NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F036860

Metagenome / Metatranscriptome Family F036860

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F036860
Family Type Metagenome / Metatranscriptome
Number of Sequences 169
Average Sequence Length 43 residues
Representative Sequence LVEKVREKIEMRRRFDAAAATICGVNLKRFLKEKEDRQV
Number of Associated Samples 156
Number of Associated Scaffolds 169

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 3.55 %
% of genes near scaffold ends (potentially truncated) 91.72 %
% of genes from short scaffolds (< 2000 bps) 92.31 %
Associated GOLD sequencing projects 151
AlphaFold2 3D model prediction Yes
3D model pTM-score0.62

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(13.609 % of family members)
Environment Ontology (ENVO) Unclassified
(21.893 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(49.704 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 55.22%    β-sheet: 0.00%    Coil/Unstructured: 44.78%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.62
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 169 Family Scaffolds
PF01609DDE_Tnp_1 21.89
PF08681DUF1778 1.18
PF02585PIG-L 0.59
PF01627Hpt 0.59
PF03652RuvX 0.59
PF01695IstB_IS21 0.59
PF00296Bac_luciferase 0.59
PF03951Gln-synt_N 0.59
PF13520AA_permease_2 0.59
PF00213OSCP 0.59
PF13517FG-GAP_3 0.59
PF13646HEAT_2 0.59
PF13580SIS_2 0.59

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 169 Family Scaffolds
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 21.89
COG3293TransposaseMobilome: prophages, transposons [X] 21.89
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 21.89
COG5421TransposaseMobilome: prophages, transposons [X] 21.89
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 21.89
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 21.89
COG4453Uncharacterized conserved protein, DUF1778 familyFunction unknown [S] 1.18
COG0174Glutamine synthetaseAmino acid transport and metabolism [E] 0.59
COG0712FoF1-type ATP synthase, delta subunitEnergy production and conversion [C] 0.59
COG0816YqgF/RuvX protein, pre-16S rRNA maturation RNase/Holliday junction resolvase/anti-termination factorTranslation, ribosomal structure and biogenesis [J] 0.59
COG1484DNA replication protein DnaCReplication, recombination and repair [L] 0.59
COG2120N-acetylglucosaminyl deacetylase, LmbE familyCarbohydrate transport and metabolism [G] 0.59
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.59

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908028|beta3_all_NODE_120346_len_833_cov_8_536614All Organisms → cellular organisms → Bacteria883Open in IMG/M
2140918008|ConsensusfromContig109829All Organisms → cellular organisms → Bacteria798Open in IMG/M
2170459017|G14TP7Y01CEKDAAll Organisms → cellular organisms → Bacteria → Acidobacteria683Open in IMG/M
3300001154|JGI12636J13339_1035241All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300001175|JGI12649J13570_1034580All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300002245|JGIcombinedJ26739_100187465All Organisms → cellular organisms → Bacteria1957Open in IMG/M
3300002245|JGIcombinedJ26739_100262629All Organisms → cellular organisms → Bacteria1613Open in IMG/M
3300002549|JGI24130J36418_10082411All Organisms → cellular organisms → Bacteria761Open in IMG/M
3300002914|JGI25617J43924_10289895All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300003996|Ga0055467_10289807All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300004080|Ga0062385_10851865All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300004152|Ga0062386_101636861All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300005177|Ga0066690_10712035All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300005556|Ga0066707_10707536All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300005591|Ga0070761_10177112All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1257Open in IMG/M
3300006028|Ga0070717_11141405All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium709Open in IMG/M
3300006050|Ga0075028_100079819All Organisms → cellular organisms → Bacteria1634Open in IMG/M
3300006052|Ga0075029_100129999All Organisms → cellular organisms → Bacteria1535Open in IMG/M
3300006052|Ga0075029_101291793All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300006057|Ga0075026_100517834All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300006057|Ga0075026_100720453All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300006086|Ga0075019_11164978All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300006102|Ga0075015_100092369All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1507Open in IMG/M
3300006174|Ga0075014_100353133All Organisms → cellular organisms → Bacteria789Open in IMG/M
3300006176|Ga0070765_100099554All Organisms → cellular organisms → Bacteria2508Open in IMG/M
3300006794|Ga0066658_10840699All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300006797|Ga0066659_10792588All Organisms → cellular organisms → Bacteria783Open in IMG/M
3300006800|Ga0066660_10185791All Organisms → cellular organisms → Bacteria1572Open in IMG/M
3300006893|Ga0073928_10628767All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300006950|Ga0075524_10321048All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300007076|Ga0075435_101733146All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300007819|Ga0104322_122331All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1317Open in IMG/M
3300009012|Ga0066710_103794779All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300009038|Ga0099829_10763292All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium803Open in IMG/M
3300009088|Ga0099830_10201042All Organisms → cellular organisms → Bacteria1559Open in IMG/M
3300009088|Ga0099830_11319923All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300009137|Ga0066709_100324279All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2104Open in IMG/M
