Basic Information | |
---|---|
Family ID | F037408 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 168 |
Average Sequence Length | 35 residues |
Representative Sequence | MDRRLANKNLRTGLIAGAISLIVFAASFFVGFVY |
Number of Associated Samples | 92 |
Number of Associated Scaffolds | 168 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 22.45 % |
% of genes near scaffold ends (potentially truncated) | 8.93 % |
% of genes from short scaffolds (< 2000 bps) | 73.81 % |
Associated GOLD sequencing projects | 91 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.57 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (79.167 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand (29.762 % of family members) |
Environment Ontology (ENVO) | Unclassified (29.762 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (66.071 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 168 Family Scaffolds |
---|---|---|
PF00480 | ROK | 27.38 |
PF12270 | Cyt_c_ox_IV | 13.10 |
PF00571 | CBS | 8.93 |
PF08544 | GHMP_kinases_C | 3.57 |
PF12833 | HTH_18 | 3.57 |
PF00456 | Transketolase_N | 2.98 |
PF01040 | UbiA | 2.38 |
PF03358 | FMN_red | 1.79 |
PF02790 | COX2_TM | 1.19 |
PF01464 | SLT | 1.19 |
PF03411 | Peptidase_M74 | 1.19 |
PF02779 | Transket_pyr | 1.19 |
PF05635 | 23S_rRNA_IVP | 1.19 |
PF07885 | Ion_trans_2 | 0.60 |
PF13490 | zf-HC2 | 0.60 |
PF01425 | Amidase | 0.60 |
PF01545 | Cation_efflux | 0.60 |
PF00510 | COX3 | 0.60 |
PF13711 | DUF4160 | 0.60 |
PF00999 | Na_H_Exchanger | 0.60 |
PF01230 | HIT | 0.60 |
PF00115 | COX1 | 0.60 |
PF04389 | Peptidase_M28 | 0.60 |
PF02350 | Epimerase_2 | 0.60 |
PF08327 | AHSA1 | 0.60 |
PF10509 | GalKase_gal_bdg | 0.60 |
PF13646 | HEAT_2 | 0.60 |
PF02472 | ExbD | 0.60 |
PF10609 | ParA | 0.60 |
PF00232 | Glyco_hydro_1 | 0.60 |
PF00923 | TAL_FSA | 0.60 |
COG ID | Name | Functional Category | % Frequency in 168 Family Scaffolds |
---|---|---|---|
COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 54.76 |
COG0021 | Transketolase | Carbohydrate transport and metabolism [G] | 2.98 |
COG3959 | Transketolase, N-terminal subunit | Carbohydrate transport and metabolism [G] | 2.98 |
COG3770 | Murein endopeptidase MepA (D-alanyl-D-alanine-endopeptidase) | Cell wall/membrane/envelope biogenesis [M] | 1.19 |
COG1622 | Heme/copper-type cytochrome/quinol oxidase, subunit 2 | Energy production and conversion [C] | 1.19 |
COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.60 |
COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 0.60 |
COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.60 |
COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.60 |
COG2723 | Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase | Carbohydrate transport and metabolism [G] | 0.60 |
COG1845 | Heme/copper-type cytochrome/quinol oxidase, subunit 3 | Energy production and conversion [C] | 0.60 |
COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 0.60 |
COG0848 | Biopolymer transport protein ExbD | Intracellular trafficking, secretion, and vesicular transport [U] | 0.60 |
COG0707 | UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase | Cell wall/membrane/envelope biogenesis [M] | 0.60 |
COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.60 |
COG0381 | UDP-N-acetylglucosamine 2-epimerase | Cell wall/membrane/envelope biogenesis [M] | 0.60 |
COG0176 | Transaldolase/fructose-6-phosphate aldolase | Carbohydrate transport and metabolism [G] | 0.60 |
COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.60 |
COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 0.60 |
COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.60 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 79.17 % |
Unclassified | root | N/A | 20.83 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000956|JGI10216J12902_105601960 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 1068 | Open in IMG/M |
3300001537|A2065W1_10715409 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1352 | Open in IMG/M |
3300005529|Ga0070741_10255773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1666 | Open in IMG/M |
3300005564|Ga0070664_101865345 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300005576|Ga0066708_10993929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 521 | Open in IMG/M |
3300005577|Ga0068857_101151242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 750 | Open in IMG/M |
3300005578|Ga0068854_102013459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 532 | Open in IMG/M |
3300005587|Ga0066654_10232097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 968 | Open in IMG/M |
3300005587|Ga0066654_10598539 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 610 | Open in IMG/M |
3300005614|Ga0068856_100049247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4152 | Open in IMG/M |
3300006031|Ga0066651_10327448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 822 | Open in IMG/M |
