| Basic Information | |
|---|---|
| Family ID | F037758 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 167 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MASTPTQDLQNEVLNTVRKSQETVIDALKTWVETVQSITPKVP |
| Number of Associated Samples | 149 |
| Number of Associated Scaffolds | 167 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.60 % |
| % of genes from short scaffolds (< 2000 bps) | 95.81 % |
| Associated GOLD sequencing projects | 145 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (71.856 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (17.365 % of family members) |
| Environment Ontology (ENVO) | Unclassified (13.772 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.695 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.89% β-sheet: 0.00% Coil/Unstructured: 52.11% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 167 Family Scaffolds |
|---|---|---|
| PF02803 | Thiolase_C | 27.54 |
| PF01471 | PG_binding_1 | 4.19 |
| PF03734 | YkuD | 3.59 |
| PF01654 | Cyt_bd_oxida_I | 1.20 |
| PF00430 | ATP-synt_B | 0.60 |
| PF01381 | HTH_3 | 0.60 |
| PF07167 | PhaC_N | 0.60 |
| PF01184 | Gpr1_Fun34_YaaH | 0.60 |
| PF13561 | adh_short_C2 | 0.60 |
| PF00749 | tRNA-synt_1c | 0.60 |
| PF00108 | Thiolase_N | 0.60 |
| PF03952 | Enolase_N | 0.60 |
| PF13185 | GAF_2 | 0.60 |
| PF04542 | Sigma70_r2 | 0.60 |
| COG ID | Name | Functional Category | % Frequency in 167 Family Scaffolds |
|---|---|---|---|
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 28.14 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 3.59 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 3.59 |
| COG1271 | Cytochrome bd-type quinol oxidase, subunit 1 | Energy production and conversion [C] | 1.20 |
| COG0008 | Glutamyl- or glutaminyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.60 |
| COG0148 | Enolase | Carbohydrate transport and metabolism [G] | 0.60 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.60 |
| COG0711 | FoF1-type ATP synthase, membrane subunit b or b' | Energy production and conversion [C] | 0.60 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.60 |
| COG1584 | Succinate-acetate transporter SatP | Energy production and conversion [C] | 0.60 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.60 |
| COG3243 | Poly-beta-hydroxybutyrate synthase | Lipid transport and metabolism [I] | 0.60 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.60 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 71.86 % |
| Unclassified | root | N/A | 28.14 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003219|JGI26341J46601_10181972 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300003219|JGI26341J46601_10199043 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300003296|Ga0006840J48914_100093 | All Organisms → cellular organisms → Bacteria | 1221 | Open in IMG/M |
| 3300003298|Ga0006841J48915_102025 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10396506 | Not Available | 560 | Open in IMG/M |
| 3300004080|Ga0062385_10288767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 934 | Open in IMG/M |
| 3300004100|Ga0058904_1388041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → unclassified Mycobacterium → Mycobacterium sp. 155 | 521 | Open in IMG/M |
| 3300004468|Ga0068977_1064275 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300004470|Ga0068967_1031873 | All Organisms → cellular organisms → Bacteria | 1578 | Open in IMG/M |
| 3300004470|Ga0068967_1041006 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
| 3300004471|Ga0068965_1058267 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300004602|Ga0068960_1235167 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300004801|Ga0058860_12233643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → unclassified Mycobacterium → Mycobacterium sp. 155 | 539 | Open in IMG/M |
| 3300005167|Ga0066672_10553996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → unclassified Mycobacterium → Mycobacterium sp. | 745 | Open in IMG/M |
| 3300005332|Ga0066388_107827096 | Not Available | 535 | Open in IMG/M |
| 3300005332|Ga0066388_108600210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → unclassified Mycobacterium → Mycobacterium sp. 155 | 508 | Open in IMG/M |
| 3300005338|Ga0068868_101420927 | Not Available | 647 | Open in IMG/M |
| 3300005363|Ga0008090_10163952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 621 | Open in IMG/M |
| 3300005435|Ga0070714_102158177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → unclassified Mycobacterium → Mycobacterium sp. 155 | 542 | Open in IMG/M |
| 3300005441|Ga0070700_100836684 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300005445|Ga0070708_101017876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → unclassified Mycobacterium → Mycobacterium sp. 155 | 777 | Open in IMG/M |
| 3300005467|Ga0070706_100480114 | All Organisms → cellular organisms → Bacteria | 1156 | Open in IMG/M |
| 3300005518|Ga0070699_101166542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 707 | Open in IMG/M |
| 3300005531|Ga0070738_10051724 | All Organisms → cellular organisms → Bacteria | 2561 | Open in IMG/M |
| 3300005534|Ga0070735_10566808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 675 | Open in IMG/M |
| 3300005640|Ga0075035_1609895 | All Organisms → cellular organisms → Bacteria | 1527 | Open in IMG/M |
| 3300006052|Ga0075029_100392531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → unclassified Mycobacterium → Mycobacterium sp. | 901 | Open in IMG/M |
| 3300006354|Ga0075021_10614261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 695 | Open in IMG/M |
| 3300006806|Ga0079220_11984798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 518 | Open in IMG/M |
| 3300006954|Ga0079219_11667388 | Not Available | 588 | Open in IMG/M |
| 3300009036|Ga0105244_10559984 | Not Available | 526 | Open in IMG/M |
| 3300009090|Ga0099827_11606415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 566 | Open in IMG/M |
| 3300009174|Ga0105241_10783596 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300009249|Ga0103862_1070209 | Not Available | 512 | Open in IMG/M |
| 3300009551|Ga0105238_10453568 | Not Available | 1279 | Open in IMG/M |
| 3300010090|Ga0127471_1069432 | Not Available | 567 | Open in IMG/M |
| 3300010091|Ga0127485_1100371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 614 | Open in IMG/M |
| 3300010100|Ga0127440_1034093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 530 | Open in IMG/M |
| 3300010110|Ga0126316_1086609 | Not Available | 631 | Open in IMG/M |
| 3300010112|Ga0127458_1075776 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 570 | Open in IMG/M |
| 3300010118|Ga0127465_1157178 | Not Available | 520 | Open in IMG/M |
| 3300010124|Ga0127498_1102376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 591 | Open in IMG/M |
| 3300010139|Ga0127464_1062280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 531 | Open in IMG/M |
| 3300010139|Ga0127464_1178725 | Not Available | 685 | Open in IMG/M |
| 3300010164|Ga0063827_188493 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300010325|Ga0134064_10388670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 554 | Open in IMG/M |
| 3300010379|Ga0136449_101455637 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
| 3300010379|Ga0136449_101779265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. CNU-125 | 923 | Open in IMG/M |
| 3300010860|Ga0126351_1298897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1522 | Open in IMG/M |
| 3300010865|Ga0126346_1333907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 508 | Open in IMG/M |
| 3300010876|Ga0126361_10059945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. CNU-125 | 718 | Open in IMG/M |
| 3300010880|Ga0126350_10521274 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300011016|Ga0138589_109885 | Not Available | 537 | Open in IMG/M |
| 3300011029|Ga0138551_113794 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300011069|Ga0138592_1079226 | Not Available | 586 | Open in IMG/M |
| 3300011073|Ga0138584_1101194 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300011073|Ga0138584_1117186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. CNU-125 | 1133 | Open in IMG/M |
| 3300011120|Ga0150983_15530265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 516 | Open in IMG/M |
| 3300012373|Ga0134042_1231735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 516 | Open in IMG/M |
| 3300012379|Ga0134058_1227806 | Not Available | 542 | Open in IMG/M |
| 3300012381|Ga0134026_1270200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 573 | Open in IMG/M |
| 3300012393|Ga0134052_1252136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 502 | Open in IMG/M |
| 3300012469|Ga0150984_107979436 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1119 | Open in IMG/M |
| 3300012477|Ga0157336_1017406 | Not Available | 619 | Open in IMG/M |
| 3300012481|Ga0157320_1010870 | Not Available | 709 | Open in IMG/M |
| 3300012483|Ga0157337_1006477 | Not Available | 810 | Open in IMG/M |
| 3300012986|Ga0164304_11478065 | Not Available | 561 | Open in IMG/M |
| 3300013297|Ga0157378_11009968 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300013297|Ga0157378_12061396 | Not Available | 621 | Open in IMG/M |
| 3300014838|Ga0182030_10921865 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300015357|Ga0134072_10274650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 617 | Open in IMG/M |
| 3300016341|Ga0182035_10484826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1054 | Open in IMG/M |
| 3300017821|Ga0187812_1194414 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300017973|Ga0187780_11188294 | Not Available | 559 | Open in IMG/M |
| 3300017973|Ga0187780_11427981 | Not Available | 510 | Open in IMG/M |
| 3300018001|Ga0187815_10121160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1105 | Open in IMG/M |
| 3300018042|Ga0187871_10483583 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300018062|Ga0187784_10179944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1728 | Open in IMG/M |
| 3300020199|Ga0179592_10238169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 819 | Open in IMG/M |
| 3300020582|Ga0210395_10291781 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
| 3300020582|Ga0210395_11014646 | Not Available | 614 | Open in IMG/M |
| 3300021377|Ga0213874_10267609 | Not Available | 635 | Open in IMG/M |
| 3300021402|Ga0210385_11280718 | Not Available | 562 | Open in IMG/M |
| 3300021404|Ga0210389_10907658 | Not Available | 685 | Open in IMG/M |
| 3300021445|Ga0182009_10588174 | Not Available | 595 | Open in IMG/M |
| 3300021478|Ga0210402_10343201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 1385 | Open in IMG/M |
| 3300021858|Ga0213852_1136893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 557 | Open in IMG/M |
| 3300021858|Ga0213852_1549084 | Not Available | 716 | Open in IMG/M |
| 3300022500|Ga0242643_124890 | Not Available | 503 | Open in IMG/M |
| 3300022507|Ga0222729_1050165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 576 | Open in IMG/M |
| 3300022530|Ga0242658_1224169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 521 | Open in IMG/M |
| 3300022557|Ga0212123_10866481 | Not Available | 535 | Open in IMG/M |
| 3300022713|Ga0242677_1071019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 547 | Open in IMG/M |
| 3300022717|Ga0242661_1121244 | Not Available | 564 | Open in IMG/M |
| 3300025509|Ga0208848_1072235 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 718 | Open in IMG/M |
| 3300025898|Ga0207692_10678452 | Not Available | 667 | Open in IMG/M |
| 3300025910|Ga0207684_11562355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 535 | Open in IMG/M |
| 3300025922|Ga0207646_10264564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1554 | Open in IMG/M |
| 3300026118|Ga0207675_102412878 | Not Available | 538 | Open in IMG/M |
| 3300026864|Ga0209621_1001545 | All Organisms → cellular organisms → Bacteria | 1247 | Open in IMG/M |
| 3300027050|Ga0209325_1004957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1379 | Open in IMG/M |
| 3300027604|Ga0208324_1036213 | Not Available | 1472 | Open in IMG/M |
| 3300027725|Ga0209178_1404980 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300027765|Ga0209073_10100145 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. CNU-125 | 1022 | Open in IMG/M |
| 3300027853|Ga0209274_10249764 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300028742|Ga0302220_10057935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. CNU-125 | 1604 | Open in IMG/M |
| 3300028742|Ga0302220_10332496 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300028768|Ga0307280_10310593 | Not Available | 576 | Open in IMG/M |
| 3300028773|Ga0302234_10370512 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300028801|Ga0302226_10033865 | All Organisms → cellular organisms → Bacteria | 2551 | Open in IMG/M |
| 3300028808|Ga0302228_10510483 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300029882|Ga0311368_11031906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 540 | Open in IMG/M |
| 3300029882|Ga0311368_11046898 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300029910|Ga0311369_11083906 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 627 | Open in IMG/M |
| 3300029943|Ga0311340_10778815 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300029951|Ga0311371_10740596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1225 | Open in IMG/M |
| 3300029999|Ga0311339_10946914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 812 | Open in IMG/M |
| 3300030007|Ga0311338_10760166 | Not Available | 971 | Open in IMG/M |
| 3300030007|Ga0311338_11394632 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300030056|Ga0302181_10106570 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1384 | Open in IMG/M |
| 3300030490|Ga0302184_10247718 | Not Available | 730 | Open in IMG/M |
| 3300030677|Ga0302317_10430324 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300030707|Ga0310038_10230372 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300030730|Ga0307482_1251695 | Not Available | 555 | Open in IMG/M |
| 3300030885|Ga0265743_115707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 564 | Open in IMG/M |
| 3300030906|Ga0302314_10070826 | All Organisms → cellular organisms → Bacteria | 4939 | Open in IMG/M |
| 3300031022|Ga0138301_1262974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 641 | Open in IMG/M |
| 3300031091|Ga0308201_10202519 | Not Available | 657 | Open in IMG/M |
| 3300031234|Ga0302325_12237621 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300031236|Ga0302324_100478666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1826 | Open in IMG/M |
| 3300031525|Ga0302326_10241480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2956 | Open in IMG/M |
| 3300031549|Ga0318571_10025069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 1604 | Open in IMG/M |
| 3300031572|Ga0318515_10618172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 575 | Open in IMG/M |
| 3300031590|Ga0307483_1032628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 552 | Open in IMG/M |
| 3300031640|Ga0318555_10491134 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 665 | Open in IMG/M |
| 3300031681|Ga0318572_10826965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 550 | Open in IMG/M |
| 3300031708|Ga0310686_102907559 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300031708|Ga0310686_116985680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 930 | Open in IMG/M |
| 3300031723|Ga0318493_10654433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 587 | Open in IMG/M |
| 3300031744|Ga0306918_10453045 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
| 3300031751|Ga0318494_10125682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1431 | Open in IMG/M |
| 3300031792|Ga0318529_10486043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 574 | Open in IMG/M |
| 3300031799|Ga0318565_10267835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 831 | Open in IMG/M |
| 3300031823|Ga0307478_11698747 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300031832|Ga0318499_10363832 | Not Available | 555 | Open in IMG/M |
| 3300031835|Ga0318517_10588310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 500 | Open in IMG/M |
| 3300031846|Ga0318512_10114059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1280 | Open in IMG/M |
| 3300031846|Ga0318512_10598829 | Not Available | 562 | Open in IMG/M |
| 3300031912|Ga0306921_10863086 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
| 3300031939|Ga0308174_11262345 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300032008|Ga0318562_10723068 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300032009|Ga0318563_10390248 | Not Available | 753 | Open in IMG/M |
| 3300032025|Ga0318507_10240284 | Not Available | 785 | Open in IMG/M |
| 3300032043|Ga0318556_10761874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 503 | Open in IMG/M |
| 3300032055|Ga0318575_10571175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 574 | Open in IMG/M |
| 3300032068|Ga0318553_10576772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 589 | Open in IMG/M |
| 3300032160|Ga0311301_11769069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. CNU-125 | 738 | Open in IMG/M |
| 3300032205|Ga0307472_102055193 | Not Available | 573 | Open in IMG/M |
| 3300032782|Ga0335082_10028482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5945 | Open in IMG/M |
| 3300032805|Ga0335078_12729133 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300034667|Ga0314792_109744 | Not Available | 697 | Open in IMG/M |
| 3300034667|Ga0314792_177431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 585 | Open in IMG/M |
| 3300034672|Ga0314797_106604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 581 | Open in IMG/M |
| 3300034672|Ga0314797_128871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 544 | Open in IMG/M |
| 3300034817|Ga0373948_0105479 | Not Available | 668 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.37% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 11.38% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 11.98% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 8.38% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.59% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.40% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.40% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 2.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.99% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.99% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.80% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.80% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.80% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 1.20% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.20% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.20% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.20% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.20% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.20% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.20% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.20% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.20% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.60% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.60% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 0.60% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.60% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.60% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.60% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.60% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.60% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.60% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.60% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.60% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.60% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.60% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.60% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
| 3300003296 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 41 (Metagenome Metatranscriptome, Counting Only) | Environmental | Open in IMG/M |
| 3300003298 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 42 (Metagenome Metatranscriptome, Counting Only) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004100 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF244 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004468 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 74 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004470 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 59 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004471 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 57 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004602 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 52 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005531 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005640 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_052 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009249 | Microbial communities of water from Amazon river, Brazil - RCM15 | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010090 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010091 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010100 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010110 | Soil microbial communities from Illinois, USA to study soil gas exchange rates - BV-IL-AGR metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010112 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010118 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010124 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010139 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010164 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 61 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010860 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010865 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011016 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 81 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011029 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 32 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011069 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 19 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011073 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 74 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012373 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012379 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012381 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012393 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021858 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022500 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022507 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022530 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022713 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025509 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026864 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027050 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028742 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028773 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300028801 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030677 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030885 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030906 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300031022 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031590 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| 3300034667 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034672 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI26341J46601_101819722 | 3300003219 | Bog Forest Soil | MASNPTQDLQDEFLSTIRKSQETVIDAIRSWVETVQSITPKIPSVQVPGA |
| JGI26341J46601_101990431 | 3300003219 | Bog Forest Soil | MASTPTQDLQDEFLSTIRKSQETVIDAIRSWVEAVQSVTPKIP |
| Ga0006840J48914_1000932 | 3300003296 | Peatlands Soil | MASTPTQDLQDEFLNTIRKSQETVIDAIKSWVETIQSVTPKIPSVQ |
| Ga0006841J48915_1020252 | 3300003298 | Peatlands Soil | MASTPTQDLQDEFLNTIRKSQETVIDAIKSWVETIQSVTPKIP |
| JGIcombinedJ51221_103965061 | 3300003505 | Forest Soil | MPSTQQEVQDEVLSTVRKSQETVIEAIKSWVEAVQSVTPKLPSMN |
| Ga0062385_102887672 | 3300004080 | Bog Forest Soil | MPSTQQEVQDEILNTVRKSQETVIETIKSWVETVQSVTPKLPS |
| Ga0058904_13880411 | 3300004100 | Forest Soil | MASTPTQDLQNEVLNTVRKSQETVIDAIKTWVETVQSITPKIPSVQVPG |
| Ga0068977_10642752 | 3300004468 | Peatlands Soil | MASTPTQDIQDEFLNTIRKSQETVIDAIKSWVESVQSITP |
| Ga0068967_10318731 | 3300004470 | Peatlands Soil | MASTPTQDIQDEFLNTIRKSQETVIDAIKSWVESVQSITPKIPS |
| Ga0068967_10410062 | 3300004470 | Peatlands Soil | MASTPTQDLQDEFLNTIRKSQETVIDAIKSWVETVQSVTPKIPSVQVPGA |
| Ga0068965_10473192 | 3300004471 | Peatlands Soil | MASNLPTQQLQDEFLSTIRKSQETVIDAIKTWVGTVQSVVPQMPSVPV |
| Ga0068965_10582671 | 3300004471 | Peatlands Soil | MASTPTQDIQDEFLNTIRKSQETVIDAIKSWVESVQSITPKIP |
| Ga0068960_12351672 | 3300004602 | Peatlands Soil | MTSYPTTQVQDEFLKAIRKSQETVLQAIRTWADTAQSMTPK |
| Ga0058860_122336431 | 3300004801 | Host-Associated | MASTPTQDLQNEVLITVRKSQESVIDALKTWVETVQSITPKIP |
| Ga0066672_105539961 | 3300005167 | Soil | MASTPTQDLQNEVLNTVRKSQETVIDAIKTWVETIQSITPKIPAVDLPFADKL |
| Ga0066388_1078270963 | 3300005332 | Tropical Forest Soil | MVSTTQEVQDEFLNTVRKSQETVIEAIKSWVDAVQSVTPKLPSVSVPLADKL |
| Ga0066388_1086002102 | 3300005332 | Tropical Forest Soil | MASTATQDLQDEVLTTVRKSQESVIDAIRTWVETVQSITPK |
| Ga0068868_1014209271 | 3300005338 | Miscanthus Rhizosphere | MASTPTQDLQNEVLNTVRKSQETVIDALKTWVETVQSITPK |
| Ga0008090_101639521 | 3300005363 | Tropical Rainforest Soil | MPSTPTQDLQNDILTTVRKSQESVIDAIKTWVETVQSITPKVPAMDMP |
| Ga0070714_1021581771 | 3300005435 | Agricultural Soil | MASTPTQGLQDEVLNTVRKSQEAVIDAIRTWSETVQSITPKLPSVPVPGADKL |
| Ga0070700_1008366841 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MASTPTQDLQNEVLITVRKSQESVIDALKTWVETVQSITP |
| Ga0070708_1010178762 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MASNPAQDLQDEFLSTVRKSQETVIDAIKTWVETVQSITPKVPSV |
| Ga0070706_1004801143 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MASTPTQDLQNEILNTVRKSQETVIDALKTWVETVQSITPK |
| Ga0070699_1011665422 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MASNPAQDLQDEFLSTVRKSQETVIDAIKTWVETVQSITP |
| Ga0070738_100517244 | 3300005531 | Surface Soil | MASYPAKELQDEFLSAIRKSQETVIEAVRTWAETVRSVTPKVPSVRVPLAER |
| Ga0070735_105668081 | 3300005534 | Surface Soil | MTTTAQDVQDEILNTVRKSQETVVEAIKSWVETVQSITPKLPSV |
| Ga0075035_16098951 | 3300005640 | Permafrost Soil | MAHNPTQQLQDEFLSTIRKSQETVIDAIRTWAETVQS |
| Ga0075029_1003925313 | 3300006052 | Watersheds | MANSPTQDLQEEFLSTIRKSQETVIDAIKTWVETVQSITPKIPSVQVPGADKLP |
| Ga0075021_106142611 | 3300006354 | Watersheds | MANSPTQDLQEEFLSTIRKSQETVIDAIKTWVETVQ |
| Ga0079220_119847982 | 3300006806 | Agricultural Soil | MASTPTQDLQNEVLSTVRKSQESVIDAIKTWVETVQS |
| Ga0079219_116673882 | 3300006954 | Agricultural Soil | MASTPTQDLQNEVLSTVRKSQETVIDALKTWVETV |
| Ga0105244_105599842 | 3300009036 | Miscanthus Rhizosphere | MASTPTQDLQNEVLITVRKSQESVIDALKTWVETVQSIT |
| Ga0099827_116064152 | 3300009090 | Vadose Zone Soil | MANNPTQDLQDQFLNTIRKGQESVVDAIKTWVETVQ |
| Ga0105241_107835961 | 3300009174 | Corn Rhizosphere | MASTTTTQGLQDEVLNTVRRGQEAVIDALRTWSETVQSITPKLPV |
| Ga0103862_10702092 | 3300009249 | River Water | MADNPTQDLQKEVLDAVRKSQETVIDAIKSWAETLQSITPK |
| Ga0105238_104535683 | 3300009551 | Corn Rhizosphere | MASTPTQDLQNEVLITVRKSQESVIDALKTWVETV |
| Ga0127471_10694322 | 3300010090 | Grasslands Soil | MASTPTQDLQNEVLNTVRKSQETVIDALKTWVETVQSITPKVPAVDMPFADKLP |
| Ga0127485_11003713 | 3300010091 | Grasslands Soil | MASNPTQDLQNEVLTTVRKSQEAVIDAIKTWVETVQSITPKVPA |
| Ga0127440_10340931 | 3300010100 | Grasslands Soil | MASTPTQDLQNEVLTTVRKSQESVIDAIKTWVETVQSI |
| Ga0126316_10866093 | 3300010110 | Soil | MASTPTQDLQNEVLNTVRKSQESVIDALKTWVETVQSITPKIPA |
| Ga0127458_10757762 | 3300010112 | Grasslands Soil | MASNPTQDLQNEILNTVRKSQESVIDAIKTWVETVQSI |
| Ga0127465_11571782 | 3300010118 | Grasslands Soil | MASTPTQDLQNEVLITVRKSQESVIDALKTWVETVQSITPKVP |
| Ga0127498_11023762 | 3300010124 | Grasslands Soil | MASTPTQDLQNEVLITVRKSQESVIDALKTWVETVQSITPKVPAVDMPFA |
| Ga0127464_10622801 | 3300010139 | Grasslands Soil | MANNPTQDLQNEVLNTVRKSQETVIDAIRTMVDTVQTITPK |
| Ga0127464_11787251 | 3300010139 | Grasslands Soil | MASTPTQDLQNEVLITVRKSQESVIDALKTWVETVQSITPKVPAVDMPFADK |
| Ga0063827_1884932 | 3300010164 | Peatlands Soil | MASTPTQDIQDEFLNTIRKSQETVIDAIKSWVESVQSITPKIPSVQVPG |
| Ga0134064_103886702 | 3300010325 | Grasslands Soil | MATTPTQDLQNEVLNTVRKSQETVIDALKTWVETV |
| Ga0136449_1014556371 | 3300010379 | Peatlands Soil | MASSPTQDIQDEFLNTIRKSQETVIDAIKSWVESVQSITPKIPS |
| Ga0136449_1017792651 | 3300010379 | Peatlands Soil | MASTPTQDLQDEFLNTIRKSQETVIDAIKSWVETVQSVTPKIPSVQ |
| Ga0126351_12988973 | 3300010860 | Boreal Forest Soil | MASTPTQGLQDELLNTVRKSQETVIDALKTWAETVQSITPKLPSVPVPG |
| Ga0126346_13339072 | 3300010865 | Boreal Forest Soil | MASTPTQDLQNEVLNTVRKSQESVIDAIKTWVETVQSLTPKVPAVDMPFA |
| Ga0126361_100599451 | 3300010876 | Boreal Forest Soil | MASNPTQELQEEFLSTIRKSQDTVLDAVKTWAETVQSFVPQ |
| Ga0126350_105212742 | 3300010880 | Boreal Forest Soil | MPSTPQEVQDEILSTVRKSQETVVEAIKAWVETVQSVTPKLPS |
| Ga0138589_1098852 | 3300011016 | Peatlands Soil | MASTPTQDIQDEFLNTIRKSQETVIDAIKSWVESVQSITPKIPSVQVPGAEKLPKPLDVV |
| Ga0138551_1137941 | 3300011029 | Peatlands Soil | MASTPTQDLQDEFLNTIRKSQETVIDAIKSWVETIQS |
| Ga0138592_10792262 | 3300011069 | Peatlands Soil | MASTPTQELQDEFLSTIRKSHETVIDAIRSWVETVQSITPKIPAVQV |
| Ga0138584_11011941 | 3300011073 | Peatlands Soil | MASTPTQDLQDEFLSTIRKSQETVIDAIRSWVETVQSVTPKI |
| Ga0138584_11171861 | 3300011073 | Peatlands Soil | MASNLPTQQLQDEFLSTIRKSQETVIDAIKTWVGTVQSVVPQMPSVPVP |
| Ga0150983_155302652 | 3300011120 | Forest Soil | MASTPTQDLQDEFLNTVRKSQDTVIDAIKSWVDTVQSISPKIPS |
| Ga0134042_12317351 | 3300012373 | Grasslands Soil | MANTPTQDLQNEVLNTVRKSQESVIDAIKTWVETVQSITPKVPAVD |
| Ga0134058_12278062 | 3300012379 | Grasslands Soil | MASTPTQDLQNEVLNTVRKSQETVIDALKTWVETVQSIT |
| Ga0134026_12702002 | 3300012381 | Grasslands Soil | MANTPTQDLQNEVLNTVRKSQESVIDAIKTWVETVQSITPKVPAVDMPFADKLP |
| Ga0134052_12521361 | 3300012393 | Grasslands Soil | MASIPTQDLQNEVLTTVRKSQESVIDAIKTWVETVQSITPKVP |
| Ga0150984_1079794363 | 3300012469 | Avena Fatua Rhizosphere | MASTNTPVQGMQDELLNAVRKSQETVIDAIRTWSETIQSITPKLPSVPGA |
| Ga0157336_10174061 | 3300012477 | Arabidopsis Rhizosphere | MASTPTQDLQNEVLITVRKSQESVIEAIKTWVETIQSITPKVPAV |
| Ga0157320_10108703 | 3300012481 | Arabidopsis Rhizosphere | MASTPTQDLQNEVLITVRKSQESVIEAIKTWVETIQSITPKVPAVDMPLAD |
| Ga0157337_10064773 | 3300012483 | Arabidopsis Rhizosphere | MASTPTQDLQNEVLIAVRKSQESVIDALKTWVETIQSITPKVPVV |
| Ga0164304_114780652 | 3300012986 | Soil | MASTPTQDLQNEVLNTVRKSQETVIDALKTWVETVQSITPKVPA |
| Ga0157378_110099681 | 3300013297 | Miscanthus Rhizosphere | MASTPTQDLQNEVLITVRKSQESVIDALKTWVETVQ |
| Ga0157378_120613963 | 3300013297 | Miscanthus Rhizosphere | MASTPTQDLQNEVLNTVRKSQETVIDALKTWVETVQSITPKVP |
| Ga0182030_109218652 | 3300014838 | Bog | MASNPTQDLQNEFLSTIRKSQETVIDAIRTWAETVQ |
| Ga0134072_102746501 | 3300015357 | Grasslands Soil | MASTPTQDLQNEVLTTVRKSQESVIDALKTWVETVQSITPK |
| Ga0182035_104848261 | 3300016341 | Soil | MVSTTQEVQDEILNTVRKSQETVIEAVKAWVEAIQSVTPKLPSVSLPLA |
| Ga0187812_11944142 | 3300017821 | Freshwater Sediment | MASYPTKEIQDEFLNAIRKSQETVIEAVRTWVDTVQ |
| Ga0187780_111882942 | 3300017973 | Tropical Peatland | MVSTPQEVQDEFLNTIRKSQETVIEAIKSWVETVQSITPKLPSVSVPLADRLPK |
| Ga0187780_114279811 | 3300017973 | Tropical Peatland | MPSTPQEVQEEILNTIRKSQETVVEAIKSWVETVQS |
| Ga0187815_101211601 | 3300018001 | Freshwater Sediment | MVSTPQQVQDEFLNTIRKSQETVIEAIKSWVEAVQSITPKLPSMNVPLADK |
| Ga0187871_104835832 | 3300018042 | Peatland | MASNPTQELSEEFLSTLRKSQDTVLDAIKTWADAVQS |
| Ga0187784_101799443 | 3300018062 | Tropical Peatland | MASNPAQDLQEEFLKTIRKSQETVVEAIKTWVETVQS |
| Ga0179592_102381693 | 3300020199 | Vadose Zone Soil | MASNPTQDLQNEVLNTVRKSQESVIDAIKTWVETVQSITPKVPAVDLP |
| Ga0210395_102917812 | 3300020582 | Soil | MPNTPQQLQDELINTVRKSQETVLDAIKSWVETVQSITPKMPSVQVPFSDKL |
| Ga0210395_110146462 | 3300020582 | Soil | MASTPTQDLQNEVLNTVRKSQETVIDALKTWVETVQSITPKIPAVDLPFADKLP |
| Ga0213874_102676092 | 3300021377 | Plant Roots | MTSNPAQDMQQEFLNNIRRSQEAVIDALKTWVEGVQSMTPKVPAVQVPGVENLPR |
| Ga0210385_112807182 | 3300021402 | Soil | MASTPTQDLQNEVLNTVRKSQETVIDAIKTWVETVQSITPKIPAVDMPFA |
| Ga0210389_109076581 | 3300021404 | Soil | MASTPTQDLQNEVLITVRKSQESVIDALKTWVETVQSITPKVPAVDMPFAD |
| Ga0182009_105881741 | 3300021445 | Soil | MASTPTQDLQNEVLNTVRKSQETVIDALKTWVETVQSITPKV |
| Ga0210402_103432011 | 3300021478 | Soil | MASTPTQDLQDEFLSTVRKSQETVIDAIKTWVETVQSI |
| Ga0213852_11368932 | 3300021858 | Watersheds | MASTPTQDVQNEILSTVRKSQESVIDAIKTWVETVQSITPKV |
| Ga0213852_15490842 | 3300021858 | Watersheds | MASSPTQDIQDEFLNTIRKSQETVIDAIKSWVESVQSIT |
| Ga0242643_1248902 | 3300022500 | Soil | MANTPAQDVQNEVLNTVRKSQETVLDALRTWVETVQSLTPKVPSVEIPYSD |
| Ga0222729_10501651 | 3300022507 | Soil | MASTPTQDLQNEVLIAVRKSQESVIDALKTWVETVQSLTPKVP |
| Ga0242658_12241692 | 3300022530 | Soil | MASTPTQDVQNEILSTVRKSQESVIDAIKTWVETVQSITPKLPSVDVPFAGKLPK |
| Ga0212123_108664812 | 3300022557 | Iron-Sulfur Acid Spring | MPNTPQELQEEIINTVRKSQETVLDAIKSWVETVQSITPKM |
| Ga0242677_10710191 | 3300022713 | Soil | MASTPTQDVQNEILSTVRKSQESVIDAIKTWVETVQSITPK |
| Ga0242661_11212441 | 3300022717 | Soil | MASTPTQDLQNEVLNTVRKSQESVIDAIKTWVETVQSITPKVPAVDMPFADKLP |
| Ga0208848_10722351 | 3300025509 | Arctic Peat Soil | MASTPTQGLQDELLNAVRKSQETVIDALKTWAETVQSITPKLPSVPVPGADKLP |
| Ga0207692_106784521 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MANNPTQDLQNEVLNTVRKSQETVVDALKTWVETVQSMTPKVPAVDL |
| Ga0207684_115623551 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MASTPTQDLQNEVLNTVRKSQESVIDAIKTWVETVQSITPKIPAVDMPFADKLP |
| Ga0207646_102645643 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MASNPAQDLQDEFLSTVRKSQETVIDAIKTWVETVQSITPKVPSVQVPG |
| Ga0207675_1024128782 | 3300026118 | Switchgrass Rhizosphere | MASTPTQDLQNEVLITVRKSQESVIDALKTWVETVQSITPKIPAVDMP |
| Ga0209621_10015454 | 3300026864 | Forest Soil | MANTATQDLQNELLSTVRKGQESVIDAIRTWVETVQSIT |
| Ga0209325_10049571 | 3300027050 | Forest Soil | MANTATQDLQNELLSTVRKGQESVIDAIRTWVETVQSITPK |
| Ga0208324_10362131 | 3300027604 | Peatlands Soil | MASTPTQDLQDEFLNTIRKSQETVIDAIKSWVETIQSVTP |
| Ga0209178_14049801 | 3300027725 | Agricultural Soil | MASTTTTQGLQDEVLNTVRRGQEAVIDAIRTWSETVQSITPKLPVVP |
| Ga0209073_101001451 | 3300027765 | Agricultural Soil | MANTTTTQGLQDEVLNTVRKSQEAVIDAIRTWSETVQSITPK |
| Ga0209274_102497642 | 3300027853 | Soil | MPNTPQQLQEELINTVRKSQETVLDAIKSWVETVQSIT |
| Ga0302220_100579351 | 3300028742 | Palsa | MASKPTQEVQDEFLSTIRKSQETVIDAIRTWVETVQSAVPQVPSVQLPLADKLPDPEE |
| Ga0302220_103324962 | 3300028742 | Palsa | MASKPTQDLQDEFLSTIRKSQETVIDAIRSWVETVQSAVPQVSSV |
| Ga0307280_103105931 | 3300028768 | Soil | MASTPTQDLQNEVLNTVRKSQETVIDALKTWVETVQSITPKVPAVDM |
| Ga0302234_103705122 | 3300028773 | Palsa | MASKPTQEVQDEFLSTIRKSQETVIDAIRTWVETVQSAVPQVPSVQLPLADKLP |
| Ga0302226_100338651 | 3300028801 | Palsa | MASKPTQEVQDEFLSTIRKSQETVIDAIRTWVETVQSAVPR |
| Ga0302228_105104831 | 3300028808 | Palsa | MASNPTQELQEEFLSTIRKSQDTVLDAIKTWAEAVPSLAPQLSSVQLPLA |
| Ga0311368_110319061 | 3300029882 | Palsa | MASNITQDVQEQFLSTIRKSQEMTIDALKTWVETVQS |
| Ga0311368_110468982 | 3300029882 | Palsa | MASKPTQDLQDEFLSTIRKSQETVIDAIRTWVETVQSAVPQVPAVQLPLA |
| Ga0311369_110839061 | 3300029910 | Palsa | MASKPTQEVQDEFLSTIRKSQETVIDAIRTWVETVQSAVPQVPSVQLPLADKLPDPEEVVATAYDFAEQLL |
| Ga0311340_107788151 | 3300029943 | Palsa | MASKPTQDLQDEFLSTIRKSQETVIDAIRTWVETVQSAVPQ |
| Ga0311371_107405963 | 3300029951 | Palsa | MTSPQQVQDEILNTVRKSQETVVEAIKTWVETVQS |
| Ga0311339_109469141 | 3300029999 | Palsa | MTSPQQVQDEILNTVRKSQETVVEAIKTWVETVQSITP |
| Ga0311338_107601661 | 3300030007 | Palsa | MTSPQQVQDEILNTVRKSQETVVEAIKTWVETVQSITPKLPSV |
| Ga0311338_113946322 | 3300030007 | Palsa | MASKPTQEVQDEFLSTIRKSQETVIDAIRTWVETVQS |
| Ga0302181_101065702 | 3300030056 | Palsa | MTSPQQVQDEILNTVRKSQETVVEAIKTWVETVQSITSK |
| Ga0302184_102477182 | 3300030490 | Palsa | MASKPTQDVQDEFLSTIRKSQETVIDAIRTWVETVQSAVPQVPSVQLPLADKLPDPE |
| Ga0302317_104303242 | 3300030677 | Palsa | MASKPTQEVQDEFLSTIRKSQETVIDAIRTWVETVQSAVPQVPSV |
| Ga0310038_102303721 | 3300030707 | Peatlands Soil | MASTPTQDLQNEFLNTIRKSQETVIDAIKTWAEAVQS |
| Ga0307482_12516952 | 3300030730 | Hardwood Forest Soil | MASTPTQDLQNEVLITVRKSQESVIDALKTWVETVQSITPK |
| Ga0265743_1157072 | 3300030885 | Soil | MANAPTQDLQNEILTTVRKSQETVIDAIRTWVETVQSITPKVP |
| Ga0302314_100708261 | 3300030906 | Palsa | MASKPTQDLQDEFLSTIRKSQETVIDAIRTWVETVQSAVPQVPAV |
| Ga0138301_12629741 | 3300031022 | Soil | MASTPTQDLQNEVLNTVRKSQESVIDAIKTWVETVQSMTPK |
| Ga0308201_102025193 | 3300031091 | Soil | MASTPTQDLQNEVLNTVRKSQETVIDALKTWVETVQSITPKVPAVD |
| Ga0302325_122376212 | 3300031234 | Palsa | MASKPTQEVQDEFLSTIRKSQETVIDAIRTWVETVQSAVPQVPSVQLPLADKLPDPEEVVATAY |
| Ga0302324_1004786661 | 3300031236 | Palsa | MTSPQQVQDEILNTVRKSQETVVEAIKTWVETVQSITPKLPSVNVPLADKLP |
| Ga0302326_102414805 | 3300031525 | Palsa | MTSPQQVQDEILNTVRKSQETVVEAIKTWVETVQSITPKLPSVNVPLA |
| Ga0318571_100250691 | 3300031549 | Soil | MASNPTQDLQNEILNTVRKSQETVIDAIKTWVETIQSLTPKVPAVDLPF |
| Ga0318515_106181721 | 3300031572 | Soil | MASNPTQDLQNEILNTVRKSQETVIDAIKTWVETIQSLTPKVPAVDLPFADK |
| Ga0307483_10326282 | 3300031590 | Hardwood Forest Soil | MASTPTQDVQNEILTTVRKSQESVIDAIKTWVETVQSITPKL |
| Ga0318555_104911343 | 3300031640 | Soil | MASNPTQDLQNEILNTVRKSQETVIDAIKTWVETIQSLTPKVPAVD |
| Ga0318572_108269651 | 3300031681 | Soil | MASTPTQDLQNEILTTVRKSQESVIDAIKAWVETIQSLTPKVP |
| Ga0310686_1029075593 | 3300031708 | Soil | MASTPTQDIQDEFLNTVRKSQEAVIDAIKSWVETVQSVTPKLPSMNVPLAD |
| Ga0310686_1169856802 | 3300031708 | Soil | MPSTPQEMQEEILNTVRKSQETVIDAIKSWVETVQS |
| Ga0318493_106544333 | 3300031723 | Soil | MASNPTQDLQNEILNTVRKSQETVIDAIKTWVETI |
| Ga0306918_104530451 | 3300031744 | Soil | MASNPTQDLQNEILNTVRKSQETVIDAIKTWVETIQSLTPKVPAV |
| Ga0318494_101256821 | 3300031751 | Soil | MVSTTQEVQDEILNTVRKSQETVIEAVKAWVEAIQSVTPKLPSVSVPLAD |
| Ga0318529_104860432 | 3300031792 | Soil | MASNPTQDLQNEILNTVRKSQETVIDAIKTWVETIQSLTPKVPAVDLP |
| Ga0318565_102678351 | 3300031799 | Soil | MASTPTQDLQNEILTTVRKSQESVIDAIKAWVETIQSLTPKVPAVDLPFAGQLPKPE |
| Ga0307478_116987472 | 3300031823 | Hardwood Forest Soil | MPSTQQEVQDEILNTVRKSQETVVEAIKSWVETVQSVTPKL |
| Ga0318499_103638321 | 3300031832 | Soil | MVSTTQEVQDEILNTVRKSQETVIEAVKAWVEAIQSV |
| Ga0318517_105883102 | 3300031835 | Soil | MASNPTQDLQNEILNTVRKSQETVIDAIKTWVETIQSLTPKV |
| Ga0318512_101140591 | 3300031846 | Soil | MASNPTQDLQNEILNTIRKSQETVIDAIKTWVETIQSL |
| Ga0318512_105988291 | 3300031846 | Soil | MVSSTQEVQDEILNTVRKSQETVLEAVKAWIEAVQSVTPKLPSVSMPLADRLPKPE |
| Ga0306921_108630861 | 3300031912 | Soil | MASNPTQAVQNEVLNTVSKSQEAVVDAIKTWVETVQSITPKIP |
| Ga0308174_112623452 | 3300031939 | Soil | MASTPTQSVQDDVLNTVRKSQEAVIDAIRTWSETIQSITPKLP |
| Ga0318562_107230682 | 3300032008 | Soil | MANNPGRDMQEEFLNAVRKSEETVIDAIKSWVETVQS |
| Ga0318563_103902481 | 3300032009 | Soil | MVSTPQEVQDEILNAVRKSQETVIEAIKSWVETVQSITPKLPSM |
| Ga0318507_102402842 | 3300032025 | Soil | MVSTPQEVQDEFLNTVRKSQETVLEAIKAWVEAVQSITPKLPSVSVPLADRLPK |
| Ga0318556_107618742 | 3300032043 | Soil | MASTPTQDLQNEILTTVRKSQESVIDAIKAWVETIQSLTPKVPAVD |
| Ga0318575_105711751 | 3300032055 | Soil | MASNPTQAVQNEVLNTVSKSQEAVVDAIKTWVETVQSITPKI |
| Ga0318553_105767722 | 3300032068 | Soil | MANTATQDLQDEILTTVRKGQESVIDAIKTWVETVQAITPK |
| Ga0311301_117690691 | 3300032160 | Peatlands Soil | MASTPTQDIQDEFLNTIRKSQETVIDAIKSWVESVQSITPK |
| Ga0307472_1020551932 | 3300032205 | Hardwood Forest Soil | MASTPTQDLQNEVLSTVRKSQESVIDALKTWVETVQSITPKVPAVDMPFAHKQPKPEEDLASAY |
| Ga0335082_100284827 | 3300032782 | Soil | MASNPVQDMQQEFLNALRKSEETVVDAIKTWVETVQSITPKIPSVQVPGA |
| Ga0335078_127291332 | 3300032805 | Soil | MATNPTQQIQDEILNTIRKSQETVIDALQTWVETVQSITPKIPS |
| Ga0370515_0086732_2_115 | 3300034163 | Untreated Peat Soil | MASNSTQDMQEQFLSTIRKGQEMTIDALKTWVETVQSL |
| Ga0314792_109744_560_697 | 3300034667 | Soil | MASTPTQDLQNEVLITVRKSQESVIDALKTWVETVQSITPKIPAVD |
| Ga0314792_177431_454_585 | 3300034667 | Soil | MASTPTQDLQNEVLNTVRKSQESVIDAIKTWVETVQSITPKVPA |
| Ga0314797_106604_465_581 | 3300034672 | Soil | MASTPTQDLQNEVLNTVRKSQETVIDAIKTWVETVQSIT |
| Ga0314797_128871_3_146 | 3300034672 | Soil | MASTPTQDVQNEILSTVRKSQESVIDALKTWVETVQSITPKIPAVDMP |
| Ga0373948_0105479_1_162 | 3300034817 | Rhizosphere Soil | MASTPTQDLQNEVLITVRKSQESVIDALKTWVETVQSITPKIPAVDMPFADKLP |
| ⦗Top⦘ |