3300009137|Ga0066709_103238916All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300009157|Ga0105092_10167618All Organisms → cellular organisms → Bacteria1223Open in IMG/M
3300009167|Ga0113563_11537640All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium785Open in IMG/M
3300009520|Ga0116214_1191071All Organisms → cellular organisms → Bacteria769Open in IMG/M
3300009521|Ga0116222_1053652All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1754Open in IMG/M
3300009522|Ga0116218_1359041All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300009524|Ga0116225_1503364All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300009645|Ga0116106_1251052All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300009672|Ga0116215_1081962All Organisms → cellular organisms → Bacteria1449Open in IMG/M
3300009683|Ga0116224_10137330All Organisms → cellular organisms → Bacteria1179Open in IMG/M
3300009700|Ga0116217_10588988All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300010341|Ga0074045_10060149All Organisms → cellular organisms → Bacteria2716Open in IMG/M
3300010343|Ga0074044_10188607All Organisms → cellular organisms → Bacteria1372Open in IMG/M
3300010364|Ga0134066_10166659All Organisms → cellular organisms → Bacteria705Open in IMG/M
3300010400|Ga0134122_10685223All Organisms → cellular organisms → Bacteria961Open in IMG/M
3300011270|Ga0137391_10273690All Organisms → cellular organisms → Bacteria1460Open in IMG/M
3300011996|Ga0120156_1015625All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1495Open in IMG/M
3300012096|Ga0137389_10260767All Organisms → cellular organisms → Bacteria1459Open in IMG/M
3300012096|Ga0137389_10433475All Organisms → cellular organisms → Bacteria1124Open in IMG/M
3300012199|Ga0137383_10572833All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium826Open in IMG/M
3300012200|Ga0137382_10330164All Organisms → cellular organisms → Bacteria1068Open in IMG/M
3300012200|Ga0137382_11322923All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300012202|Ga0137363_10575436All Organisms → cellular organisms → Bacteria950Open in IMG/M
3300012207|Ga0137381_10405913All Organisms → cellular organisms → Bacteria1189Open in IMG/M
3300012349|Ga0137387_11246765All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300012354|Ga0137366_10999368All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300012359|Ga0137385_10973458All Organisms → cellular organisms → Bacteria700Open in IMG/M
3300012360|Ga0137375_10840098All Organisms → cellular organisms → Bacteria735Open in IMG/M
3300012362|Ga0137361_10620635All Organisms → cellular organisms → Bacteria990Open in IMG/M
3300012582|Ga0137358_10548577All Organisms → cellular organisms → Bacteria → Acidobacteria777Open in IMG/M
3300012927|Ga0137416_11692128All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300012927|Ga0137416_11862643All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300012929|Ga0137404_12262449All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium508Open in IMG/M
3300012930|Ga0137407_11944399All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300012975|Ga0134110_10325085All Organisms → cellular organisms → Bacteria → Acidobacteria669Open in IMG/M
3300014159|Ga0181530_10007992All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales9887Open in IMG/M
3300014167|Ga0181528_10374873All Organisms → cellular organisms → Bacteria774Open in IMG/M
3300014270|Ga0075325_1030348All Organisms → cellular organisms → Bacteria1068Open in IMG/M
3300014489|Ga0182018_10093519All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1769Open in IMG/M
3300014490|Ga0182010_10561069All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300014494|Ga0182017_10685178All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300014495|Ga0182015_11055402All Organisms → cellular organisms → Bacteria → Acidobacteria501Open in IMG/M
3300014502|Ga0182021_13734398All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300014657|Ga0181522_10099181All Organisms → cellular organisms → Bacteria1680Open in IMG/M
3300015206|Ga0167644_1136912All Organisms → cellular organisms → Bacteria645Open in IMG/M
3300015245|Ga0137409_10323544All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1350Open in IMG/M
3300015371|Ga0132258_11327066All Organisms → cellular organisms → Bacteria → Acidobacteria1818Open in IMG/M
3300017931|Ga0187877_1366068All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300017961|Ga0187778_10392542All Organisms → cellular organisms → Bacteria909Open in IMG/M
3300018014|Ga0187860_1071227All Organisms → cellular organisms → Bacteria → Acidobacteria1667Open in IMG/M
3300018057|Ga0187858_10032791All Organisms → cellular organisms → Bacteria3893Open in IMG/M
3300018057|Ga0187858_10078232All Organisms → cellular organisms → Bacteria2293Open in IMG/M
3300018060|Ga0187765_10327308All Organisms → cellular organisms → Bacteria926Open in IMG/M
3300018062|Ga0187784_11340322All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300018433|Ga0066667_12017366All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300018468|Ga0066662_12649782All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300019785|Ga0182022_1140752All Organisms → cellular organisms → Bacteria1827Open in IMG/M
3300019789|Ga0137408_1414573All Organisms → cellular organisms → Bacteria1698Open in IMG/M
3300020022|Ga0193733_1150202All Organisms → cellular organisms → Bacteria → Acidobacteria630Open in IMG/M
3300020109|Ga0194112_10686532All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300020201|Ga0163154_10326055All Organisms → cellular organisms → Bacteria727Open in IMG/M
3300020580|Ga0210403_11401307All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300021080|Ga0210382_10344359All Organisms → cellular organisms → Bacteria658Open in IMG/M
3300021181|Ga0210388_10706956All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium877Open in IMG/M
3300021407|Ga0210383_11690946All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300021420|Ga0210394_10226238All Organisms → cellular organisms → Bacteria1635Open in IMG/M
3300021420|Ga0210394_10391931All Organisms → cellular organisms → Bacteria1221Open in IMG/M
3300021420|Ga0210394_10926894All Organisms → cellular organisms → Bacteria757Open in IMG/M
3300021559|Ga0210409_10429470All Organisms → cellular organisms → Bacteria1180Open in IMG/M
3300022524|Ga0224534_1099807All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300022650|Ga0236339_1135883All Organisms → cellular organisms → Bacteria2072Open in IMG/M
3300022650|Ga0236339_1242887All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300022716|Ga0242673_1112364All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300025414|Ga0208935_1039287All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300025427|Ga0208077_1002980All Organisms → cellular organisms → Bacteria2378Open in IMG/M
3300025439|Ga0208323_1047673All Organisms → cellular organisms → Bacteria → Acidobacteria784Open in IMG/M
3300025457|Ga0208850_1026764All Organisms → cellular organisms → Bacteria1007Open in IMG/M
3300025494|Ga0207928_1032689All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1007Open in IMG/M
3300025495|Ga0207932_1023349All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1647Open in IMG/M
3300025498|Ga0208819_1103172All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300025506|Ga0208937_1073917All Organisms → cellular organisms → Bacteria → Acidobacteria776Open in IMG/M
3300025507|Ga0208188_1079519All Organisms → cellular organisms → Bacteria765Open in IMG/M
3300025764|Ga0209539_1332589All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300026333|Ga0209158_1259424All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300026360|Ga0257173_1002675All Organisms → cellular organisms → Bacteria1632Open in IMG/M
3300026492|Ga0256802_1010931All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1011Open in IMG/M
3300026494|Ga0257159_1046826All Organisms → cellular organisms → Bacteria733Open in IMG/M
3300026538|Ga0209056_10196427All Organisms → cellular organisms → Bacteria1482Open in IMG/M
3300026552|Ga0209577_10811704All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300027003|Ga0207722_1013216All Organisms → cellular organisms → Bacteria943Open in IMG/M
3300027014|Ga0207815_1039367All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300027605|Ga0209329_1146920All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300027629|Ga0209422_1069449All Organisms → cellular organisms → Bacteria831Open in IMG/M
3300027698|Ga0209446_1004219All Organisms → cellular organisms → Bacteria3528Open in IMG/M
3300027853|Ga0209274_10440685All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300027855|Ga0209693_10297932All Organisms → cellular organisms → Bacteria786Open in IMG/M
3300027857|Ga0209166_10270062All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium899Open in IMG/M
3300027885|Ga0209450_10568137All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes829Open in IMG/M
3300027894|Ga0209068_10387636All Organisms → cellular organisms → Bacteria795Open in IMG/M
3300027898|Ga0209067_10883563All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300028010|Ga0265358_104563All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300028021|Ga0265352_1006709All Organisms → cellular organisms → Bacteria692Open in IMG/M
3300028748|Ga0302156_10113899All Organisms → cellular organisms → Bacteria1354Open in IMG/M
3300028792|Ga0307504_10284940All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300028866|Ga0302278_10403565All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300029636|Ga0222749_10040610All Organisms → cellular organisms → Bacteria2018Open in IMG/M
3300029911|Ga0311361_10367774All Organisms → cellular organisms → Bacteria1543Open in IMG/M
3300029915|Ga0311358_10154319All Organisms → cellular organisms → Bacteria2186Open in IMG/M
3300029954|Ga0311331_10870692All Organisms → cellular organisms → Bacteria801Open in IMG/M
3300029955|Ga0311342_10703798All Organisms → cellular organisms → Bacteria796Open in IMG/M
3300029994|Ga0302283_1214647All Organisms → cellular organisms → Bacteria708Open in IMG/M
3300030490|Ga0302184_10055368All Organisms → cellular organisms → Bacteria1917Open in IMG/M
3300030509|Ga0302183_10096306All Organisms → cellular organisms → Bacteria1166Open in IMG/M
3300030838|Ga0311335_11085231All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300031344|Ga0265316_10654216All Organisms → cellular organisms → Bacteria743Open in IMG/M
3300031521|Ga0311364_11802095All Organisms → cellular organisms → Bacteria602Open in IMG/M
3300031521|Ga0311364_12176069All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300031754|Ga0307475_11334560All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300031834|Ga0315290_10695390All Organisms → cellular organisms → Bacteria877Open in IMG/M
3300032401|Ga0315275_11383112All Organisms → cellular organisms → Bacteria760Open in IMG/M
3300032456|Ga0335394_11145815All Organisms → cellular organisms → Bacteria → Acidobacteria502Open in IMG/M
3300032805|Ga0335078_10336236All Organisms → cellular organisms → Bacteria2012Open in IMG/M
3300032897|Ga0335071_11478072All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300032898|Ga0335072_10361635All Organisms → cellular organisms → Bacteria1582Open in IMG/M
3300033233|Ga0334722_10168772All Organisms → cellular organisms → Bacteria1632Open in IMG/M
3300033402|Ga0326728_10189238All Organisms → cellular organisms → Bacteria2105Open in IMG/M
3300033405|Ga0326727_10966165All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300033482|Ga0316627_100189039All Organisms → cellular organisms → Bacteria1570Open in IMG/M
3300033487|Ga0316630_11506046All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300033743|Ga0334844_097105All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300033891|Ga0334811_074160All Organisms → cellular organisms → Bacteria889Open in IMG/M
3300033983|Ga0371488_0434912All Organisms → cellular organisms → Bacteria602Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil13.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.51%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds5.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.73%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.14%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil4.14%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland3.55%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.55%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.55%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog3.55%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.96%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.37%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen2.37%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.37%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen2.37%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment1.78%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.78%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.78%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.78%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.78%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.78%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.18%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.18%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil1.18%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil1.18%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa1.18%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.18%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.18%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.18%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.59%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.59%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.59%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.59%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat0.59%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.59%
SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment0.59%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater0.59%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.59%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.59%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.59%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.59%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.59%
Permafrost SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Permafrost Soil0.59%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.59%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.59%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.59%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.59%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.59%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.59%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.59%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908028Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3EnvironmentalOpen in IMG/M
2140918008Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_allEnvironmentalOpen in IMG/M
2170459017Litter degradation ZMR4EngineeredOpen in IMG/M
3300001154Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1EnvironmentalOpen in IMG/M
3300001175Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300002549Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-212EnvironmentalOpen in IMG/M
3300002914Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cmEnvironmentalOpen in IMG/M
3300003996Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2EnvironmentalOpen in IMG/M
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006057Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012EnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300006950Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-oneEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007819Permafrost core soil microbial communities from Svalbard, Norway - sample 2-1-2 SoapdenovoEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009524Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaGEnvironmentalOpen in IMG/M
3300009645Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40EnvironmentalOpen in IMG/M
3300009672Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaGEnvironmentalOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011996Permafrost microbial communities from Nunavut, Canada - A39_65cm_12MEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300014159Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaGEnvironmentalOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300014270Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D1EnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014490Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaGEnvironmentalOpen in IMG/M
3300014494Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300015206Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8B, Adjacent to main proglacial river, end of transect (Watson river))EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300017931Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100EnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300018014Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019785Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300020022Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2EnvironmentalOpen in IMG/M
