Basic Information | |
---|---|
Family ID | F037349 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 168 |
Average Sequence Length | 40 residues |
Representative Sequence | MIDPPQVLSEEPTAVTPHGGICGGESQQWLSYPTNPHVR |
Number of Associated Samples | 148 |
Number of Associated Scaffolds | 168 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 94.64 % |
% of genes near scaffold ends (potentially truncated) | 89.88 % |
% of genes from short scaffolds (< 2000 bps) | 80.36 % |
Associated GOLD sequencing projects | 145 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.14 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (92.857 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (22.024 % of family members) |
Environment Ontology (ENVO) | Unclassified (23.810 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.048 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.14 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 168 Family Scaffolds |
---|---|---|
PF00078 | RVT_1 | 61.31 |
PF08388 | GIIM | 2.38 |
PF01609 | DDE_Tnp_1 | 1.19 |
PF00872 | Transposase_mut | 1.19 |
PF13408 | Zn_ribbon_recom | 0.60 |
PF10098 | DUF2336 | 0.60 |
PF00239 | Resolvase | 0.60 |
PF13701 | DDE_Tnp_1_4 | 0.60 |
PF07508 | Recombinase | 0.60 |
PF13561 | adh_short_C2 | 0.60 |
PF13557 | Phenol_MetA_deg | 0.60 |
PF06745 | ATPase | 0.60 |
COG ID | Name | Functional Category | % Frequency in 168 Family Scaffolds |
---|---|---|---|
COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 1.19 |
COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 1.19 |
COG3293 | Transposase | Mobilome: prophages, transposons [X] | 1.19 |
COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 1.19 |
COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 1.19 |
COG5421 | Transposase | Mobilome: prophages, transposons [X] | 1.19 |
COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 1.19 |
COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 1.19 |
COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.60 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 92.86 % |
Unclassified | root | N/A | 7.14 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000518|MB_CA_OM3_M2DRAFT_100487 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
3300000734|JGI12535J11911_1016094 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300001205|C688J13580_1001073 | All Organisms → cellular organisms → Bacteria | 2048 | Open in IMG/M |
3300001205|C688J13580_1033769 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
3300001305|C688J14111_10073090 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
3300001593|JGI12635J15846_10056093 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2976 | Open in IMG/M |
3300001661|JGI12053J15887_10071471 | All Organisms → cellular organisms → Bacteria | 1921 | Open in IMG/M |
3300001867|JGI12627J18819_10126771 | All Organisms → cellular organisms → Bacteria | 1047 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100622416 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
3300002568|C688J35102_119071813 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300002914|JGI25617J43924_10030641 | All Organisms → cellular organisms → Bacteria | 1912 | Open in IMG/M |
3300003577|Ga0007416J51690_1132297 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300004016|Ga0058689_10081496 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
3300005355|Ga0070671_101260346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 651 | Open in IMG/M |
3300005456|Ga0070678_100081344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 2455 | Open in IMG/M |
3300005568|Ga0066703_10090982 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1780 | Open in IMG/M |
3300005578|Ga0068854_100823698 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
3300005602|Ga0070762_10291297 | All Organisms → cellular organisms → Bacteria | 1026 | Open in IMG/M |
3300005614|Ga0068856_100216115 | All Organisms → cellular organisms → Bacteria | 1932 | Open in IMG/M |
3300005618|Ga0068864_102258463 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300006046|Ga0066652_100437963 | All Organisms → cellular organisms → Bacteria | 1200 | Open in IMG/M |
3300006057|Ga0075026_100229721 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
3300006102|Ga0075015_100807166 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300006174|Ga0075014_100719049 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300006969|Ga0075419_10150138 | Not Available | 1524 | Open in IMG/M |
3300007258|Ga0099793_10147223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium plurifarium | 1114 | Open in IMG/M |
3300009089|Ga0099828_10138341 | All Organisms → cellular organisms → Bacteria | 2142 | Open in IMG/M |