3300006031|Ga0066651_10453418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 681 | Open in IMG/M |
3300006032|Ga0066696_10387062 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 912 | Open in IMG/M |
3300006046|Ga0066652_101050577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 772 | Open in IMG/M |
3300006169|Ga0082029_1405147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 634 | Open in IMG/M |
3300006196|Ga0075422_10193327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 833 | Open in IMG/M |
3300006792|Ga0075530_1046942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1522 | Open in IMG/M |
3300006800|Ga0066660_10385019 | All Organisms → cellular organisms → Bacteria | 1152 | Open in IMG/M |
3300006844|Ga0075428_100237872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1965 | Open in IMG/M |
3300006845|Ga0075421_100667238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1213 | Open in IMG/M |
3300006876|Ga0079217_11229838 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 572 | Open in IMG/M |
3300006954|Ga0079219_11529421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 606 | Open in IMG/M |
3300009090|Ga0099827_11084653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 695 | Open in IMG/M |
3300009093|Ga0105240_11637876 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300009094|Ga0111539_11006485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 969 | Open in IMG/M |
3300009094|Ga0111539_12554459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 592 | Open in IMG/M |
3300009098|Ga0105245_12570779 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 562 | Open in IMG/M |
3300009137|Ga0066709_100489617 | All Organisms → cellular organisms → Bacteria | 1729 | Open in IMG/M |
3300009162|Ga0075423_12715282 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300009659|Ga0123328_1208099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 739 | Open in IMG/M |
3300009789|Ga0126307_10007033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 7991 | Open in IMG/M |
3300009840|Ga0126313_10000006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 183991 | Open in IMG/M |
3300009840|Ga0126313_10041664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3201 | Open in IMG/M |
3300009840|Ga0126313_10096489 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2167 | Open in IMG/M |
3300009840|Ga0126313_10690288 | Not Available | 826 | Open in IMG/M |
3300009840|Ga0126313_11783407 | Not Available | 515 | Open in IMG/M |
3300010038|Ga0126315_10687314 | Not Available | 667 | Open in IMG/M |
3300010039|Ga0126309_10013907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 3385 | Open in IMG/M |
3300010039|Ga0126309_10059254 | Not Available | 1860 | Open in IMG/M |
3300010039|Ga0126309_10223223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1054 | Open in IMG/M |
3300010039|Ga0126309_10788670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 619 | Open in IMG/M |
3300010040|Ga0126308_10104803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1738 | Open in IMG/M |
3300010040|Ga0126308_10711630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 691 | Open in IMG/M |
3300010041|Ga0126312_10358811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 1033 | Open in IMG/M |
3300010041|Ga0126312_10565695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 816 | Open in IMG/M |
3300010044|Ga0126310_10222317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1256 | Open in IMG/M |
3300010044|Ga0126310_11562848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 543 | Open in IMG/M |
3300010044|Ga0126310_11878957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 500 | Open in IMG/M |
3300010045|Ga0126311_10808008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 756 | Open in IMG/M |
3300010045|Ga0126311_11259559 | Not Available | 613 | Open in IMG/M |
3300010399|Ga0134127_11263793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 806 | Open in IMG/M |
3300010399|Ga0134127_11425883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 764 | Open in IMG/M |
3300010400|Ga0134122_11612223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 673 | Open in IMG/M |
3300012042|Ga0136627_1000145 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 22815 | Open in IMG/M |
3300012042|Ga0136627_1000450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 15471 | Open in IMG/M |
3300012042|Ga0136627_1058836 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1357 | Open in IMG/M |
3300012042|Ga0136627_1103449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. CPCC 204708 | 971 | Open in IMG/M |
3300012042|Ga0136627_1161836 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 739 | Open in IMG/M |
3300012043|Ga0136631_10011753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 3072 | Open in IMG/M |
3300012043|Ga0136631_10250656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 698 | Open in IMG/M |
