059031	3300017439	Switchgrass Phyllosphere	MNSDILTINYDIKQKQFTKPTPEPRASDPEESNEAFDRAIRGWLL
Ga0182198_10903632	3300017445	Switchgrass Phyllosphere	ILTINYGIKQSQFTKLTSEPHASDPEESNEAFDRAIRGG
Ga0182198_11368151	3300017445	Switchgrass Phyllosphere	MNSDILVKQDQFTKPTPESRANDFEESNKAFDRAIRD
Ga0182198_11464181	3300017445	Switchgrass Phyllosphere	VNSDILTVNYGVKQNQLTKLTLEPRASDPEESNKVFD
Ga0182198_11753032	3300017445	Switchgrass Phyllosphere	MLVNSDSLTANYGVKQSQFTKLTSEPRANDPEESNETFGRAIR
Ga0182198_11982721	3300017445	Switchgrass Phyllosphere	MNSNILIANYGVKQSQITKPTSEPRASDSEESQEAFDHAIRV
Ga0182178_10033062	3300020023	Switchgrass Phyllosphere	NYGVKQSQFTKPTSEPRASNPEESNKAFDRAIRGWLL
Ga0182146_1069781	3300020033	Switchgrass Phyllosphere	VNSDSLIANYGVKQSQFTKPTSNSRASDPEESNEAFDRAIREW
Ga0207869_10267531	3300025517	Ionic Liquid And High Solid Enriched	YGVKQSQFTKSTSEPRASDPEESNEAFDRAIRGWLL
Ga0207641_122128591	3300026088	Switchgrass Rhizosphere	VLVNSDSLTANYGVKQNQFTKPTLKPRASDPKESNEDFDRAIREWLL
Ga0207641_124035911	3300026088	Switchgrass Rhizosphere	MLINSDILTANYGIKQSQFTKPTPEPRANDAEESNKAFDRTIRG
Ga0268322_10528511	3300028049	Phyllosphere	VLVNSDSLTANYGIKQSQFTKLTLEPRASDPKESNEA
Ga0268330_10243871	3300028056	Phyllosphere	MLMHSDILTANYGVKQSQFIKQTSEPRTSDPEESNETVD
Ga0268320_10100521	3300028153	Phyllosphere	FYGVKQSQFTKPTSEPGASDYKESNEAFDRAIRGWLL
Ga0268307_10027051	3300028470	Phyllosphere	LTANYGVKQSQFTKPTSEPRARNPEDSNEFFDSAIWG
Ga0268307_10188011	3300028470	Phyllosphere	MNSDILTDNYGVKQNQFTKSTSEPRASDPEESNEVFDCAIREWLL
Ga0268315_10127411	3300028472	Phyllosphere	ILTANYGIKQSQFTKSTPEPRASDPEEFNKIFDRAIR
Ga0268315_10271681	3300028472	Phyllosphere	MHTSRKILTVNYGVKQSQFTKPTSEPYASDYKESNEAFDRAIR
Ga0268329_10040761	3300028476	Phyllosphere	VLVNSDSLTTNYDVKQSQFTKPTSEPRASDPEESNGDFDYAIR
Ga0268309_10105551	3300028477	Phyllosphere	LTANYGVKQSQFTKPTSEPRASDPEESNEAFDRTIRGWL
Ga0214493_11122121	3300032465	Switchgrass Phyllosphere	MNSDILIANYGVKQSQFIKPTLEPPYRTGDSEEPNKIFNH
Ga0214503_12041871	3300032466	Switchgrass Phyllosphere	MFSVLFVRAMLVNNNILIANYGVKQNQFTKLTSEPRASDLEECNEVFDRAIRG
Ga0214488_10452762	3300032467	Switchgrass Phyllosphere	MLVNSDILTANYGVKQNQFTKPTSEPRASDPEEYNEAFDRVIRE
Ga0214488_10680892	3300032467	Switchgrass Phyllosphere	VLVNSETLTTNYGVKQSQFTKPTLEPHASDLEESNKTFDRAI
Ga0214482_10199272	3300032468	Switchgrass Phyllosphere	LVWFCSALVNSDTLTTYYGVKQSQFTKPTPESRASDPEESNEAFDRAIGGWLL
Ga0214491_11612442	3300032469	Switchgrass Phyllosphere	MNSDILTANYGIKQSQFTKPTPEPRASDLEESNKAFDRAIRGWLL
Ga0214490_11462081	3300032502	Switchgrass Phyllosphere	DILIANYGVKQSQFIKQTSEPRASDPEESNKTVDCGIRE