3300009094|Ga0111539_11571906 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
3300009098|Ga0105245_11774648 | Not Available | 670 | Open in IMG/M |
3300009101|Ga0105247_10104945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1811 | Open in IMG/M |
3300009101|Ga0105247_10540857 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
3300009698|Ga0116216_10054100 | Not Available | 2475 | Open in IMG/M |
3300010045|Ga0126311_11846900 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300010046|Ga0126384_10125850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1936 | Open in IMG/M |
3300010329|Ga0134111_10006586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3581 | Open in IMG/M |
3300010341|Ga0074045_10583103 | Not Available | 714 | Open in IMG/M |
3300010341|Ga0074045_10797283 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300010358|Ga0126370_12582641 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300010398|Ga0126383_12241441 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
3300010403|Ga0134123_10909140 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
3300010403|Ga0134123_13225862 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300010880|Ga0126350_10406908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 831 | Open in IMG/M |
3300011270|Ga0137391_10503758 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
3300011271|Ga0137393_10252199 | All Organisms → cellular organisms → Bacteria | 1498 | Open in IMG/M |
3300011444|Ga0137463_1361363 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300012096|Ga0137389_10260241 | All Organisms → cellular organisms → Bacteria | 1460 | Open in IMG/M |
3300012203|Ga0137399_10442868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1086 | Open in IMG/M |
3300012362|Ga0137361_10179721 | All Organisms → cellular organisms → Bacteria | 1907 | Open in IMG/M |
3300012362|Ga0137361_11655041 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300012363|Ga0137390_10208770 | All Organisms → cellular organisms → Bacteria | 1940 | Open in IMG/M |
3300012683|Ga0137398_10439222 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
3300012925|Ga0137419_10434224 | Not Available | 1032 | Open in IMG/M |
3300012927|Ga0137416_10899269 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
3300012929|Ga0137404_11991453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium → Sinorhizobium fredii group → Sinorhizobium fredii → Sinorhizobium fredii USDA 257 | 542 | Open in IMG/M |
3300012930|Ga0137407_10205850 | Not Available | 1767 | Open in IMG/M |
3300012958|Ga0164299_10433030 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
3300013296|Ga0157374_11719218 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
3300014056|Ga0120125_1001935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4236 | Open in IMG/M |
3300014153|Ga0181527_1055819 | All Organisms → cellular organisms → Bacteria | 2081 | Open in IMG/M |
3300014157|Ga0134078_10046983 | All Organisms → cellular organisms → Bacteria | 1480 | Open in IMG/M |
3300014165|Ga0181523_10365774 | Not Available | 807 | Open in IMG/M |
3300015241|Ga0137418_10058764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3524 | Open in IMG/M |
3300015357|Ga0134072_10070208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS113 | 1018 | Open in IMG/M |
3300015372|Ga0132256_100190540 | All Organisms → cellular organisms → Bacteria | 2091 | Open in IMG/M |
3300015373|Ga0132257_100363436 | All Organisms → cellular organisms → Bacteria | 1752 | Open in IMG/M |
3300016270|Ga0182036_10757349 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
3300016341|Ga0182035_10195728 | All Organisms → cellular organisms → Bacteria | 1595 | Open in IMG/M |
3300017943|Ga0187819_10106184 | All Organisms → cellular organisms → Bacteria | 1677 | Open in IMG/M |
3300017975|Ga0187782_10862836 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
3300017993|Ga0187823_10313150 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300018007|Ga0187805_10015189 | All Organisms → cellular organisms → Bacteria | 3293 | Open in IMG/M |
3300018009|Ga0187884_10383255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
3300018432|Ga0190275_12356759 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
3300018433|Ga0066667_10012952 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4118 | Open in IMG/M |
3300018465|Ga0190269_10229637 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
3300019182|Ga0184598_132735 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
3300019185|Ga0184587_128676 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300019767|Ga0190267_10078955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS113 | 1237 | Open in IMG/M |
3300019889|Ga0193743_1079936 | All Organisms → cellular organisms → Bacteria | 1289 | Open in IMG/M |
3300020580|Ga0210403_10059348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3063 | Open in IMG/M |
3300021086|Ga0179596_10017430 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2525 | Open in IMG/M |
3300021088|Ga0210404_10007387 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4440 | Open in IMG/M |
3300021403|Ga0210397_10744387 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
3300021405|Ga0210387_10425069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1178 | Open in IMG/M |
3300021420|Ga0210394_10139085 | All Organisms → cellular organisms → Bacteria | 2106 | Open in IMG/M |
3300021432|Ga0210384_10637154 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
3300021432|Ga0210384_11483487 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
3300022724|Ga0242665_10004148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2472 | Open in IMG/M |
3300022724|Ga0242665_10368771 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300024271|Ga0224564_1013487 | All Organisms → cellular organisms → Bacteria | 1413 | Open in IMG/M |
3300025725|Ga0209638_1040069 | All Organisms → cellular organisms → Bacteria | 2003 | Open in IMG/M |
3300025923|Ga0207681_10562558 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
3300025934|Ga0207686_11100789 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300025939|Ga0207665_10725120 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
3300025972|Ga0207668_10115986 | All Organisms → cellular organisms → Bacteria | 2018 | Open in IMG/M |
3300026088|Ga0207641_10241164 | All Organisms → cellular organisms → Bacteria | 1684 | Open in IMG/M |
3300026095|Ga0207676_10033994 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3857 | Open in IMG/M |
3300026295|Ga0209234_1031966 | All Organisms → cellular organisms → Bacteria | 2000 | Open in IMG/M |
3300026354|Ga0257180_1011846 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
3300026371|Ga0257179_1019061 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
3300026469|Ga0257169_1083339 | Not Available | 524 | Open in IMG/M |
3300026480|Ga0257177_1070360 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300026482|Ga0257172_1032187 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
3300026514|Ga0257168_1098435 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
3300026524|Ga0209690_1117241 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
3300026524|Ga0209690_1124947 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
3300026555|Ga0179593_1046806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3480 | Open in IMG/M |
3300027043|Ga0207800_1052467 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300027061|Ga0209729_1028223 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
3300027388|Ga0208995_1000762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4838 | Open in IMG/M |
3300027537|Ga0209419_1000475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4078 | Open in IMG/M |
3300027603|Ga0209331_1072752 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
3300027674|Ga0209118_1029523 | All Organisms → cellular organisms → Bacteria | 1690 | Open in IMG/M |
3300027698|Ga0209446_1010319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2291 | Open in IMG/M |
3300027698|Ga0209446_1091915 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
3300027701|Ga0209447_10220804 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300027729|Ga0209248_10009586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3050 | Open in IMG/M |
3300027729|Ga0209248_10017677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2231 | Open in IMG/M |
3300027894|Ga0209068_10237842 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
3300027915|Ga0209069_10520444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 673 | Open in IMG/M |
3300028381|Ga0268264_11066202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS113 | 816 | Open in IMG/M |
3300028381|Ga0268264_11175310 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
3300028719|Ga0307301_10230312 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
3300028881|Ga0307277_10023612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2419 | Open in IMG/M |
3300031421|Ga0308194_10008204 | All Organisms → cellular organisms → Bacteria | 1895 | Open in IMG/M |
3300031546|Ga0318538_10181276 | All Organisms → cellular organisms → Bacteria | 1120 | Open in IMG/M |
3300031590|Ga0307483_1014541 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
3300031640|Ga0318555_10029212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2670 | Open in IMG/M |
3300031668|Ga0318542_10053792 | All Organisms → cellular organisms → Bacteria | 1836 | Open in IMG/M |
3300031715|Ga0307476_10101276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2034 | Open in IMG/M |
3300031720|Ga0307469_10681158 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
3300031754|Ga0307475_10468896 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
3300031754|Ga0307475_11273247 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300031769|Ga0318526_10193730 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
3300031769|Ga0318526_10235772 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
3300031777|Ga0318543_10047006 | Not Available | 1749 | Open in IMG/M |
3300031777|Ga0318543_10195433 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
3300031793|Ga0318548_10039350 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2115 | Open in IMG/M |
3300031793|Ga0318548_10173725 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
3300031805|Ga0318497_10175998 | All Organisms → cellular organisms → Bacteria | 1178 | Open in IMG/M |
3300031823|Ga0307478_10176913 | All Organisms → cellular organisms → Bacteria | 1706 | Open in IMG/M |
3300031845|Ga0318511_10117556 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
3300031859|Ga0318527_10030736 | Not Available | 1993 | Open in IMG/M |
3300031945|Ga0310913_10061629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2471 | Open in IMG/M |
3300031954|Ga0306926_10678307 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1252 | Open in IMG/M |
3300031954|Ga0306926_10826871 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
3300031954|Ga0306926_11431655 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
3300031962|Ga0307479_10428305 | All Organisms → cellular organisms → Bacteria | 1307 | Open in IMG/M |
3300031981|Ga0318531_10126931 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
3300032004|Ga0307414_12188736 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300032005|Ga0307411_10707079 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
3300032025|Ga0318507_10031346 | All Organisms → cellular organisms → Bacteria | 1986 | Open in IMG/M |
3300032025|Ga0318507_10418935 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
3300032039|Ga0318559_10205310 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
3300032044|Ga0318558_10247195 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
3300032051|Ga0318532_10038286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS113 | 1622 | Open in IMG/M |
3300032055|Ga0318575_10485104 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
3300032060|Ga0318505_10042400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1918 | Open in IMG/M |
3300032076|Ga0306924_11230528 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
3300032076|Ga0306924_11909995 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300032089|Ga0318525_10642808 | Not Available | 540 | Open in IMG/M |
3300032121|Ga0316040_101837 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
3300032770|Ga0335085_11800179 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
3300032892|Ga0335081_10996879 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
3300033402|Ga0326728_10210277 | All Organisms → cellular organisms → Bacteria | 1937 | Open in IMG/M |
3300033402|Ga0326728_10355420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1287 | Open in IMG/M |
3300033755|Ga0371489_0028037 | Not Available | 4268 | Open in IMG/M |
3300034681|Ga0370546_018792 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 22.02% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.12% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.74% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.95% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.17% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.17% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.98% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.98% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.38% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.38% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.79% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.79% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.79% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.79% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.79% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.79% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.19% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.19% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.19% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.19% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.19% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.19% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.19% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.19% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.19% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.19% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.60% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.60% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.60% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.60% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.60% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.60% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.60% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.60% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.60% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.60% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.60% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.60% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.60% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.60% |
Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.60% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.60% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000518 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 | Environmental | Open in IMG/M |
3300000734 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 | Environmental | Open in IMG/M |
3300001205 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
3300004016 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz | Host-Associated | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300014056 | Permafrost microbial communities from Nunavut, Canada - A20_5cm_0M | Environmental | Open in IMG/M |
3300014153 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaG | Environmental | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
3300019182 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZE1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019185 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSE2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
3300019889 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2 | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
3300025725 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-211 (SPAdes) | Environmental | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026354 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-B | Environmental | Open in IMG/M |
3300026371 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-B | Environmental | Open in IMG/M |
3300026469 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B | Environmental | Open in IMG/M |
3300026480 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-B | Environmental | Open in IMG/M |
3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300027043 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 11 (SPAdes) | Environmental | Open in IMG/M |
3300027061 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027388 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027537 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031590 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300032121 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSA3 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
3300033755 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fraction | Environmental | Open in IMG/M |
3300034681 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_121 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
MB_CA_OM3_M2DRAFT_1004872 | 3300000518 | Forest Soil | MINPPQVLPEEPTAVTPHGGFCGGKSQQWLRYPTMPHVRFCAGVLSN |
JGI12535J11911_10160941 | 3300000734 | Tropical Forest Soil | MIDPPQVRPEEPTAVTPHGGIRGGESQQWLSYPTNPHVRFDE |
C688J13580_10010733 | 3300001205 | Soil | MIDPSQVLSEEPTAVTPHGGICGGESQQWLSYPTKPH |
C688J13580_10337691 | 3300001205 | Soil | MIDPSQVLSEEPTAVTPHGGICGGESQQWLSYPTKP |
C688J14111_100730902 | 3300001305 | Soil | MINPPQVRPEEPIAVTPHGGICGGKSQQWLSYPTKPHVRI |
JGI12635J15846_100560932 | 3300001593 | Forest Soil | MINPPPVLPEEPTAVTPHGGFCGGKSQQWLRYPTNLLVRICAGGVQQ* |
JGI12053J15887_100714711 | 3300001661 | Forest Soil | MINPSQVRPEEPTAVTPHGGFCGGKSQQWLRYPTMPH |
JGI12627J18819_101267711 | 3300001867 | Forest Soil | MINPPQVRPEEPTAVTPHGGFCGGKSQQWLRYPTNPHAAFDVEGT |
JGIcombinedJ26739_1006224162 | 3300002245 | Forest Soil | MIDPPQVLSEEPTAVTPHGGFCGGESQQWLSYPTNL |
C688J35102_1190718131 | 3300002568 | Soil | MIDPPQVRPEEPTAVTPHGGIRGGESQQWLSYPTDLHVRLCVQ* |
JGI25617J43924_100306411 | 3300002914 | Grasslands Soil | MINPPQVLPEEPTAVTPHGGFCGGKSQQWLRYPTNPHVRI |
Ga0007416J51690_11322972 | 3300003577 | Avena Fatua Rhizosphere | MIHPPQVRPEEPIAVTPHDGICGGESQQWLSYPTNPHVRFD |
Ga0058689_100814961 | 3300004016 | Agave | MINPPQVRPEEPTAVTPHGGICGGKSQQWLSYPTNLHVRF |
Ga0070671_1012603461 | 3300005355 | Switchgrass Rhizosphere | MINPPQVRPEEPTAVTPHGGICGGKSQQWLRYPTKPHVRFCAGGAQ* |
Ga0070678_1000813441 | 3300005456 | Miscanthus Rhizosphere | MSHPPQVRPEEPIAVTPHDGICGGESQQWLSYPTNPHVRF |
Ga0066703_100909823 | 3300005568 | Soil | MINPPQVRPEEPTAVTPHGGICGGKSQQWLSYPTN |
Ga0068854_1008236981 | 3300005578 | Corn Rhizosphere | MINPPQVRPEEPTAVTPHGGICGGESQQWLSYPTNPHVRFDERG |
Ga0070762_102912971 | 3300005602 | Soil | MIDPPRVLSEEPTAVTPHGGFCGGESQQWLSYPTNL |
Ga0068856_1002161153 | 3300005614 | Corn Rhizosphere | MIHPPQVRPEEPIAVTPHDGICGGESQQWLSYPTNPHVRF |
Ga0068864_1022584632 | 3300005618 | Switchgrass Rhizosphere | MINPPQVRPEEPTAVTPHGGICGGKSQQWLSYPTKPHVRFCAG |
Ga0066652_1004379631 | 3300006046 | Soil | MIDPPQVRPEEPTAVTPHGGICGGESQQWLSYPTNPH |
Ga0075026_1002297212 | 3300006057 | Watersheds | MIDSPRVLSEEPTAVTPHGGICGGESQQWLSYPTNL |
Ga0075015_1008071661 | 3300006102 | Watersheds | MINPPPVLPEEPTAVTPHGGFCGGKSQQWLRYPTN |
Ga0075014_1007190491 | 3300006174 | Watersheds | MSGPPQVLPEEPAAVTPHGGFCGGESQQWLSYPTNPHVRFD |
Ga0075419_101501382 | 3300006969 | Populus Rhizosphere | GLAQMIDPSQVLSEEPTAVTPHGGICGGESQQWLSYPTKRAP* |
Ga0099793_101472233 | 3300007258 | Vadose Zone Soil | MIDPPQVLSEEPTAVTPHGGFCGGESQQWPSYPTNLPV |
Ga0099828_101383411 | 3300009089 | Vadose Zone Soil | MTWVFPDEPDALTGHVRICGGESQQWLIYPTVPHAGICG |
Ga0111539_115719062 | 3300009094 | Populus Rhizosphere | MINPPQVRPEEPIAVTPHGGICGGKSQQWLSYPTKPHV |
Ga0105245_117746482 | 3300009098 | Miscanthus Rhizosphere | MINPSQVLSEEPTAVTPHGGICGGESQQWLSYPTMPHVRICAGVRSNAHSYRNSLLGL |
Ga0105247_101049455 | 3300009101 | Switchgrass Rhizosphere | MINPPQVRPEEPTAVTPHGGICGGKSQQWLSYLTKPHVRFDE |
Ga0105247_105408571 | 3300009101 | Switchgrass Rhizosphere | MIHPPQVRPEEPIAVTPHDGICGGESQQWLSYPTNPHVRFDE |
Ga0116216_100541001 | 3300009698 | Peatlands Soil | MIDPPRVLPEEPTAVTPHGGICGGESQQWLSYPTDPHVR |
Ga0126311_118469001 | 3300010045 | Serpentine Soil | MINPPQVRPEEPTAVTPHGGICGGKSQQWLSYPTKPHVR |
Ga0126384_101258502 | 3300010046 | Tropical Forest Soil | MIDPPQVFSEEPTAVTPHGGFCGGENQQWLSYPTIPEMSRPMLN* |
Ga0134111_100065861 | 3300010329 | Grasslands Soil | MAAMIDPPQVLSEEPTAVTPHGGFCGGESQQWLSYPTNLPVR |
Ga0074045_105831032 | 3300010341 | Bog Forest Soil | MIDPPRVLSEEPTAVTPHGGIRGGESQQWLSYPTE |
Ga0074045_107972832 | 3300010341 | Bog Forest Soil | MIDPPQVLSEEPTAVTPHGGICGGESQQWLSYPTNP |
Ga0126370_125826411 | 3300010358 | Tropical Forest Soil | MIDPPQVLSEEPTAVTPHGGFCGGESQQWPSYPTKPPVRFCAG |
Ga0126383_122414412 | 3300010398 | Tropical Forest Soil | MINPPPVLPEEPTAVTPHGGFCGGKSQQWLRYPTVPHVRFGE |
Ga0134123_109091402 | 3300010403 | Terrestrial Soil | MIDPPQVRPEEPTAVTPHGGICGGESQQWLSYPTNP |
Ga0134123_132258621 | 3300010403 | Terrestrial Soil | MINSPQVLPEEPTAVTPHGGFCGGESQQWLSYPTIPPARIWAGG |
Ga0126350_104069082 | 3300010880 | Boreal Forest Soil | DPPGMAAMIDPPQVLSEEPTAVTPHGGICGGESQQWLSYPTNLPVRLCVQ* |
Ga0137391_105037581 | 3300011270 | Vadose Zone Soil | LAQVINPPQVLPEEPTAVTPHGGFCGGKSQQWLRYPTKPHVFCAGGAQ* |
Ga0137393_102521991 | 3300011271 | Vadose Zone Soil | MINPPQVLPEEPTAVTPHGGFCGGKSQQWLRYPTK |
Ga0137463_13613631 | 3300011444 | Soil | MINPPQVLPEEPTAVTPHGGFCGGESQQWLSYPTNL |
Ga0137389_102602411 | 3300012096 | Vadose Zone Soil | MINPHQVLPEEPTAVTPHGGFCGGKSQQWLRYPTKSACP |
Ga0137399_104428683 | 3300012203 | Vadose Zone Soil | MINPPQVLPEEPTAVTPHGGFCGGKSQQWLRYPTMPH |
Ga0137361_101797212 | 3300012362 | Vadose Zone Soil | MINPHQVLPEEPTAVTPHGGFCGGKSQQWLRYPTD |
Ga0137361_116550412 | 3300012362 | Vadose Zone Soil | MIDPPQVLSEEPTAVTPHGGLCGGKSQQWLRYPTKPHVRFC |
Ga0137390_102087701 | 3300012363 | Vadose Zone Soil | MIDLPQVRPEEPTAVTPHGGFCGGKSQQWLRYPTNPLVRICAGGVR |
Ga0137398_104392222 | 3300012683 | Vadose Zone Soil | MINPPQVLPEEPTAVTPHGGFCGGKSQQWLRYPTNP |
Ga0137419_104342242 | 3300012925 | Vadose Zone Soil | RVNEAARIDPPQVLSEEPTAVTPHGGICGGESQQWLSYPTNPPVRLCVQ* |
Ga0137416_108992691 | 3300012927 | Vadose Zone Soil | MIDPPQVRPEEPTAVTPHGGIRGGKSQQWLSYPTH |
Ga0137404_119914531 | 3300012929 | Vadose Zone Soil | PHQVLPEEPTAVTPHGGFCGGKSQQWLRYPTDLHVRFDEGCALQAR* |
Ga0137407_102058502 | 3300012930 | Vadose Zone Soil | MINPPQVRSEEPTAVTPHGGFCGGESQQWPSYPTDLHV |
Ga0164299_104330301 | 3300012958 | Soil | MIDPPQVRPEEPTAVTPHGGICGGESQQWLSYQTNLHVRFDER |
Ga0157374_117192181 | 3300013296 | Miscanthus Rhizosphere | MINPPQVRPEEPTAVTPHGGICGGKSQQWLSYPTKPHVRICAG |
Ga0120125_10019353 | 3300014056 | Permafrost | MINPPQVLPEEPTAVTPHGGFCGGKSQQWLRYPTKPHVRFWAGGPG* |
Ga0181527_10558193 | 3300014153 | Bog | MIDPPQVLSEEPTAVTPHGGFCGGESQQWLSYPTKP |
Ga0134078_100469831 | 3300014157 | Grasslands Soil | MIDPPQVRPEEPTALTPHGGICGGESQQWLSYPTKIRGGGRGMRAN |
Ga0181523_103657742 | 3300014165 | Bog | MIDPPRVLSEEPTAVTPHGGICGGESQQWLSYPTCER |
Ga0137418_100587643 | 3300015241 | Vadose Zone Soil | MINPPQVLPEEPTAVTPHGGFCGGKSQQWLRYPTMPHVRFCAGGAQ* |
Ga0134072_100702081 | 3300015357 | Grasslands Soil | MIDPPQVRPEEPTAVTPHGGICGGESQQWLSYPTKLHVRICEG |
Ga0132256_1001905401 | 3300015372 | Arabidopsis Rhizosphere | MIDPPQVRPEEPTAVTPHGGICGGESQQWLSYPTNLHVRFD |
Ga0132257_1003634363 | 3300015373 | Arabidopsis Rhizosphere | MSHPPQVRPEEPIAVTPHDGICGGESQQWLSYPTNPHVRFDE |
Ga0182036_107573492 | 3300016270 | Soil | MIDPPQVFSEEPTAVTPHGGFCGGENQQWLSYPTDLPVRF |
Ga0182035_101957282 | 3300016341 | Soil | MIDPPQVLSEEPTAVTPHGGFCGGKSQQWPSYPTK |
Ga0187819_101061841 | 3300017943 | Freshwater Sediment | MIDPPQVLSEEPTAVTPHGGICGGESQQWLSYPTNPHVR |
Ga0187782_108628361 | 3300017975 | Tropical Peatland | MIDSPQVRPEEPTAVTPHGGIRGGESQQWLSYPTNL |
Ga0187823_103131501 | 3300017993 | Freshwater Sediment | MIDPPRVPSEEPTAVTPHGGICGGESQQWLSYPTNPHVRFDER |
Ga0187805_100151894 | 3300018007 | Freshwater Sediment | MIDPPRVLSEEPTAVTPHGGICGGESQQWLSYPTNLHVRFDE |
Ga0187884_103832551 | 3300018009 | Peatland | MEAMIDPPQVLSEEPTAVTPRGGICGGESQQWLSC |
Ga0190275_123567591 | 3300018432 | Soil | MINPPQVRPEEPTAVTPHGGICGGESQQWLSYPTKPHAGICAGG |
Ga0066667_100129521 | 3300018433 | Grasslands Soil | MIDPPQVLSEEPTAVTPHGGFCGGESQQWLSYPTNLPVRLCVQ |
Ga0190269_102296371 | 3300018465 | Soil | MINPPQVRPEEPTAVTPHGGICGGKSQQWLSYPTKPHAGI |
Ga0184598_1327351 | 3300019182 | Soil | MINPPQVRPEEPTAVTPHGGFCGGKSQQWLRYPTKPHA |
Ga0184587_1286761 | 3300019185 | Soil | MINPPQVLPEEPTAVTPHGGFCGGKSQQWLRYPTKPHA |
Ga0190267_100789553 | 3300019767 | Soil | MIDPSQVLSEEPTAVTPHGGICGGESQQWLSYPTKPHAGICAG |
Ga0193743_10799361 | 3300019889 | Soil | MIDSPQVLSEEPTAVTPHGGFCGGESQQWLSYPTN |
Ga0210403_100593481 | 3300020580 | Soil | MINPPQVLSEEPTAVTPHGGFCGGESQQWLSYPTNLPVRFD |
Ga0179596_100174304 | 3300021086 | Vadose Zone Soil | MINPPQVLPEEPTAVTPHGGFCGGKSQQWLRYPTN |
Ga0210404_100073871 | 3300021088 | Soil | MINPPQVLSEEPTAVTPHGGFCGGESQQWLSYPTNLPVR |
Ga0210397_107443872 | 3300021403 | Soil | MIKPPQVLPEEPTAVTPHGGFCGGKSQQWLRYPTKPHVRFWAGGPG |
Ga0210387_104250691 | 3300021405 | Soil | MINPPQVRPEEPTAVTPHGGFCGGKSQQWLRYPKNPHA |
Ga0210394_101390851 | 3300021420 | Soil | MINPPQVLSEEPTAVTPHGGFCGGESQQWLSYPTNLPVRLCVQRRL |
Ga0210384_106371541 | 3300021432 | Soil | MIDPPQVHPEEPTAVTPHGGIRGGKSQQWLSYPTNPHVACDVEGAG |
Ga0210384_114834872 | 3300021432 | Soil | MIDSPQVLSEEPTAVTPHGGFCGGESQQWLSYPTIPPAR |
Ga0242665_100041483 | 3300022724 | Soil | MINPPQVLPEEPTAVTPHGGFCGGKSQQWLRYPTNLLVRICAGGVR |
Ga0242665_103687711 | 3300022724 | Soil | MIDSPQVLSEEPTAVTPHGRFCGGESQQWLSYPTNLPVR |
Ga0224564_10134872 | 3300024271 | Soil | MINPPQVRPEEPTAVTPHGGFCGGKSQQWLRYPTNPHVRFDE |
Ga0209638_10400691 | 3300025725 | Arctic Peat Soil | MIDPPQVLSEEPTAVTPHGGFCGGESQQWPSYPTNLPVR |
Ga0207681_105625581 | 3300025923 | Switchgrass Rhizosphere | MIHPPQVRPEEPIAVTPHDGICGGESQQWLSYPTCD |
Ga0207686_111007891 | 3300025934 | Miscanthus Rhizosphere | MIDPPQVRPEEPTAVTPHGGICGGESQQWLSYSTNLHVRF |
Ga0207665_107251201 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MINPPQVLPEEPTAVTPHGGFCGGKSQQWLRYPTVPHVRICAG |
Ga0207668_101159861 | 3300025972 | Switchgrass Rhizosphere | MIHPPQVRPEEPIAVTPHDGICGGESQQWLSYPTN |
Ga0207641_102411641 | 3300026088 | Switchgrass Rhizosphere | MINPPQVRPEEPTAVTPHGGICGGKSQQWLRYPTKPHVRICAG |
Ga0207676_100339945 | 3300026095 | Switchgrass Rhizosphere | MINPPQVRPEEPTAVTPHGGICGGKSQQWLSYPTKPHVRF |
Ga0209234_10319662 | 3300026295 | Grasslands Soil | MIDPPQVRPEEPTAVTPHGGIRGGESQQWLSYPTKLHVRICAG |
Ga0257180_10118462 | 3300026354 | Soil | MINPPQVLPEEPTAVTPHGGFCGGKSQQWLRYPTKPH |
Ga0257179_10190612 | 3300026371 | Soil | MINSPQVLSEEPTAVTPHGGFCGGESQQWLSYPTILHAGIWCS |
Ga0257169_10833391 | 3300026469 | Soil | MIDPPQVLSEEPTAVTPHGGICGGESQQWLSYPTNLPVRLCVQ |
Ga0257177_10703602 | 3300026480 | Soil | MINPPQVLPEEPTAVTLHGGFCGGKSQQWLRYPTMPHVRFCAGGAQ |
Ga0257172_10321872 | 3300026482 | Soil | MINPPQVLPEEPTAVTPHGGFCGGKSQQWLRYPTNPHVRFD |
Ga0257168_10984352 | 3300026514 | Soil | MINSPQVLSEEPTAVTPHGGFCGGESQQWLSYPTDLP |
Ga0209690_11172411 | 3300026524 | Soil | MIDPPQVLSEEPTAVTPHGGFCGGESQQWLSYPTNLPVR |
Ga0209690_11249472 | 3300026524 | Soil | AAMIDPPQVLSEEPTAVTPHGGFCGGESQQWLSYPTNLPVRLCVQ |
Ga0179593_10468063 | 3300026555 | Vadose Zone Soil | MINPPQVRPEEPTAVTPHGGFCGGKSQQWLRYPTVPHVRFCAGGAQ |
Ga0207800_10524671 | 3300027043 | Tropical Forest Soil | MIDPPRVLSEEPTAVTPHGGIRGGESQQWLSYPTNPHVRFDER |
Ga0209729_10282232 | 3300027061 | Forest Soil | MINPPQVRPEEPTAVTPHGGFCGGKSQQWLRYPTNPP |
Ga0208995_10007623 | 3300027388 | Forest Soil | MINPPQVLPEEPTAVTPHGGFCGGKSQQWLRYPTMPHVRFCAGGAQ |
Ga0209419_10004751 | 3300027537 | Forest Soil | MINPPPVLPEEPTAVTPHGGFCGGKSQQWLRYPTNLLVRICAGGVQQ |
Ga0209331_10727521 | 3300027603 | Forest Soil | MINPPQVLPEEPTAVTPHGGFCGGKSQQWLRYPTDLHVRLCVQRRLACS |
Ga0209118_10295232 | 3300027674 | Forest Soil | MINPPQVLPEEPTAVTPHGGFCGGKSQQWLRYPTKPHVRFWAGGQG |
Ga0209446_10103191 | 3300027698 | Bog Forest Soil | MIDPPQVRPEEPTAVTPHGGIRGGESQQWLSYPTKPHVWI |
Ga0209446_10919152 | 3300027698 | Bog Forest Soil | MIDPPQVLSEEPTAVTPHGGICGGESQQWLSYPTVLGR |
Ga0209447_102208042 | 3300027701 | Bog Forest Soil | MIDPPQVRPEEPTAVTPHGGIRGGESQQWLSYPTDLHVRFDERC |
Ga0209248_100095865 | 3300027729 | Bog Forest Soil | MINPPPVLPEEPTAVTPHGGFCGGKSQQWLRYPTMPHVRFCAGDAQ |
Ga0209248_100176773 | 3300027729 | Bog Forest Soil | MTDRPQVRPEEPTAVTPHGGIRGGESQRWLSYPTKLHGGIYGGGAG |
Ga0209068_102378421 | 3300027894 | Watersheds | MIDPPQVRPEEPTAVTPHGGICGGESQQWLSYPTAPH |
Ga0209069_105204441 | 3300027915 | Watersheds | MIDPPQVRPEEPTAVTPHGGIRGGESQQWLSYPTNPHAAFDVEG |
Ga0268264_110662021 | 3300028381 | Switchgrass Rhizosphere | MINPPQVRPEEPTAVTPHGGICGGKSQQWLSYPTK |
Ga0268264_111753102 | 3300028381 | Switchgrass Rhizosphere | MIDPPQVRPEEPTAVTPHGGICGGESQQWLSYPTNPHIRFDEG |
Ga0307301_102303121 | 3300028719 | Soil | MIHPPQVRPEEPIAVTPHDGICGGESQQWLSYPTNPHVR |
Ga0307277_100236124 | 3300028881 | Soil | MIDPPQVRPEEPTAVTPHGGIRGGESQQWLSYPTDLHVRF |
Ga0308194_100082042 | 3300031421 | Soil | MIDPPQVRPEEPTAVTPHGGIRGGESQQWLSYPTDLHVRFD |
Ga0318538_101812762 | 3300031546 | Soil | MIDPPQVLSEEPTAVTPHGGFCGGKSQQWPSYPTEPP |
Ga0307483_10145411 | 3300031590 | Hardwood Forest Soil | MINPPQVLPEEPTAVTPHGGICGGKSQQWLRYPTDLHVR |
Ga0318555_100292121 | 3300031640 | Soil | MINPPQVLPEEPTAVTPHGGFCGGKSQQWLRYPTNLHVRF |
Ga0318542_100537922 | 3300031668 | Soil | MIDPPQDRPEEPTAVTPHGGIRGGESQQWLSYPTKPHVRICAGGV |
Ga0307476_101012763 | 3300031715 | Hardwood Forest Soil | MIDPPRVLHEEPTAVTPHGGIRGGESQQWLSYPTNLHVRF |
Ga0307469_106811582 | 3300031720 | Hardwood Forest Soil | MIDPPQGRPEEPIAVTPHGGICGGKSQRWLRYPTDLHVRFD |
Ga0307475_104688962 | 3300031754 | Hardwood Forest Soil | MINPPQVLPEEPTAVTPHGGICGSKSQQWLRYPTN |
Ga0307475_112732471 | 3300031754 | Hardwood Forest Soil | MINPPQVLPEEPTAVTPHGGFCGGKSQQWLRYPTNPHV |
Ga0318526_101937301 | 3300031769 | Soil | MINPPPVLPEEPTAVTPHGGFCGGKSQQWLRYPTNPHVR |
Ga0318526_102357722 | 3300031769 | Soil | MIDPPQVLSEEPTAVTPHGGFCGGKSQQWPSYPTKPHVRICA |
Ga0318543_100470062 | 3300031777 | Soil | MIAPPPVLPEEPAKVTPHGGFRRGKSQQWLRYPIN |
Ga0318543_101954331 | 3300031777 | Soil | MIDPPQDRPEEPTAVTPHGGIRGGESQQWLSYPTNLHVRFG |
Ga0318548_100393504 | 3300031793 | Soil | MINPPQVLPEEPTAVTPHGGFCGGKSQQWLRYPTVRLSAKRYA |
Ga0318548_101737252 | 3300031793 | Soil | MIDPPQVLSEEPTAVTPHGGFCGGKSQQWPSYPTN |
Ga0318497_101759982 | 3300031805 | Soil | MIDPPQDRPEEPTAVTPHGGIRGGESQQWLSYPTCDRRSRYELAS |
Ga0307478_101769133 | 3300031823 | Hardwood Forest Soil | MIDSPQVLSEEPTAVTPHGGFCGGESQQWLSYPTDLPV |
Ga0318511_101175562 | 3300031845 | Soil | MINPPPVLPEEPTAVTPHGGFCGGKSQQWLRYPTNP |
Ga0318527_100307361 | 3300031859 | Soil | MIAPPPVLPEEPAKVTPHGGFRGGKSQQWLRYPINPH |
Ga0310913_100616292 | 3300031945 | Soil | MIDPPQVLSEEPTAVTPHGGFCGGKSQQWPSYPTIPPARIWAGGGEQ |
Ga0306926_106783071 | 3300031954 | Soil | MMIAPPPVLPEEPAAVTPHGGICGGKSRQWLRYLSMP |
Ga0306926_108268711 | 3300031954 | Soil | MIDPPQDRPEEPTAVTPHGGIRGGESQQWLSYPTEPHVR |
Ga0306926_114316551 | 3300031954 | Soil | MINPPQVLPEEPTAVTPHGGFCGGKSQQWLRYPTKPHVRI |
Ga0307479_104283052 | 3300031962 | Hardwood Forest Soil | MINPPQVLPEEPTAVTPHGGICGGKSQQWLRYPTCVRRS |
Ga0318531_101269311 | 3300031981 | Soil | MIDPPQDRPEEPTAVTPHGGIRGGESQQWLSYPTN |
Ga0307414_121887361 | 3300032004 | Rhizosphere | MIDPVLSEEPTAVTPHGGICGGESQQWLSYPTMPHA |
Ga0307411_107070792 | 3300032005 | Rhizosphere | MIDPSQVLSEEPTAVTPHGGICGGESQQWLSYPTKPHAGIC |
Ga0318507_100313462 | 3300032025 | Soil | MIDQPQVLSEEPNAVTPHGGFCGGESQQWLSYPTK |
Ga0318507_104189351 | 3300032025 | Soil | MIALPPVLPEEPAAVTPHGGFRGGKSQQWLRYPIKLHAQF |
Ga0318559_102053102 | 3300032039 | Soil | MIDPPQDRPEEPTAVTPHGGIRGGESQQWLSYPTE |
Ga0318558_102471952 | 3300032044 | Soil | MIDPPQDRPEEPTAVTPHGGIRGGESQQWLSYPTNPHVRF |
Ga0318532_100382863 | 3300032051 | Soil | MIVPPPVLPEEPAAVTPHGGIRGGKSQQWLRYPIN |
Ga0318575_104851042 | 3300032055 | Soil | MINPPQVLPEEPTAVTPHGGFCGGKSQQWLRYPTNLH |
Ga0318505_100424003 | 3300032060 | Soil | MINPPQVLPEEPTAVTPHGGFCGGKSQQWLRYPTNLHV |
Ga0306924_112305282 | 3300032076 | Soil | MIAPPPVLPEEPAAVTPHGGIRGGKSQQWLRYPIN |
Ga0306924_119099951 | 3300032076 | Soil | MINPPQDLPEEPTAVTPHGGICGGKSQQWFRYPTNLHVR |
Ga0318525_106428081 | 3300032089 | Soil | MIDPPQVRPEEPTAVTPHGGICGGKGQQWLSYPTKPHVRI |
Ga0316040_1018371 | 3300032121 | Soil | MINPPQVRPEEPTAVTPHGGFCGGKSQQWLRYPTDPHVRFGGGGSNPIGSPYPF |
Ga0335085_118001792 | 3300032770 | Soil | MIDPPQVLSEEPTAVTPHGGICGGESQQWLSYPTNLHV |
Ga0335081_109968791 | 3300032892 | Soil | MIDPPQVLSEEPTAVTPHGGICGGESQQWLSYPTNPHVRFDE |
Ga0326728_102102772 | 3300033402 | Peat Soil | MIDPPQVLSEEPTAVTPHGGICGGESQQWLSYPTCERK |
Ga0326728_103554201 | 3300033402 | Peat Soil | MIDPPQVLSEEPTAVTPHGGICGGESQQWLSYPTKLHA |
Ga0371489_0028037_3249_3371 | 3300033755 | Peat Soil | MIDPPQVLSEEPTAVTPHGGICGGESQQWLSYPTKLHAGI |
Ga0370546_018792_789_899 | 3300034681 | Soil | MIDPPQVRPEEPTAVTPHGGIRGGESQQWLSYPTEPH |
⦗Top⦘ |