3300012043|Ga0136631_10308712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 630 | Open in IMG/M |
3300012045|Ga0136623_10094500 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1305 | Open in IMG/M |
3300012045|Ga0136623_10291632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 692 | Open in IMG/M |
3300012046|Ga0136634_10295272 | Not Available | 659 | Open in IMG/M |
3300012091|Ga0136625_1112512 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
3300012091|Ga0136625_1115624 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
3300012091|Ga0136625_1200880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 678 | Open in IMG/M |
3300012091|Ga0136625_1286696 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300012091|Ga0136625_1298381 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 544 | Open in IMG/M |
3300012092|Ga0136621_1164352 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
3300012092|Ga0136621_1249798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 695 | Open in IMG/M |
3300012093|Ga0136632_10033562 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2336 | Open in IMG/M |
3300012093|Ga0136632_10111883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1262 | Open in IMG/M |
3300012093|Ga0136632_10302987 | Not Available | 719 | Open in IMG/M |
3300012183|Ga0136624_1179114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 683 | Open in IMG/M |
3300012186|Ga0136620_10051717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1929 | Open in IMG/M |
3300012186|Ga0136620_10182766 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
3300012186|Ga0136620_10198043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 892 | Open in IMG/M |
3300012187|Ga0136622_10041165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1972 | Open in IMG/M |
3300012187|Ga0136622_10044006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1904 | Open in IMG/M |
3300012187|Ga0136622_10059193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1632 | Open in IMG/M |
3300012187|Ga0136622_10093405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1278 | Open in IMG/M |
3300012187|Ga0136622_10152161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 977 | Open in IMG/M |
3300012187|Ga0136622_10181500 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
3300012187|Ga0136622_10301723 | Not Available | 672 | Open in IMG/M |
3300012187|Ga0136622_10384625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 589 | Open in IMG/M |
3300012188|Ga0136618_10310655 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
3300012188|Ga0136618_10520831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 515 | Open in IMG/M |
3300012200|Ga0137382_10800620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 678 | Open in IMG/M |
3300012212|Ga0150985_108751614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 521 | Open in IMG/M |
3300012212|Ga0150985_122573632 | Not Available | 513 | Open in IMG/M |
3300012285|Ga0137370_10853026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 564 | Open in IMG/M |
3300012350|Ga0137372_10575746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae | 829 | Open in IMG/M |
3300012469|Ga0150984_105347177 | Not Available | 1142 | Open in IMG/M |
3300012531|Ga0136640_10046801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1932 | Open in IMG/M |
3300012531|Ga0136640_10347306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 626 | Open in IMG/M |
3300012678|Ga0136615_10007912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 5443 | Open in IMG/M |
3300012680|Ga0136612_10136652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1246 | Open in IMG/M |
3300012897|Ga0157285_10170064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 663 | Open in IMG/M |
3300012943|Ga0164241_10017444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 5732 | Open in IMG/M |
3300013011|Ga0169967_1004908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3876 | Open in IMG/M |
3300013013|Ga0169969_1091856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 666 | Open in IMG/M |
3300013024|Ga0170682_1057630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 732 | Open in IMG/M |
3300013026|Ga0170681_1000490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 20755 | Open in IMG/M |
3300013026|Ga0170681_1029666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1152 | Open in IMG/M |
3300013772|Ga0120158_10039425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3446 | Open in IMG/M |
3300014058|Ga0120149_1246537 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300014487|Ga0182000_10251544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 709 | Open in IMG/M |
3300014488|Ga0182001_10102774 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
3300014488|Ga0182001_10220384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 710 | Open in IMG/M |
3300014488|Ga0182001_10263383 | Not Available | 674 | Open in IMG/M |
3300014488|Ga0182001_10429819 | Not Available | 585 | Open in IMG/M |
3300014488|Ga0182001_10623345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 523 | Open in IMG/M |
3300015064|Ga0167641_122685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 601 | Open in IMG/M |
3300015165|Ga0167628_1045908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 906 | Open in IMG/M |
3300015209|Ga0167629_1008259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 3926 | Open in IMG/M |
3300015357|Ga0134072_10183967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 712 | Open in IMG/M |
3300015373|Ga0132257_101828723 | Not Available | 781 | Open in IMG/M |
3300017659|Ga0134083_10482052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 553 | Open in IMG/M |
3300017965|Ga0190266_10287037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 849 | Open in IMG/M |
3300018422|Ga0190265_10540489 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1281 | Open in IMG/M |
3300018422|Ga0190265_10569951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1249 | Open in IMG/M |
3300018422|Ga0190265_10578162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1241 | Open in IMG/M |
3300018432|Ga0190275_10000125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 85852 | Open in IMG/M |
3300018432|Ga0190275_11365172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 785 | Open in IMG/M |
3300018432|Ga0190275_12149016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 637 | Open in IMG/M |
3300018469|Ga0190270_10307075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1417 | Open in IMG/M |
3300018469|Ga0190270_10447729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 1213 | Open in IMG/M |
3300018469|Ga0190270_10595039 | Not Available | 1076 | Open in IMG/M |
3300018469|Ga0190270_11167794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 806 | Open in IMG/M |
3300019377|Ga0190264_12270417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 508 | Open in IMG/M |
3300020070|Ga0206356_10810601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1535 | Open in IMG/M |
3300022756|Ga0222622_11248332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 547 | Open in IMG/M |
3300025918|Ga0207662_11154711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 551 | Open in IMG/M |
3300025949|Ga0207667_10336085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1542 | Open in IMG/M |
3300026078|Ga0207702_10142547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2170 | Open in IMG/M |
3300028721|Ga0307315_10025033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1567 | Open in IMG/M |
3300030006|Ga0299907_10008525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 7186 | Open in IMG/M |
3300030006|Ga0299907_10645007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 818 | Open in IMG/M |
3300030006|Ga0299907_10680085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 790 | Open in IMG/M |
3300031228|Ga0299914_10055224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3400 | Open in IMG/M |
3300031228|Ga0299914_10215136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1703 | Open in IMG/M |
3300031229|Ga0299913_10351692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1461 | Open in IMG/M |
3300031229|Ga0299913_11569567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 610 | Open in IMG/M |
3300031731|Ga0307405_10010442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4813 | Open in IMG/M |
3300034007|Ga0334936_001566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 8126 | Open in IMG/M |
3300034007|Ga0334936_004946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → unclassified Rhodococcus → Rhodococcus sp. 14-1411-2a | 3412 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 29.76% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 15.48% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.71% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.95% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.76% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.57% |
Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Rock | 2.98% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.98% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.38% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 2.38% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.79% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 1.79% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.79% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.19% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.19% |
Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust | 1.19% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.19% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.60% |
Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.60% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.60% |
Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.60% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.60% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.60% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.60% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.60% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.60% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.60% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.60% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.60% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.60% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.60% |
Anaerobic Biogas Reactor | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor | 0.60% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001537 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-65 cm-11A)- 1 week illumina | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
3300006792 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL1-D | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009659 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_A C12 SIP DNA | Engineered | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300012042 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ489 (22.06) | Environmental | Open in IMG/M |
3300012043 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ601 (22.06) | Environmental | Open in IMG/M |
3300012045 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06) | Environmental | Open in IMG/M |
3300012046 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ833 (21.06) | Environmental | Open in IMG/M |
3300012091 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ483 (23.06) | Environmental | Open in IMG/M |
3300012092 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ445A (23.06) | Environmental | Open in IMG/M |
3300012093 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ611 (21.06) | Environmental | Open in IMG/M |
3300012183 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ469 (22.06) | Environmental | Open in IMG/M |
3300012186 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ416 (21.06) | Environmental | Open in IMG/M |
3300012187 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ448 (21.06) | Environmental | Open in IMG/M |
3300012188 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ330 (21.06) | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012526 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ857 (21.06) | Environmental | Open in IMG/M |
3300012531 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ864 (21.06) | Environmental | Open in IMG/M |
3300012678 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ288 (22.06) | Environmental | Open in IMG/M |
3300012679 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ299 (21.06) | Environmental | Open in IMG/M |
3300012680 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ224A (23.06) | Environmental | Open in IMG/M |
3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
3300012943 | Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY) | Environmental | Open in IMG/M |
3300013011 | Gypsum crust endolithic microbial communities from the Atacama Desert, Chile - KM37 | Environmental | Open in IMG/M |
3300013013 | Gypsum rock endolithic microbial communities from the Atacama Desert, Chile - Monturaqui | Environmental | Open in IMG/M |
3300013024 | Gypsum crust hypoendolithic microbial communities from the Atacama Desert, Chile - KM37, HE | Environmental | Open in IMG/M |
3300013026 | Gypsum rock hypoendolithic microbial communities from the Atacama Desert, Chile - Cordon de Lila | Environmental | Open in IMG/M |
3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
3300014058 | Permafrost microbial communities from Nunavut, Canada - A3_65cm_0.25M | Environmental | Open in IMG/M |
3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
3300014965 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T2 | Environmental | Open in IMG/M |
3300015064 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G7B, Adjacent to main proglacial river, mid transect (Watson river)) | Environmental | Open in IMG/M |
3300015165 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G3A, Proglacial river margin, by glacier terminus) | Environmental | Open in IMG/M |
3300015209 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G3B, Proglacial river margin, by glacier terminus) | Environmental | Open in IMG/M |
3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
3300034007 | Biocrust microbial communities from Mojave Desert, California, United States - 32SMC | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI10216J12902_1056019602 | 3300000956 | Soil | MDRRLASRNIRTALIAGAISLIIFAAAFVAAYLY* |
A2065W1_107154092 | 3300001537 | Permafrost | VDRRLAQKNLRTALVATAIILVVFAAAFLTGYIY* |
Ga0070741_102557732 | 3300005529 | Surface Soil | MDRRLANRNIRTALIAGAISLIIFALAFVAAYVY* |
Ga0070664_1018653452 | 3300005564 | Corn Rhizosphere | MDRRLASRNIRTALIAGAISLIIFAAAFLAAYLY* |
Ga0066708_109939292 | 3300005576 | Soil | VDRRLAGKNLRTALIAGAISLFVFAAAFFTAYVY* |
Ga0068857_1011512422 | 3300005577 | Corn Rhizosphere | MDRRLANRNIRTALIAGAISLIIFALSFVAAYLYS* |
Ga0068854_1020134591 | 3300005578 | Corn Rhizosphere | ICYKGARMDRRLAYRNIRTALIAGAIALIIFALAFLAAYLY* |
Ga0066654_102320972 | 3300005587 | Soil | VDRRLANKNLRTALIAGAISLFIFAAAFFTALVY* |
Ga0066654_105985391 | 3300005587 | Soil | DLLQRARMDRRLANRNIRTALIAGAISLIIFALAFVAAYLY* |
Ga0068856_1000492477 | 3300005614 | Corn Rhizosphere | GARMDRRLANRNIRTALIAGAISLIIFALSFVAAYLYS* |
Ga0066651_103274482 | 3300006031 | Soil | MDRRLAHKNIRTALIAGAIALAVFAAAWVSGIVY* |
Ga0066651_104534182 | 3300006031 | Soil | MDRRLANRNIRTALIAGAISLIIFALAFVAAYLY* |
Ga0066696_103870622 | 3300006032 | Soil | VDRRLASKNLRTALIAGAISLFVFAAAFFTAYVY* |
Ga0066652_1010505772 | 3300006046 | Soil | MDRRLASKNLRTGLIAGAIIFLVFGAAFFVASVY* |
Ga0082029_14051472 | 3300006169 | Termite Nest | MDRRLANKNLRTGLIAGAISLIVFAASFFVGFVY* |
Ga0075422_101933274 | 3300006196 | Populus Rhizosphere | DRRLANKNIRTALIAGAISLIVFALSFVAGLTYT* |
Ga0075530_10469422 | 3300006792 | Arctic Peat Soil | VDRRLANRNLRTALIAGAISLIVFAASWVVGLVY* |
Ga0066658_109084452 | 3300006794 | Soil | MDRRLALKNIRTGLIAGAIALFVFAAAFFAAAVY* |
Ga0066660_103850192 | 3300006800 | Soil | VDRRLAAKNLRTALIAAAIALIVLAASFLAAFVY* |
Ga0075428_1002378723 | 3300006844 | Populus Rhizosphere | MDRRLANKNIRTALIAGAISLIVFALSFVAGLTYT* |
Ga0075421_1006672381 | 3300006845 | Populus Rhizosphere | MDRRLAQKNIRTALIAGAISLIIFALSFFAGLIYT* |
Ga0079217_112298382 | 3300006876 | Agricultural Soil | MDRRLAHKNVRTALIAGSISLIVFALSFVAGLIYT* |
Ga0079219_115294213 | 3300006954 | Agricultural Soil | MDRRLAYRNIRTALIAGAISLIIFALAFLAAYLY* |
Ga0099827_110846533 | 3300009090 | Vadose Zone Soil | VDRRLAYKNLRTALIAGAISLIIFAVAFFTAIVY* |
Ga0105240_116378763 | 3300009093 | Corn Rhizosphere | MDRRLAYRNIRTALIAGAIALIIFALAFLAAYLY* |
Ga0111539_110064852 | 3300009094 | Populus Rhizosphere | MDRRLAQKNIRTALIAGAISLIVFALSFFTGLIYT* |
Ga0111539_125544591 | 3300009094 | Populus Rhizosphere | VDRRLAQKNIRTALIAGAISLVIFALSFFSGFIYT* |
Ga0105245_125707792 | 3300009098 | Miscanthus Rhizosphere | MDRRLASKNLRTALIAGAICFLVFGAAFFVASVY* |
Ga0066709_1004896172 | 3300009137 | Grasslands Soil | VDRRLAQKNLRTALIAGAICLFVFAAAWIAALVY* |
Ga0075423_127152822 | 3300009162 | Populus Rhizosphere | MDRRLASRNIRTALIAGAISLILFALAFVAAYLY* |
Ga0123328_12080992 | 3300009659 | Anaerobic Biogas Reactor | MDRRLANRNLRTALIAGAISLIVFAASWVVGFVY* |
Ga0126307_100070331 | 3300009789 | Serpentine Soil | MDRRLANKNLRTGLIAGAISLIVFAASFFVGFIY* |
Ga0126307_100253362 | 3300009789 | Serpentine Soil | MDRRLARRNIRTGLIAGAISASLFAASFIAAFLS* |
Ga0126307_103369193 | 3300009789 | Serpentine Soil | MDRRLARRNIRTGLIAGAISASLFAASFLAAFLS* |
Ga0126313_1000000651 | 3300009840 | Serpentine Soil | MDRRLASRNLRTALIASAISLFVFAASWVVGLVY* |
Ga0126313_100416645 | 3300009840 | Serpentine Soil | MDRRLANKNLRTALIAGAIIFIVFAAAFFSGYVY* |
Ga0126313_100964893 | 3300009840 | Serpentine Soil | VDRRLAHKNLRTALIAGAISLIVFAAAWVTGLIY* |
Ga0126313_102528771 | 3300009840 | Serpentine Soil | MDRRLARRNVRTGLIAGAISASIFAASFVAAFLS* |
Ga0126313_106902883 | 3300009840 | Serpentine Soil | VDRRLAYKNLRTALIAGAISLMVFAAAWVTGLIY* |
Ga0126313_117834072 | 3300009840 | Serpentine Soil | MDRRLANRNLRTALIAGSISLIVFAASWIVGLVY* |
Ga0126315_106873141 | 3300010038 | Serpentine Soil | VDRRLAYKNLRTALIAGAISLIVFAAAWVTGLIY* |
Ga0126309_1000122212 | 3300010039 | Serpentine Soil | MDRRLARRNIRTGLIAGAISATVFAASFIAAFLS* |
Ga0126309_100139076 | 3300010039 | Serpentine Soil | VDRRLARKNLRTALIAGAIILIVFAASFFSGYVY* |
Ga0126309_100378623 | 3300010039 | Serpentine Soil | VDRRIALRNLRTGLIAGAISLLVFAAAFVAALVYT* |
Ga0126309_100592543 | 3300010039 | Serpentine Soil | VDRRLAQKNLRTGLIAGAIILVIFAASFFSGYIY* |
Ga0126309_102232232 | 3300010039 | Serpentine Soil | VDRRLAQKNLRTALIAGAISLIVFALSFFTGLVYT* |
Ga0126309_107886703 | 3300010039 | Serpentine Soil | VDRRLAEKNLRTGLIAGAIILVVFAAAFFSGYVY* |
Ga0126308_100518251 | 3300010040 | Serpentine Soil | MDRRLARRNIRTGLIAGAISVSLFAASFIAAFLS* |
Ga0126308_101048033 | 3300010040 | Serpentine Soil | MDRRLAQKNLRTALIAGAISLIVFALSFFTGLVYT* |
Ga0126308_107116302 | 3300010040 | Serpentine Soil | VDRRLAQKNLRTALIARAVCFFVFAAAWVASVVY* |
Ga0126312_103588112 | 3300010041 | Serpentine Soil | VDRRLAQKNLRTALIAGAIILIIFAASFFSGYVY* |
Ga0126312_105656952 | 3300010041 | Serpentine Soil | VDRRLAYKNLRTGLIAGAIILVIFAAAFFSGYVY* |
Ga0126310_102223173 | 3300010044 | Serpentine Soil | VDRRLAQKNLRTALIAGAVAVFVLAAAFVAAAVY* |
Ga0126310_115628481 | 3300010044 | Serpentine Soil | MDRRLAQKNLRTALIAGLVCLLMFAAAFITGIVY* |
Ga0126310_118789572 | 3300010044 | Serpentine Soil | MDRRLAQKNIRTALIAGAISFIVFGAAFIAASVY* |
Ga0126311_108080082 | 3300010045 | Serpentine Soil | VDRRLANKNLRTALIAGAVCVVVFAAAFLAASVY* |
Ga0126311_112595591 | 3300010045 | Serpentine Soil | MDRRLAQKNIRTALIAGAISLVIFALSFFAGLVY* |
Ga0134127_112637931 | 3300010399 | Terrestrial Soil | VDRRHAVKNIRTALIAGAISLIIFALSFVAGITY* |
Ga0134127_114258832 | 3300010399 | Terrestrial Soil | MDRRLAQKNIRTALIAGAIWLIVFALSFFTGLIYT* |
Ga0134122_116122232 | 3300010400 | Terrestrial Soil | VDRRLAQKNIRTALIAGAISLVIFALSFVSGFLYT* |
Ga0136627_100014526 | 3300012042 | Polar Desert Sand | VDRRLANRNLRTALIAGLICLMVFAASFGVAFVY* |
Ga0136627_10004507 | 3300012042 | Polar Desert Sand | MDRRLANRNLRTALIAGAISMIVFAASFVAGLVY* |
Ga0136627_10132034 | 3300012042 | Polar Desert Sand | MDRRLALSNIRTGLIAGAVALLVLAASFIAAVLY* |
Ga0136627_10588364 | 3300012042 | Polar Desert Sand | VWQNAARMDRRLAERNIRTALIAGAIALLVFAASFVAGFVY* |
Ga0136627_11034492 | 3300012042 | Polar Desert Sand | VDRRLANRNLRTALIAGLIALIVFAASFGVALVY* |
Ga0136627_11618362 | 3300012042 | Polar Desert Sand | MDRRLAMKNLRTALIATAVSLFVFAGAFFSALVY* |
Ga0136631_100117535 | 3300012043 | Polar Desert Sand | MDRRLANKNVRTGLIAGAVSMLVFGLAFLIGFLY* |
Ga0136631_100136206 | 3300012043 | Polar Desert Sand | VDRRLANRNIRTGLIAGALALIVFAASFVVAFVY* |
Ga0136631_100259313 | 3300012043 | Polar Desert Sand | MDRRLALSNIRTGLIAGAVALVVLAASFIAAVLY* |
Ga0136631_100917473 | 3300012043 | Polar Desert Sand | VDRRLAQKNLRTGLIAGAISVVVLSASFFAAFVY* |
Ga0136631_102506562 | 3300012043 | Polar Desert Sand | VDRRLANRNIRTALIAGAICFLVFAASFLVAFVY* |
Ga0136631_103087123 | 3300012043 | Polar Desert Sand | SGKIPPVDRRLANRNLRTALIAGALALAVFAASFAVGLIY* |
Ga0136623_100945002 | 3300012045 | Polar Desert Sand | VDRRLANRNIRTALIAGVIALAVFAASFAVGFIY* |
Ga0136623_102916321 | 3300012045 | Polar Desert Sand | MDRNLANRNLRTALIAGAISMIVFAAAFFTGYIY* |
Ga0136634_102952722 | 3300012046 | Polar Desert Sand | VDRRLANRNIRTALIAGVIALAMFAASFAVGFIY* |
Ga0136625_11125123 | 3300012091 | Polar Desert Sand | VDRYLARKNLRSGLIAGAISLIVFGVSFFTGYIY* |
Ga0136625_11156242 | 3300012091 | Polar Desert Sand | VDRRLANRNLRTALIAGALALAVFAASFAVGLIY* |
Ga0136625_12008802 | 3300012091 | Polar Desert Sand | VDRRLAHRNLRTALIATVLTLLVFAASFVVGLVY* |
Ga0136625_12866962 | 3300012091 | Polar Desert Sand | VDRRLANRNLRTAFIAGALALIVFAASFAVGFVY* |
Ga0136625_12983812 | 3300012091 | Polar Desert Sand | MDRRLANRNIRTALIAGTLALLVFAASFAVGFVY* |
Ga0136621_11643523 | 3300012092 | Polar Desert Sand | VDRYLARKNLRTGLIAGAISLIIFGVSFFTGYIY* |
Ga0136621_12497982 | 3300012092 | Polar Desert Sand | VDRRLANRNLRTALIAGLICLIVFAASFGVAFVY* |
Ga0136632_100335622 | 3300012093 | Polar Desert Sand | VDRYLARKNLRTGLIAGAISLIVFGVSFFTGYIY* |
Ga0136632_101118832 | 3300012093 | Polar Desert Sand | VDRRLANRNLRTALIAGAISLIVFAASFFTGFIY* |
Ga0136632_103029872 | 3300012093 | Polar Desert Sand | MLVDRRLANRNIRTALIAGVIALAVFAASFAVAFIY* |
Ga0136624_11791142 | 3300012183 | Polar Desert Sand | VDRRLANRNLRTALIAGTIALIVFALSFFVGFIY* |
Ga0136620_100517174 | 3300012186 | Polar Desert Sand | MDRRLASRNLRTAFIAGAIAMIVFAASFVAGLVY* |
Ga0136620_101827662 | 3300012186 | Polar Desert Sand | MDRRLAQKNVRTGLIAGAISTLIFGLAFFAGYIY* |
Ga0136620_101980433 | 3300012186 | Polar Desert Sand | MDRRLATKNVRTGLIAGAISLIVFGASFFVGFIY* |
Ga0136620_102704592 | 3300012186 | Polar Desert Sand | MDRRLATRNLRTGLIAGAISLVVFGAAFFVASVY* |
Ga0136622_100411653 | 3300012187 | Polar Desert Sand | VDRRLANRNLRTALIAGLICMIVFAASFAVAFVY* |
Ga0136622_100440064 | 3300012187 | Polar Desert Sand | MRRVDRRLAQKNLRTALIAGAVSMIAFGAAFFAAFVY* |
Ga0136622_100591932 | 3300012187 | Polar Desert Sand | VDRRLANRNLRTALIAGALALAVFAASFVVGLIY* |
Ga0136622_100934053 | 3300012187 | Polar Desert Sand | VDRNLAYRNLRTALIAGTISLIVFALAFVTGLVY* |
Ga0136622_101521612 | 3300012187 | Polar Desert Sand | MDRRLANKNVRTGLIAGAISLIVFGASFFVGFIY* |
Ga0136622_101815002 | 3300012187 | Polar Desert Sand | VDRRLANRNLRTALIAGLLCLIVFAASFGVAFVY* |
Ga0136622_103017232 | 3300012187 | Polar Desert Sand | MDRRLAQKNVRTGLIASAISTLVFAAAFFAGYVY* |
Ga0136622_103846252 | 3300012187 | Polar Desert Sand | MDRHLATKNVRTGLIAGAISLIVFGASFFVGFIY* |
Ga0136618_103106552 | 3300012188 | Polar Desert Sand | MDRRLANRNLRTALIAGAIAMIVFAASFVAGFVY* |
Ga0136618_105208312 | 3300012188 | Polar Desert Sand | VDRRLANKNVRTGLIAGAISLIVFGASFFVGFIY* |
Ga0137382_108006202 | 3300012200 | Vadose Zone Soil | VDRRLAQKNLRTAFIAGAICLFVFAAAWVAGFVY* |
Ga0150985_1087516143 | 3300012212 | Avena Fatua Rhizosphere | CRAVDRQLAQKNLRTALIAGLVCLFVFAAAFLAAFVY* |
Ga0150985_1225736323 | 3300012212 | Avena Fatua Rhizosphere | DVCSSDLLAVKNLRTGLIAGAISLLIFAAAFFTAIVY* |
Ga0137370_108530261 | 3300012285 | Vadose Zone Soil | MDRRLANRNIRTALIAGAISLTIFALAFLAAYLY* |
Ga0137372_105757463 | 3300012350 | Vadose Zone Soil | MDRRLANRNIRTALIAGAVSLIIFAAAFLAGYLY* |
Ga0150984_1053471773 | 3300012469 | Avena Fatua Rhizosphere | VDRQLAQKNLRTALIAGLVCLFVFAAAFLAAFVY* |
Ga0136637_11447041 | 3300012526 | Polar Desert Sand | MDRRLAMRNIRTGLIAGAVSLTVLAASFVAAFVY* |
Ga0136640_100468012 | 3300012531 | Polar Desert Sand | VDRRLANRNLRTALIAGLICLLVFAASFGVAFVY* |
Ga0136640_103473062 | 3300012531 | Polar Desert Sand | MDRRLASRNLRTALVAGAVALIVFAASFVVGLVY* |
Ga0136615_1000124310 | 3300012678 | Polar Desert Sand | MDRRLALKNVRTGLMAGAISLLVFAAAFVAALVYS* |
Ga0136615_100079124 | 3300012678 | Polar Desert Sand | MDRKLANRNMRTALIAGAISLLVFAASFGVGYVY* |
Ga0136615_102972782 | 3300012678 | Polar Desert Sand | VDRRLAQKNLRTGLLCTAVSVLAFGLSFLAALVYG |
Ga0136616_100715562 | 3300012679 | Polar Desert Sand | MDRRLALKNVRTGLIAGTVALVILAASFIAAFVY* |
Ga0136612_101366522 | 3300012680 | Polar Desert Sand | VDRRLASRNLRTALICAVVSVLVFAAAFFAGSVY* |
Ga0136612_106167152 | 3300012680 | Polar Desert Sand | MDRRLAMRNIRTGLIAGMVSLSILAASFIAAFVY* |
Ga0136612_106260511 | 3300012680 | Polar Desert Sand | MDRRLATRNLRTGLIAGAISLVVFASAFFIAAIY* |
Ga0157285_101700642 | 3300012897 | Soil | MDRRLAQKNIRTALIAGAISLIIFALSFVAGLTYT* |
Ga0164241_100174444 | 3300012943 | Soil | MDRRLANRNLRTALIAGAISLIVFAASWAVGLVY* |
Ga0169967_10049083 | 3300013011 | Rock | VDRRLANRNLRTALIAGAICLLVFAASFVVAFVY* |
Ga0169969_10918561 | 3300013013 | Rock | VDRRLAQRNIRTALIAGAISLVVFALSFVVGFVY* |
Ga0170682_10576302 | 3300013024 | Rock | MDRRLANRNIRTALLAGAICFLVFAAAFLVAFVY* |
Ga0170681_10004904 | 3300013026 | Rock | VDRRLANRNLRTALIAGLISLIVFAASFGVAFVY* |
Ga0170681_10296663 | 3300013026 | Rock | VDRRLANKNLRTALIAGAISLIVFAASFLVGFVYG* |
Ga0120158_100394257 | 3300013772 | Permafrost | VDRKLAQKNLRTALVAAAIILVVFAAAFLTGYIY* |
Ga0120149_12465372 | 3300014058 | Permafrost | VDRKLAQKNLRTALVATAIILVVFAAAFLTGYIY* |
Ga0182000_102515442 | 3300014487 | Soil | VDRRLAQKNLRTALIAGAVCCFVFAAAFVAAALY* |
Ga0182001_101027742 | 3300014488 | Soil | MDRRLANKNLRTGLIAGAISLIFFGAAFLVAGAY* |
Ga0182001_102203841 | 3300014488 | Soil | VDRRLAQKNLRTALIAGVVCFLVFAAAWIAALVY* |
Ga0182001_102633832 | 3300014488 | Soil | VDRRLAQKNLRTAFIAGAICLLVFAAAWVAAFVY* |
Ga0182001_104298192 | 3300014488 | Soil | VDRRLAQKNLRTAFIAGAICLLVFAGAWVAAFVY* |
Ga0182001_104838232 | 3300014488 | Soil | MDRRLAARNLRTGLIAGAISFLVFGAAFFVASVY* |
Ga0182001_105053962 | 3300014488 | Soil | MDRRLALKNVRTGLIAGAISVLVLAASFVAAFLY* |
Ga0182001_106233452 | 3300014488 | Soil | VDRRLAQKNLRTALIAGAICLFVFAAAWLAAFVY* |
Ga0120193_100214582 | 3300014965 | Terrestrial | MDRRLANKNIRTGLIAGAVSLIVFGAAFMAGYLY* |
Ga0167641_1226852 | 3300015064 | Glacier Forefield Soil | VDRRLANRNLRTALVAGTIIFVVFALSFLVGLIY* |
Ga0167628_10459082 | 3300015165 | Glacier Forefield Soil | VDRQLARRNLRTALIASVIALTVFAASFVVAFVY* |
Ga0167629_10082592 | 3300015209 | Glacier Forefield Soil | VDRHLANRNLRTALIAGTIALVVFALSFLVGFIY* |
Ga0134072_101839672 | 3300015357 | Grasslands Soil | VDRRLAQKNLRTAFIAGAICLLVFAAAWVAGFVY* |
Ga0132257_1018287233 | 3300015373 | Arabidopsis Rhizosphere | SAPMDRRLAQKNIRTALIAGAISLIVFALSFFTALIYT* |
Ga0134083_104820521 | 3300017659 | Grasslands Soil | PVDRRLAQKNLRTALIAGAIIFLVFAAAFFAGYVY |
Ga0190266_102870371 | 3300017965 | Soil | VDRRLAQKNIRTALIAGAISLIIFALSFLTGLVYT |
Ga0190265_105404893 | 3300018422 | Soil | VDRRLAQKNIRTALIAGAISLIIFALSFFTGLVYT |
Ga0190265_105699512 | 3300018422 | Soil | MDRRLAHKNLRTALIAGAISLIVFALSFFAGLVYT |
Ga0190265_105781622 | 3300018422 | Soil | MDRRLAQKNLRTALIAGAISLVIFALSFFAGLVYT |
Ga0190275_1000012566 | 3300018432 | Soil | MDRRLALKNMRTALIAGAISLIVFAASFVAGLVYS |
Ga0190275_113651723 | 3300018432 | Soil | MDRRLAQKNIRTALIAGAISLIIFALSFVAGLVYT |
Ga0190275_121490163 | 3300018432 | Soil | VVVDRKLARRNLRTALIASVIALTVFAASWVVAFVY |
Ga0190270_103070751 | 3300018469 | Soil | KRRVDRRLANRNLRTGFIAGALIMIVFAASFVVGFVY |
Ga0190270_104477292 | 3300018469 | Soil | VDRRLAQKNIRTALIAGAISLIIFALSFVAGLVYT |
Ga0190270_105950393 | 3300018469 | Soil | ESGTNAAVDRRLANRNLRTALIAGAIILIVFAASFGVGLIY |
Ga0190270_111677943 | 3300018469 | Soil | VDRRLAQKNIRTALIAGAISLIVFALSFFSGLIYT |
Ga0190264_122704171 | 3300019377 | Soil | FVDSAFVDRRLAQKNIRTALIAGLVALFVFAAAWVAAAVY |
Ga0206356_108106012 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MDRRLANRNIRTALIAGAISLIIFALSFVAAYLYS |
Ga0222622_112483322 | 3300022756 | Groundwater Sediment | VDRRLANKNIRTALIAGAISLVIFALSFFSGFIYT |
Ga0207662_111547111 | 3300025918 | Switchgrass Rhizosphere | MDRRLANKNIRTALIAGAISLIIFALSFVAGLTYS |
Ga0207667_103360852 | 3300025949 | Corn Rhizosphere | MDRRLANRNIRTALIAGAISLIIFALSFVAAYRYS |
Ga0207702_101425476 | 3300026078 | Corn Rhizosphere | GARMDRRLANRNIRTALIAGAISLIIFALSFVAAYLYS |
Ga0307315_100250335 | 3300028721 | Soil | TKRDVDRRLANKNIRTALIAGAISLVIFALSFFSGFIYT |
Ga0299907_100085257 | 3300030006 | Soil | VDRRLASKNLRTALIAGSIALLVFALSFFAGLVYS |
Ga0299907_106450072 | 3300030006 | Soil | MDRRLAQKNLRTALIAGAISLIIFALSFFTGLVYT |
Ga0299907_106800852 | 3300030006 | Soil | MDRRLATKNLRTALIAGAIALIIFALSFFAGLVYS |
Ga0299914_100552245 | 3300031228 | Soil | MDRRLAHKNIRTALIAGAVSLIVFALSFFAGLVYT |
Ga0299914_102151364 | 3300031228 | Soil | MDRRLAQKNLRTALIAGAISLVIFALSFFTGLVYT |
Ga0299913_103516924 | 3300031229 | Soil | MDRRLAHKNLRTALIAGAISLIIFALSFFAGLVYT |
Ga0299913_115695672 | 3300031229 | Soil | MDRRLAQKNVRTALIAGAISLIIFALSFFAGLVYS |
Ga0307405_100104423 | 3300031731 | Rhizosphere | MDRRLAHKNIRTALIAGAISLIVFALSFFAGLTYT |
Ga0334936_001566_6637_6744 | 3300034007 | Biocrust | MDRQLANKNLRTGLIAGAISLIFFGASFLVAATYA |
Ga0334936_004946_1935_2042 | 3300034007 | Biocrust | MDRRLANKNLRTGLIAGAISLIFFGASFLVAATYA |
⦗Top⦘ |