Ga0214483_10366622	3300032548	Switchgrass Phyllosphere	MLVNRDILIANYGVKQSQFTKPTSEPRASDPEEFNEAFDRAIRG
Ga0321339_10579581	3300032551	Switchgrass Phyllosphere	ILTVNYGVKQSKFTKPTPESRASDASDPEESNKAFDPAIRGWLL
Ga0321339_10704601	3300032551	Switchgrass Phyllosphere	VNSDTLTTYYGVKQSQFTKPTPESRASDPEESNEAFDRAIGEWLL
Ga0321339_11030711	3300032551	Switchgrass Phyllosphere	VNSDTLTTYYGVKQNQFKKPTPEPRASDPEESNEAFDRAIGEWLL
Ga0214484_10776981	3300032591	Switchgrass Phyllosphere	VNSDTLTAYYSVKQTQFTKPTPEPRASDPEESNETFDRAIGGWLL
Ga0214504_10640131	3300032592	Switchgrass Phyllosphere	VNSDTLTAYYGVKQSQFTKPTPESRASDPEESNEAFDRAIGEWLL
Ga0214499_10773812	3300032697	Switchgrass Phyllosphere	MNSDTLTAYYGVKQSQFTKPTPKPRASDPEESNEAFDRAIGEWLL
Ga0314746_10075612	3300032758	Switchgrass Phyllosphere	MNSDILTANYGIKQSQFTKTTPEPRASDLEESNKAFDRAIRG
Ga0314725_10395451	3300032789	Switchgrass Phyllosphere	MNSDIFTANYGVKQSQFTKPTPEPRASDASDPEESNEPFDPASRGWLL
Ga0314744_10036782	3300032792	Switchgrass Phyllosphere	MLVWFWSALVNSDTLTAYYGVKQSQFIKPTPEPRASDPEESNEAFDRAIGGWLL
Ga0314745_10278142	3300032812	Switchgrass Phyllosphere	VPVNSDSLTVNYGVKQNQFTKPTSEPRTSDPEESNEAFDRAIRERLL
Ga0314745_11293212	3300032812	Switchgrass Phyllosphere	RVNSDILTANYSIKQSQFTKLISEPRARNPEKSNEAFDRAIRE
Ga0314740_10291172	3300032822	Switchgrass Phyllosphere	MNSDTLTAYYGVKQSQFTKPTPEPRASDPEESNEAFDRAIGGLLL
Ga0314723_11069441	3300032823	Switchgrass Phyllosphere	LVNSDTLTAYYGVKQNQFTKPTPEPRASDPEESNEAFDRAIGEWLL
Ga0314743_11363692	3300032844	Switchgrass Phyllosphere	MNSDILTANYGVKQSQFTKPTPEPRANDLEESNKVFDCAIRGCL
Ga0314750_11191982	3300032914	Switchgrass Phyllosphere	VYYGVKQNQFTKLTPEPRASDLKEFNEAFDRAIKGWLL
Ga0314750_11663182	3300032914	Switchgrass Phyllosphere	VNSDTLTAYYSVKQTQFTKPTPEPRASDPEESNEAFDRAIGGLLL
Ga0314741_10120752	3300032934	Switchgrass Phyllosphere	MSNEPPSSNVSDFVWFCSALVNSDTLTAYYGVKQSQFTKPTPEPRASDPEESNEAFDRAIGGLLL
Ga0314722_10188762	3300032966	Switchgrass Phyllosphere	MNSDTLTAYYGVKQSQFTKPTPKPRASDPEESNETFDRAIGGWLL
Ga0314761_10333141	3300033526	Switchgrass Phyllosphere	YGVKQSHFIKPTPEPCANDLEESNKASNRAIRGWLL
Ga0314767_11280982	3300033532	Switchgrass Phyllosphere	MNSDILTANYGVKQRQFTNQLQNSRASDPEESNEDFDCAIRGWLLYH
Ga0314759_10389021	3300033535	Switchgrass Phyllosphere	MRARILALVNSATLTANYGVKQSQFTKPTSKSCARNPEDSNEAFDRVIXG
Ga0314759_12221811	3300033535	Switchgrass Phyllosphere	VIMNSDILTANYGIKQSQFTKPTPEPRASDLEESNKAFDRAIRG

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F038940

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences