NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F037408

Metagenome / Metatranscriptome Family F037408

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F037408
Family Type Metagenome / Metatranscriptome
Number of Sequences 168
Average Sequence Length 35 residues
Representative Sequence MDRRLANKNLRTGLIAGAISLIVFAASFFVGFVY
Number of Associated Samples 92
Number of Associated Scaffolds 168

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 22.45 %
% of genes near scaffold ends (potentially truncated) 8.93 %
% of genes from short scaffolds (< 2000 bps) 73.81 %
Associated GOLD sequencing projects 91
AlphaFold2 3D model prediction Yes
3D model pTM-score0.57

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (79.167 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand
(29.762 % of family members)
Environment Ontology (ENVO) Unclassified
(29.762 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(66.071 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 50.00%    β-sheet: 0.00%    Coil/Unstructured: 50.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.57
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 168 Family Scaffolds
PF00480ROK 27.38
PF12270Cyt_c_ox_IV 13.10
PF00571CBS 8.93
PF08544GHMP_kinases_C 3.57
PF12833HTH_18 3.57
PF00456Transketolase_N 2.98
PF01040UbiA 2.38
PF03358FMN_red 1.79
PF02790COX2_TM 1.19
PF01464SLT 1.19
PF03411Peptidase_M74 1.19
PF02779Transket_pyr 1.19
PF0563523S_rRNA_IVP 1.19
PF07885Ion_trans_2 0.60
PF13490zf-HC2 0.60
PF01425Amidase 0.60
PF01545Cation_efflux 0.60
PF00510COX3 0.60
PF13711DUF4160 0.60
PF00999Na_H_Exchanger 0.60
PF01230HIT 0.60
PF00115COX1 0.60
PF04389Peptidase_M28 0.60
PF02350Epimerase_2 0.60
PF08327AHSA1 0.60
PF10509GalKase_gal_bdg 0.60
PF13646HEAT_2 0.60
PF02472ExbD 0.60
PF10609ParA 0.60
PF00232Glyco_hydro_1 0.60
PF00923TAL_FSA 0.60

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 168 Family Scaffolds
COG1940Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domainTranscription [K] 54.76
COG0021TransketolaseCarbohydrate transport and metabolism [G] 2.98
COG3959Transketolase, N-terminal subunitCarbohydrate transport and metabolism [G] 2.98
COG3770Murein endopeptidase MepA (D-alanyl-D-alanine-endopeptidase)Cell wall/membrane/envelope biogenesis [M] 1.19
COG1622Heme/copper-type cytochrome/quinol oxidase, subunit 2Energy production and conversion [C] 1.19
COG4651Predicted Kef-type K+ transport protein, K+/H+ antiporter domainInorganic ion transport and metabolism [P] 0.60
COG3965Predicted Co/Zn/Cd cation transporter, cation efflux familyInorganic ion transport and metabolism [P] 0.60
COG3263NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domainsEnergy production and conversion [C] 0.60
COG3004Na+/H+ antiporter NhaAEnergy production and conversion [C] 0.60
COG2723Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidaseCarbohydrate transport and metabolism [G] 0.60
COG1845Heme/copper-type cytochrome/quinol oxidase, subunit 3Energy production and conversion [C] 0.60
COG1230Co/Zn/Cd efflux system componentInorganic ion transport and metabolism [P] 0.60
COG0848Biopolymer transport protein ExbDIntracellular trafficking, secretion, and vesicular transport [U] 0.60
COG0707UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferaseCell wall/membrane/envelope biogenesis [M] 0.60
COG0475Kef-type K+ transport system, membrane component KefBInorganic ion transport and metabolism [P] 0.60
COG0381UDP-N-acetylglucosamine 2-epimeraseCell wall/membrane/envelope biogenesis [M] 0.60
COG0176Transaldolase/fructose-6-phosphate aldolaseCarbohydrate transport and metabolism [G] 0.60
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 0.60
COG0053Divalent metal cation (Fe/Co/Zn/Cd) efflux pumpInorganic ion transport and metabolism [P] 0.60
COG0025NhaP-type Na+/H+ or K+/H+ antiporterInorganic ion transport and metabolism [P] 0.60


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms79.17 %
UnclassifiedrootN/A20.83 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000956|JGI10216J12902_105601960All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei1068Open in IMG/M
3300001537|A2065W1_10715409All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1352Open in IMG/M
3300005529|Ga0070741_10255773All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1666Open in IMG/M
3300005564|Ga0070664_101865345All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300005576|Ga0066708_10993929All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia521Open in IMG/M
3300005577|Ga0068857_101151242All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia750Open in IMG/M
3300005578|Ga0068854_102013459All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales532Open in IMG/M
3300005587|Ga0066654_10232097All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia968Open in IMG/M
3300005587|Ga0066654_10598539All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia610Open in IMG/M
3300005614|Ga0068856_100049247All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales4152Open in IMG/M
3300006031|Ga0066651_10327448All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales822Open in IMG/M
3300006031|Ga0066651_10453418All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria681Open in IMG/M
3300006032|Ga0066696_10387062All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia912Open in IMG/M
3300006046|Ga0066652_101050577All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia772Open in IMG/M
3300006169|Ga0082029_1405147All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria634Open in IMG/M
3300006196|Ga0075422_10193327All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia833Open in IMG/M
3300006792|Ga0075530_1046942All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1522Open in IMG/M
3300006800|Ga0066660_10385019All Organisms → cellular organisms → Bacteria1152Open in IMG/M
3300006844|Ga0075428_100237872All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1965Open in IMG/M
3300006845|Ga0075421_100667238All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1213Open in IMG/M
3300006876|Ga0079217_11229838All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia572Open in IMG/M
3300006954|Ga0079219_11529421All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia606Open in IMG/M
3300009090|Ga0099827_11084653All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia695Open in IMG/M
3300009093|Ga0105240_11637876All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300009094|Ga0111539_11006485All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album969Open in IMG/M
3300009094|Ga0111539_12554459All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria592Open in IMG/M
3300009098|Ga0105245_12570779All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia562Open in IMG/M
3300009137|Ga0066709_100489617All Organisms → cellular organisms → Bacteria1729Open in IMG/M
3300009162|Ga0075423_12715282All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300009659|Ga0123328_1208099All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria739Open in IMG/M
3300009789|Ga0126307_10007033All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia7991Open in IMG/M
3300009840|Ga0126313_10000006All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia183991Open in IMG/M
3300009840|Ga0126313_10041664All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3201Open in IMG/M
3300009840|Ga0126313_10096489All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2167Open in IMG/M
3300009840|Ga0126313_10690288Not Available826Open in IMG/M
3300009840|Ga0126313_11783407Not Available515Open in IMG/M
3300010038|Ga0126315_10687314Not Available667Open in IMG/M
3300010039|Ga0126309_10013907All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia3385Open in IMG/M
3300010039|Ga0126309_10059254Not Available1860Open in IMG/M
3300010039|Ga0126309_10223223All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1054Open in IMG/M
3300010039|Ga0126309_10788670All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria619Open in IMG/M
3300010040|Ga0126308_10104803All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1738Open in IMG/M
3300010040|Ga0126308_10711630All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia691Open in IMG/M
3300010041|Ga0126312_10358811All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium1033Open in IMG/M
3300010041|Ga0126312_10565695All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria816Open in IMG/M
3300010044|Ga0126310_10222317All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1256Open in IMG/M
3300010044|Ga0126310_11562848All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria543Open in IMG/M
3300010044|Ga0126310_11878957All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia500Open in IMG/M
3300010045|Ga0126311_10808008All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia756Open in IMG/M
3300010045|Ga0126311_11259559Not Available613Open in IMG/M
3300010399|Ga0134127_11263793All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales806Open in IMG/M
3300010399|Ga0134127_11425883All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria764Open in IMG/M
3300010400|Ga0134122_11612223All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium673Open in IMG/M
3300012042|Ga0136627_1000145All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia22815Open in IMG/M
3300012042|Ga0136627_1000450All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia15471Open in IMG/M
3300012042|Ga0136627_1058836All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1357Open in IMG/M
3300012042|Ga0136627_1103449All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. CPCC 204708971Open in IMG/M
3300012042|Ga0136627_1161836All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria739Open in IMG/M
3300012043|Ga0136631_10011753All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album3072Open in IMG/M
3300012043|Ga0136631_10250656All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria698Open in IMG/M
3300012043|Ga0136631_10308712All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria630Open in IMG/M
3300012045|Ga0136623_10094500All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1305Open in IMG/M
3300012045|Ga0136623_10291632All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia692Open in IMG/M
3300012046|Ga0136634_10295272Not Available659Open in IMG/M
3300012091|Ga0136625_1112512All Organisms → cellular organisms → Bacteria947Open in IMG/M
3300012091|Ga0136625_1115624All Organisms → cellular organisms → Bacteria932Open in IMG/M
3300012091|Ga0136625_1200880All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia678Open in IMG/M
3300012091|Ga0136625_1286696All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300012091|Ga0136625_1298381All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria544Open in IMG/M
3300012092|Ga0136621_1164352All Organisms → cellular organisms → Bacteria886Open in IMG/M
3300012092|Ga0136621_1249798All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria695Open in IMG/M
3300012093|Ga0136632_10033562All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2336Open in IMG/M
3300012093|Ga0136632_10111883All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1262Open in IMG/M
3300012093|Ga0136632_10302987Not Available719Open in IMG/M
3300012183|Ga0136624_1179114All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria683Open in IMG/M
3300012186|Ga0136620_10051717All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1929Open in IMG/M
3300012186|Ga0136620_10182766All Organisms → cellular organisms → Bacteria936Open in IMG/M
3300012186|Ga0136620_10198043All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium892Open in IMG/M
3300012187|Ga0136622_10041165All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1972Open in IMG/M
3300012187|Ga0136622_10044006All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1904Open in IMG/M
3300012187|Ga0136622_10059193All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1632Open in IMG/M
3300012187|Ga0136622_10093405All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1278Open in IMG/M
3300012187|Ga0136622_10152161All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium977Open in IMG/M
3300012187|Ga0136622_10181500All Organisms → cellular organisms → Bacteria888Open in IMG/M
3300012187|Ga0136622_10301723Not Available672Open in IMG/M
3300012187|Ga0136622_10384625All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium589Open in IMG/M
3300012188|Ga0136618_10310655All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300012188|Ga0136618_10520831All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium515Open in IMG/M
3300012200|Ga0137382_10800620All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria678Open in IMG/M
3300012212|Ga0150985_108751614All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia521Open in IMG/M
3300012212|Ga0150985_122573632Not Available513Open in IMG/M
3300012285|Ga0137370_10853026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria564Open in IMG/M
3300012350|Ga0137372_10575746All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae829Open in IMG/M
3300012469|Ga0150984_105347177Not Available1142Open in IMG/M
3300012531|Ga0136640_10046801All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1932Open in IMG/M
3300012531|Ga0136640_10347306All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria626Open in IMG/M
3300012678|Ga0136615_10007912All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album5443Open in IMG/M
3300012680|Ga0136612_10136652All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium1246Open in IMG/M
3300012897|Ga0157285_10170064All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia663Open in IMG/M
3300012943|Ga0164241_10017444All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei5732Open in IMG/M
3300013011|Ga0169967_1004908All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3876Open in IMG/M
3300013013|Ga0169969_1091856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria666Open in IMG/M
3300013024|Ga0170682_1057630All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria732Open in IMG/M
3300013026|Ga0170681_1000490All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales20755Open in IMG/M
3300013026|Ga0170681_1029666All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1152Open in IMG/M
3300013772|Ga0120158_10039425All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3446Open in IMG/M
3300014058|Ga0120149_1246537All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300014487|Ga0182000_10251544All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales709Open in IMG/M
3300014488|Ga0182001_10102774All Organisms → cellular organisms → Bacteria891Open in IMG/M
3300014488|Ga0182001_10220384All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium710Open in IMG/M
3300014488|Ga0182001_10263383Not Available674Open in IMG/M
3300014488|Ga0182001_10429819Not Available585Open in IMG/M
3300014488|Ga0182001_10623345All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium523Open in IMG/M
3300015064|Ga0167641_122685All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria601Open in IMG/M
3300015165|Ga0167628_1045908All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria906Open in IMG/M
3300015209|Ga0167629_1008259All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia3926Open in IMG/M
3300015357|Ga0134072_10183967All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium712Open in IMG/M
3300015373|Ga0132257_101828723Not Available781Open in IMG/M
3300017659|Ga0134083_10482052All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria553Open in IMG/M
3300017965|Ga0190266_10287037All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia849Open in IMG/M
3300018422|Ga0190265_10540489All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1281Open in IMG/M
3300018422|Ga0190265_10569951All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1249Open in IMG/M
3300018422|Ga0190265_10578162All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1241Open in IMG/M
3300018432|Ga0190275_10000125All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia85852Open in IMG/M
3300018432|Ga0190275_11365172All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales785Open in IMG/M
3300018432|Ga0190275_12149016All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia637Open in IMG/M
3300018469|Ga0190270_10307075All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1417Open in IMG/M
3300018469|Ga0190270_10447729All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album1213Open in IMG/M
3300018469|Ga0190270_10595039Not Available1076Open in IMG/M
3300018469|Ga0190270_11167794All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album806Open in IMG/M
3300019377|Ga0190264_12270417All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia508Open in IMG/M
3300020070|Ga0206356_10810601All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1535Open in IMG/M
3300022756|Ga0222622_11248332All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium547Open in IMG/M
3300025918|Ga0207662_11154711All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia551Open in IMG/M
3300025949|Ga0207667_10336085All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1542Open in IMG/M
3300026078|Ga0207702_10142547All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2170Open in IMG/M
3300028721|Ga0307315_10025033All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1567Open in IMG/M
3300030006|Ga0299907_10008525All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album7186Open in IMG/M
3300030006|Ga0299907_10645007All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria818Open in IMG/M
3300030006|Ga0299907_10680085All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria790Open in IMG/M
3300031228|Ga0299914_10055224All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3400Open in IMG/M
3300031228|Ga0299914_10215136All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1703Open in IMG/M
3300031229|Ga0299913_10351692All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1461Open in IMG/M
3300031229|Ga0299913_11569567All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium610Open in IMG/M
3300031731|Ga0307405_10010442All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales4813Open in IMG/M
3300034007|Ga0334936_001566All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album8126Open in IMG/M
3300034007|Ga0334936_004946All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → unclassified Rhodococcus → Rhodococcus sp. 14-1411-2a3412Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand29.76%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil15.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil10.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.76%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.57%
RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Rock2.98%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.98%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.38%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil2.38%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.79%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil1.79%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost1.79%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.19%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.19%
BiocrustEnvironmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust1.19%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere1.19%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.60%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial0.60%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.60%
Termite NestEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest0.60%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.60%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.60%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.60%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.60%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.60%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.60%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.60%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.60%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.60%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.60%
Anaerobic Biogas ReactorEngineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor0.60%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001537Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-65 cm-11A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006169Termite nest microbial communities from Madurai, IndiaEnvironmentalOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006792Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL1-DEnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009659Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_A C12 SIP DNAEngineeredOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300012042Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ489 (22.06)EnvironmentalOpen in IMG/M
3300012043Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ601 (22.06)EnvironmentalOpen in IMG/M
3300012045Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06)EnvironmentalOpen in IMG/M
3300012046Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ833 (21.06)EnvironmentalOpen in IMG/M
3300012091Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ483 (23.06)EnvironmentalOpen in IMG/M
3300012092Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ445A (23.06)EnvironmentalOpen in IMG/M
3300012093Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ611 (21.06)EnvironmentalOpen in IMG/M
3300012183Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ469 (22.06)EnvironmentalOpen in IMG/M
3300012186Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ416 (21.06)EnvironmentalOpen in IMG/M
3300012187Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ448 (21.06)EnvironmentalOpen in IMG/M
3300012188Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ330 (21.06)EnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012526Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ857 (21.06)EnvironmentalOpen in IMG/M
3300012531Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ864 (21.06)EnvironmentalOpen in IMG/M
3300012678Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ288 (22.06)EnvironmentalOpen in IMG/M
3300012679Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ299 (21.06)EnvironmentalOpen in IMG/M
3300012680Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ224A (23.06)EnvironmentalOpen in IMG/M
3300012897Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1EnvironmentalOpen in IMG/M
3300012943Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY)EnvironmentalOpen in IMG/M
3300013011Gypsum crust endolithic microbial communities from the Atacama Desert, Chile - KM37EnvironmentalOpen in IMG/M
3300013013Gypsum rock endolithic microbial communities from the Atacama Desert, Chile - MonturaquiEnvironmentalOpen in IMG/M
3300013024Gypsum crust hypoendolithic microbial communities from the Atacama Desert, Chile - KM37, HEEnvironmentalOpen in IMG/M
3300013026Gypsum rock hypoendolithic microbial communities from the Atacama Desert, Chile - Cordon de LilaEnvironmentalOpen in IMG/M
3300013772Permafrost microbial communities from Nunavut, Canada - A10_80_0.25MEnvironmentalOpen in IMG/M
3300014058Permafrost microbial communities from Nunavut, Canada - A3_65cm_0.25MEnvironmentalOpen in IMG/M
3300014487Bulk soil microbial communities from Mexico - Magueyal (Ma) metaGEnvironmentalOpen in IMG/M
3300014488Bulk soil microbial communities from Mexico - San Felipe (SF) metaGEnvironmentalOpen in IMG/M
3300014965Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T2EnvironmentalOpen in IMG/M
3300015064Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G7B, Adjacent to main proglacial river, mid transect (Watson river))EnvironmentalOpen in IMG/M
3300015165Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G3A, Proglacial river margin, by glacier terminus)EnvironmentalOpen in IMG/M
3300015209Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G3B, Proglacial river margin, by glacier terminus)EnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017659Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028721Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355EnvironmentalOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300031228Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57EnvironmentalOpen in IMG/M
3300031229Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38EnvironmentalOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300034007Biocrust microbial communities from Mojave Desert, California, United States - 32SMCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10216J12902_10560196023300000956SoilMDRRLASRNIRTALIAGAISLIIFAAAFVAAYLY*
A2065W1_1071540923300001537PermafrostVDRRLAQKNLRTALVATAIILVVFAAAFLTGYIY*
Ga0070741_1025577323300005529Surface SoilMDRRLANRNIRTALIAGAISLIIFALAFVAAYVY*
Ga0070664_10186534523300005564Corn RhizosphereMDRRLASRNIRTALIAGAISLIIFAAAFLAAYLY*
Ga0066708_1099392923300005576SoilVDRRLAGKNLRTALIAGAISLFVFAAAFFTAYVY*
Ga0068857_10115124223300005577Corn RhizosphereMDRRLANRNIRTALIAGAISLIIFALSFVAAYLYS*
Ga0068854_10201345913300005578Corn RhizosphereICYKGARMDRRLAYRNIRTALIAGAIALIIFALAFLAAYLY*
Ga0066654_1023209723300005587SoilVDRRLANKNLRTALIAGAISLFIFAAAFFTALVY*
Ga0066654_1059853913300005587SoilDLLQRARMDRRLANRNIRTALIAGAISLIIFALAFVAAYLY*
Ga0068856_10004924773300005614Corn RhizosphereGARMDRRLANRNIRTALIAGAISLIIFALSFVAAYLYS*
Ga0066651_1032744823300006031SoilMDRRLAHKNIRTALIAGAIALAVFAAAWVSGIVY*
Ga0066651_1045341823300006031SoilMDRRLANRNIRTALIAGAISLIIFALAFVAAYLY*
Ga0066696_1038706223300006032SoilVDRRLASKNLRTALIAGAISLFVFAAAFFTAYVY*
Ga0066652_10105057723300006046SoilMDRRLASKNLRTGLIAGAIIFLVFGAAFFVASVY*
Ga0082029_140514723300006169Termite NestMDRRLANKNLRTGLIAGAISLIVFAASFFVGFVY*
Ga0075422_1019332743300006196Populus RhizosphereDRRLANKNIRTALIAGAISLIVFALSFVAGLTYT*
Ga0075530_104694223300006792Arctic Peat SoilVDRRLANRNLRTALIAGAISLIVFAASWVVGLVY*
Ga0066658_1090844523300006794SoilMDRRLALKNIRTGLIAGAIALFVFAAAFFAAAVY*
Ga0066660_1038501923300006800SoilVDRRLAAKNLRTALIAAAIALIVLAASFLAAFVY*
Ga0075428_10023787233300006844Populus RhizosphereMDRRLANKNIRTALIAGAISLIVFALSFVAGLTYT*
Ga0075421_10066723813300006845Populus RhizosphereMDRRLAQKNIRTALIAGAISLIIFALSFFAGLIYT*
Ga0079217_1122983823300006876Agricultural SoilMDRRLAHKNVRTALIAGSISLIVFALSFVAGLIYT*
Ga0079219_1152942133300006954Agricultural SoilMDRRLAYRNIRTALIAGAISLIIFALAFLAAYLY*
Ga0099827_1108465333300009090Vadose Zone SoilVDRRLAYKNLRTALIAGAISLIIFAVAFFTAIVY*
Ga0105240_1163787633300009093Corn RhizosphereMDRRLAYRNIRTALIAGAIALIIFALAFLAAYLY*
Ga0111539_1100648523300009094Populus RhizosphereMDRRLAQKNIRTALIAGAISLIVFALSFFTGLIYT*
Ga0111539_1255445913300009094Populus RhizosphereVDRRLAQKNIRTALIAGAISLVIFALSFFSGFIYT*
Ga0105245_1257077923300009098Miscanthus RhizosphereMDRRLASKNLRTALIAGAICFLVFGAAFFVASVY*
Ga0066709_10048961723300009137Grasslands SoilVDRRLAQKNLRTALIAGAICLFVFAAAWIAALVY*
Ga0075423_1271528223300009162Populus RhizosphereMDRRLASRNIRTALIAGAISLILFALAFVAAYLY*
Ga0123328_120809923300009659Anaerobic Biogas ReactorMDRRLANRNLRTALIAGAISLIVFAASWVVGFVY*
Ga0126307_1000703313300009789Serpentine SoilMDRRLANKNLRTGLIAGAISLIVFAASFFVGFIY*
Ga0126307_1002533623300009789Serpentine SoilMDRRLARRNIRTGLIAGAISASLFAASFIAAFLS*
Ga0126307_1033691933300009789Serpentine SoilMDRRLARRNIRTGLIAGAISASLFAASFLAAFLS*
Ga0126313_10000006513300009840Serpentine SoilMDRRLASRNLRTALIASAISLFVFAASWVVGLVY*
Ga0126313_1004166453300009840Serpentine SoilMDRRLANKNLRTALIAGAIIFIVFAAAFFSGYVY*
Ga0126313_1009648933300009840Serpentine SoilVDRRLAHKNLRTALIAGAISLIVFAAAWVTGLIY*
Ga0126313_1025287713300009840Serpentine SoilMDRRLARRNVRTGLIAGAISASIFAASFVAAFLS*
Ga0126313_1069028833300009840Serpentine SoilVDRRLAYKNLRTALIAGAISLMVFAAAWVTGLIY*
Ga0126313_1178340723300009840Serpentine SoilMDRRLANRNLRTALIAGSISLIVFAASWIVGLVY*
Ga0126315_1068731413300010038Serpentine SoilVDRRLAYKNLRTALIAGAISLIVFAAAWVTGLIY*
Ga0126309_10001222123300010039Serpentine SoilMDRRLARRNIRTGLIAGAISATVFAASFIAAFLS*
Ga0126309_1001390763300010039Serpentine SoilVDRRLARKNLRTALIAGAIILIVFAASFFSGYVY*
Ga0126309_1003786233300010039Serpentine SoilVDRRIALRNLRTGLIAGAISLLVFAAAFVAALVYT*
Ga0126309_1005925433300010039Serpentine SoilVDRRLAQKNLRTGLIAGAIILVIFAASFFSGYIY*
Ga0126309_1022322323300010039Serpentine SoilVDRRLAQKNLRTALIAGAISLIVFALSFFTGLVYT*
Ga0126309_1078867033300010039Serpentine SoilVDRRLAEKNLRTGLIAGAIILVVFAAAFFSGYVY*
Ga0126308_1005182513300010040Serpentine SoilMDRRLARRNIRTGLIAGAISVSLFAASFIAAFLS*
Ga0126308_1010480333300010040Serpentine SoilMDRRLAQKNLRTALIAGAISLIVFALSFFTGLVYT*
Ga0126308_1071163023300010040Serpentine SoilVDRRLAQKNLRTALIARAVCFFVFAAAWVASVVY*
Ga0126312_1035881123300010041Serpentine SoilVDRRLAQKNLRTALIAGAIILIIFAASFFSGYVY*
Ga0126312_1056569523300010041Serpentine SoilVDRRLAYKNLRTGLIAGAIILVIFAAAFFSGYVY*
Ga0126310_1022231733300010044Serpentine SoilVDRRLAQKNLRTALIAGAVAVFVLAAAFVAAAVY*
Ga0126310_1156284813300010044Serpentine SoilMDRRLAQKNLRTALIAGLVCLLMFAAAFITGIVY*
Ga0126310_1187895723300010044Serpentine SoilMDRRLAQKNIRTALIAGAISFIVFGAAFIAASVY*
Ga0126311_1080800823300010045Serpentine SoilVDRRLANKNLRTALIAGAVCVVVFAAAFLAASVY*
Ga0126311_1125955913300010045Serpentine SoilMDRRLAQKNIRTALIAGAISLVIFALSFFAGLVY*
Ga0134127_1126379313300010399Terrestrial SoilVDRRHAVKNIRTALIAGAISLIIFALSFVAGITY*
Ga0134127_1142588323300010399Terrestrial SoilMDRRLAQKNIRTALIAGAIWLIVFALSFFTGLIYT*
Ga0134122_1161222323300010400Terrestrial SoilVDRRLAQKNIRTALIAGAISLVIFALSFVSGFLYT*
Ga0136627_1000145263300012042Polar Desert SandVDRRLANRNLRTALIAGLICLMVFAASFGVAFVY*
Ga0136627_100045073300012042Polar Desert SandMDRRLANRNLRTALIAGAISMIVFAASFVAGLVY*
Ga0136627_101320343300012042Polar Desert SandMDRRLALSNIRTGLIAGAVALLVLAASFIAAVLY*
Ga0136627_105883643300012042Polar Desert SandVWQNAARMDRRLAERNIRTALIAGAIALLVFAASFVAGFVY*
Ga0136627_110344923300012042Polar Desert SandVDRRLANRNLRTALIAGLIALIVFAASFGVALVY*
Ga0136627_116183623300012042Polar Desert SandMDRRLAMKNLRTALIATAVSLFVFAGAFFSALVY*
Ga0136631_1001175353300012043Polar Desert SandMDRRLANKNVRTGLIAGAVSMLVFGLAFLIGFLY*
Ga0136631_1001362063300012043Polar Desert SandVDRRLANRNIRTGLIAGALALIVFAASFVVAFVY*
Ga0136631_1002593133300012043Polar Desert SandMDRRLALSNIRTGLIAGAVALVVLAASFIAAVLY*
Ga0136631_1009174733300012043Polar Desert SandVDRRLAQKNLRTGLIAGAISVVVLSASFFAAFVY*
Ga0136631_1025065623300012043Polar Desert SandVDRRLANRNIRTALIAGAICFLVFAASFLVAFVY*
Ga0136631_1030871233300012043Polar Desert SandSGKIPPVDRRLANRNLRTALIAGALALAVFAASFAVGLIY*
Ga0136623_1009450023300012045Polar Desert SandVDRRLANRNIRTALIAGVIALAVFAASFAVGFIY*
Ga0136623_1029163213300012045Polar Desert SandMDRNLANRNLRTALIAGAISMIVFAAAFFTGYIY*
Ga0136634_1029527223300012046Polar Desert SandVDRRLANRNIRTALIAGVIALAMFAASFAVGFIY*
Ga0136625_111251233300012091Polar Desert SandVDRYLARKNLRSGLIAGAISLIVFGVSFFTGYIY*
Ga0136625_111562423300012091Polar Desert SandVDRRLANRNLRTALIAGALALAVFAASFAVGLIY*
Ga0136625_120088023300012091Polar Desert SandVDRRLAHRNLRTALIATVLTLLVFAASFVVGLVY*
Ga0136625_128669623300012091Polar Desert SandVDRRLANRNLRTAFIAGALALIVFAASFAVGFVY*
Ga0136625_129838123300012091Polar Desert SandMDRRLANRNIRTALIAGTLALLVFAASFAVGFVY*
Ga0136621_116435233300012092Polar Desert SandVDRYLARKNLRTGLIAGAISLIIFGVSFFTGYIY*
Ga0136621_124979823300012092Polar Desert SandVDRRLANRNLRTALIAGLICLIVFAASFGVAFVY*
Ga0136632_1003356223300012093Polar Desert SandVDRYLARKNLRTGLIAGAISLIVFGVSFFTGYIY*
Ga0136632_1011188323300012093Polar Desert SandVDRRLANRNLRTALIAGAISLIVFAASFFTGFIY*
Ga0136632_1030298723300012093Polar Desert SandMLVDRRLANRNIRTALIAGVIALAVFAASFAVAFIY*
Ga0136624_117911423300012183Polar Desert SandVDRRLANRNLRTALIAGTIALIVFALSFFVGFIY*
Ga0136620_1005171743300012186Polar Desert SandMDRRLASRNLRTAFIAGAIAMIVFAASFVAGLVY*
Ga0136620_1018276623300012186Polar Desert SandMDRRLAQKNVRTGLIAGAISTLIFGLAFFAGYIY*
Ga0136620_1019804333300012186Polar Desert SandMDRRLATKNVRTGLIAGAISLIVFGASFFVGFIY*
Ga0136620_1027045923300012186Polar Desert SandMDRRLATRNLRTGLIAGAISLVVFGAAFFVASVY*
Ga0136622_1004116533300012187Polar Desert SandVDRRLANRNLRTALIAGLICMIVFAASFAVAFVY*
Ga0136622_1004400643300012187Polar Desert SandMRRVDRRLAQKNLRTALIAGAVSMIAFGAAFFAAFVY*
Ga0136622_1005919323300012187Polar Desert SandVDRRLANRNLRTALIAGALALAVFAASFVVGLIY*
Ga0136622_1009340533300012187Polar Desert SandVDRNLAYRNLRTALIAGTISLIVFALAFVTGLVY*
Ga0136622_1015216123300012187Polar Desert SandMDRRLANKNVRTGLIAGAISLIVFGASFFVGFIY*
Ga0136622_1018150023300012187Polar Desert SandVDRRLANRNLRTALIAGLLCLIVFAASFGVAFVY*
Ga0136622_1030172323300012187Polar Desert SandMDRRLAQKNVRTGLIASAISTLVFAAAFFAGYVY*
Ga0136622_1038462523300012187Polar Desert SandMDRHLATKNVRTGLIAGAISLIVFGASFFVGFIY*
Ga0136618_1031065523300012188Polar Desert SandMDRRLANRNLRTALIAGAIAMIVFAASFVAGFVY*
Ga0136618_1052083123300012188Polar Desert SandVDRRLANKNVRTGLIAGAISLIVFGASFFVGFIY*
Ga0137382_1080062023300012200Vadose Zone SoilVDRRLAQKNLRTAFIAGAICLFVFAAAWVAGFVY*
Ga0150985_10875161433300012212Avena Fatua RhizosphereCRAVDRQLAQKNLRTALIAGLVCLFVFAAAFLAAFVY*
Ga0150985_12257363233300012212Avena Fatua RhizosphereDVCSSDLLAVKNLRTGLIAGAISLLIFAAAFFTAIVY*
Ga0137370_1085302613300012285Vadose Zone SoilMDRRLANRNIRTALIAGAISLTIFALAFLAAYLY*
Ga0137372_1057574633300012350Vadose Zone SoilMDRRLANRNIRTALIAGAVSLIIFAAAFLAGYLY*
Ga0150984_10534717733300012469Avena Fatua RhizosphereVDRQLAQKNLRTALIAGLVCLFVFAAAFLAAFVY*
Ga0136637_114470413300012526Polar Desert SandMDRRLAMRNIRTGLIAGAVSLTVLAASFVAAFVY*
Ga0136640_1004680123300012531Polar Desert SandVDRRLANRNLRTALIAGLICLLVFAASFGVAFVY*
Ga0136640_1034730623300012531Polar Desert SandMDRRLASRNLRTALVAGAVALIVFAASFVVGLVY*
Ga0136615_10001243103300012678Polar Desert SandMDRRLALKNVRTGLMAGAISLLVFAAAFVAALVYS*
Ga0136615_1000791243300012678Polar Desert SandMDRKLANRNMRTALIAGAISLLVFAASFGVGYVY*
Ga0136615_1029727823300012678Polar Desert SandVDRRLAQKNLRTGLLCTAVSVLAFGLSFLAALVYG
Ga0136616_1007155623300012679Polar Desert SandMDRRLALKNVRTGLIAGTVALVILAASFIAAFVY*
Ga0136612_1013665223300012680Polar Desert SandVDRRLASRNLRTALICAVVSVLVFAAAFFAGSVY*
Ga0136612_1061671523300012680Polar Desert SandMDRRLAMRNIRTGLIAGMVSLSILAASFIAAFVY*
Ga0136612_1062605113300012680Polar Desert SandMDRRLATRNLRTGLIAGAISLVVFASAFFIAAIY*
Ga0157285_1017006423300012897SoilMDRRLAQKNIRTALIAGAISLIIFALSFVAGLTYT*
Ga0164241_1001744443300012943SoilMDRRLANRNLRTALIAGAISLIVFAASWAVGLVY*
Ga0169967_100490833300013011RockVDRRLANRNLRTALIAGAICLLVFAASFVVAFVY*
Ga0169969_109185613300013013RockVDRRLAQRNIRTALIAGAISLVVFALSFVVGFVY*
Ga0170682_105763023300013024RockMDRRLANRNIRTALLAGAICFLVFAAAFLVAFVY*
Ga0170681_100049043300013026RockVDRRLANRNLRTALIAGLISLIVFAASFGVAFVY*
Ga0170681_102966633300013026RockVDRRLANKNLRTALIAGAISLIVFAASFLVGFVYG*
Ga0120158_1003942573300013772PermafrostVDRKLAQKNLRTALVAAAIILVVFAAAFLTGYIY*
Ga0120149_124653723300014058PermafrostVDRKLAQKNLRTALVATAIILVVFAAAFLTGYIY*
Ga0182000_1025154423300014487SoilVDRRLAQKNLRTALIAGAVCCFVFAAAFVAAALY*
Ga0182001_1010277423300014488SoilMDRRLANKNLRTGLIAGAISLIFFGAAFLVAGAY*
Ga0182001_1022038413300014488SoilVDRRLAQKNLRTALIAGVVCFLVFAAAWIAALVY*
Ga0182001_1026338323300014488SoilVDRRLAQKNLRTAFIAGAICLLVFAAAWVAAFVY*
Ga0182001_1042981923300014488SoilVDRRLAQKNLRTAFIAGAICLLVFAGAWVAAFVY*
Ga0182001_1048382323300014488SoilMDRRLAARNLRTGLIAGAISFLVFGAAFFVASVY*
Ga0182001_1050539623300014488SoilMDRRLALKNVRTGLIAGAISVLVLAASFVAAFLY*
Ga0182001_1062334523300014488SoilVDRRLAQKNLRTALIAGAICLFVFAAAWLAAFVY*
Ga0120193_1002145823300014965TerrestrialMDRRLANKNIRTGLIAGAVSLIVFGAAFMAGYLY*
Ga0167641_12268523300015064Glacier Forefield SoilVDRRLANRNLRTALVAGTIIFVVFALSFLVGLIY*
Ga0167628_104590823300015165Glacier Forefield SoilVDRQLARRNLRTALIASVIALTVFAASFVVAFVY*
Ga0167629_100825923300015209Glacier Forefield SoilVDRHLANRNLRTALIAGTIALVVFALSFLVGFIY*
Ga0134072_1018396723300015357Grasslands SoilVDRRLAQKNLRTAFIAGAICLLVFAAAWVAGFVY*
Ga0132257_10182872333300015373Arabidopsis RhizosphereSAPMDRRLAQKNIRTALIAGAISLIVFALSFFTALIYT*
Ga0134083_1048205213300017659Grasslands SoilPVDRRLAQKNLRTALIAGAIIFLVFAAAFFAGYVY
Ga0190266_1028703713300017965SoilVDRRLAQKNIRTALIAGAISLIIFALSFLTGLVYT
Ga0190265_1054048933300018422SoilVDRRLAQKNIRTALIAGAISLIIFALSFFTGLVYT
Ga0190265_1056995123300018422SoilMDRRLAHKNLRTALIAGAISLIVFALSFFAGLVYT
Ga0190265_1057816223300018422SoilMDRRLAQKNLRTALIAGAISLVIFALSFFAGLVYT
Ga0190275_10000125663300018432SoilMDRRLALKNMRTALIAGAISLIVFAASFVAGLVYS
Ga0190275_1136517233300018432SoilMDRRLAQKNIRTALIAGAISLIIFALSFVAGLVYT
Ga0190275_1214901633300018432SoilVVVDRKLARRNLRTALIASVIALTVFAASWVVAFVY
Ga0190270_1030707513300018469SoilKRRVDRRLANRNLRTGFIAGALIMIVFAASFVVGFVY
Ga0190270_1044772923300018469SoilVDRRLAQKNIRTALIAGAISLIIFALSFVAGLVYT
Ga0190270_1059503933300018469SoilESGTNAAVDRRLANRNLRTALIAGAIILIVFAASFGVGLIY
Ga0190270_1116779433300018469SoilVDRRLAQKNIRTALIAGAISLIVFALSFFSGLIYT
Ga0190264_1227041713300019377SoilFVDSAFVDRRLAQKNIRTALIAGLVALFVFAAAWVAAAVY
Ga0206356_1081060123300020070Corn, Switchgrass And Miscanthus RhizosphereMDRRLANRNIRTALIAGAISLIIFALSFVAAYLYS
Ga0222622_1124833223300022756Groundwater SedimentVDRRLANKNIRTALIAGAISLVIFALSFFSGFIYT
Ga0207662_1115471113300025918Switchgrass RhizosphereMDRRLANKNIRTALIAGAISLIIFALSFVAGLTYS
Ga0207667_1033608523300025949Corn RhizosphereMDRRLANRNIRTALIAGAISLIIFALSFVAAYRYS
Ga0207702_1014254763300026078Corn RhizosphereGARMDRRLANRNIRTALIAGAISLIIFALSFVAAYLYS
Ga0307315_1002503353300028721SoilTKRDVDRRLANKNIRTALIAGAISLVIFALSFFSGFIYT
Ga0299907_1000852573300030006SoilVDRRLASKNLRTALIAGSIALLVFALSFFAGLVYS
Ga0299907_1064500723300030006SoilMDRRLAQKNLRTALIAGAISLIIFALSFFTGLVYT
Ga0299907_1068008523300030006SoilMDRRLATKNLRTALIAGAIALIIFALSFFAGLVYS
Ga0299914_1005522453300031228SoilMDRRLAHKNIRTALIAGAVSLIVFALSFFAGLVYT
Ga0299914_1021513643300031228SoilMDRRLAQKNLRTALIAGAISLVIFALSFFTGLVYT
Ga0299913_1035169243300031229SoilMDRRLAHKNLRTALIAGAISLIIFALSFFAGLVYT
Ga0299913_1156956723300031229SoilMDRRLAQKNVRTALIAGAISLIIFALSFFAGLVYS
Ga0307405_1001044233300031731RhizosphereMDRRLAHKNIRTALIAGAISLIVFALSFFAGLTYT
Ga0334936_001566_6637_67443300034007BiocrustMDRQLANKNLRTGLIAGAISLIFFGASFLVAATYA
Ga0334936_004946_1935_20423300034007BiocrustMDRRLANKNLRTGLIAGAISLIFFGASFLVAATYA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.