3300020109Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400mEnvironmentalOpen in IMG/M
3300020201Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP9.P1EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022524Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 20-24EnvironmentalOpen in IMG/M
3300022650Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Winter W3EnvironmentalOpen in IMG/M
3300022716Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025414Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025427Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025439Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025457Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025494Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025495Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025498Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025506Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025507Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025764Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0011-312 (SPAdes)EnvironmentalOpen in IMG/M
3300026333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes)EnvironmentalOpen in IMG/M
3300026360Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-BEnvironmentalOpen in IMG/M
3300026492Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 CS5EnvironmentalOpen in IMG/M
3300026494Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-AEnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027003Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 26 (SPAdes)EnvironmentalOpen in IMG/M
3300027014Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027605Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027629Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027698Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027885Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028010Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6Host-AssociatedOpen in IMG/M
3300028021Soil microbial communities from Maridalen valley, Oslo, Norway - NSE5EnvironmentalOpen in IMG/M
3300028748Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2EnvironmentalOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300028866Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029911III_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029915III_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029954I_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029955II_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029994Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_4EnvironmentalOpen in IMG/M
3300030490Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3EnvironmentalOpen in IMG/M
3300030509Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2EnvironmentalOpen in IMG/M
3300030838I_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300031344Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaGHost-AssociatedOpen in IMG/M
3300031521III_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031834Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0EnvironmentalOpen in IMG/M
3300032401Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0EnvironmentalOpen in IMG/M
3300032456Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-03 (spades assembly)EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033233Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottomEnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300033482Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_CEnvironmentalOpen in IMG/M
3300033487Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_AEnvironmentalOpen in IMG/M
3300033743Peat soil microbial communities from Stordalen Mire, Sweden - 714 E1 5-9EnvironmentalOpen in IMG/M
3300033891Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-1-DEnvironmentalOpen in IMG/M
3300033983Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fractionEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
beta3_all_013014302124908028SoilLVSKVRQQVEMRHRFDAAAATICGINLRRFLKEKENP
Bog_all_C_056461502140918008SoilQISVLVEGKPKTFNVPAKFVEQARQKIDMRHRFDAAAATICGINLRRFLKEKENQ
4ZMR_038887602170459017Switchgrass, Maize And Mischanthus LitterVRQKIEMRRRFDAAAATICKVNLKRFLQEKEDRQV
JGI12636J13339_103524123300001154Forest SoilKVREKIEMRRRFDAAAATICKVNLKRFLQEKEDRQV*
JGI12649J13570_103458013300001175Forest SoilVRKKIEMHRRFEAAAATICGINLKRFLKEKLKPKEERKI*
JGIcombinedJ26739_10018746523300002245Forest SoilVDQVREKIEMRRRFEAAAATICGVNLKRFLKEKLKPKEERPI*
JGIcombinedJ26739_10026262923300002245Forest SoilIPAELVERVRAKIELRHRFDAAAATICSVNLKRFLKEKKEEPSA*
JGI24130J36418_1008241113300002549Arctic Peat SoilHAQYQISVLVDGKPKAFNVPATLVDQVRKQVAMRDRFDAAAATICGINLRRFLKQKEDQ*
JGI25617J43924_1028989523300002914Grasslands SoilAELAEKVREKIEMRRRFDAAAATICGVNLKRFLKEKEKGDRPV*
Ga0055467_1028980723300003996Natural And Restored WetlandsLVEGKPKVFNVPPKMVEQVRQQVAMRHRFDAAAATICGINLRRFLKEKENR*
Ga0062385_1085186513300004080Bog Forest SoilKVREKIEMRRRFEAAAATICGVNLKRFLKEKLKEKEDRQV*
Ga0062386_10163686123300004152Bog Forest SoilGKPKAFHVPAALLKQVRKQVEMRDRFDAAAATIRGINLRRFLKQKEDR*
Ga0066690_1071203513300005177SoilPAELVEKVREKTQMRRRFETAAATICGINLKRFLREKESR*
Ga0066707_1070753613300005556SoilAELVEKVRQKIEMRRRFEAAAATICKVNLKRFLKEKKDRQV*
Ga0070761_1017711213300005591SoilNVPAQWVERVREKIEMHRRFEAAAATICTVNLKRFLKEKLKEKEDRKI*
Ga0070717_1114140513300006028Corn, Switchgrass And Miscanthus RhizosphereRQKIEMRRRFDAAAATICNVNLKRFLQEKEDRQP*
Ga0075028_10007981913300006050WatershedsKPKVFHVPASLVEQVRQQIQMRHRFDAAAATICSINLRRFLKQKDTPQP*
Ga0075029_10012999923300006052WatershedsPKAFNVPARFAEQVRKQVEMRARFDAASAAICSINLRRFLKQKMER*
Ga0075029_10129179313300006052WatershedsWADKVREKTEMRRRFDAAAATICGVNLKRFLKEKEERQS*
Ga0075026_10051783413300006057WatershedsAETVREKIAMRRRFEAAAATICRVNLKRFLKEKEDRQA*
Ga0075026_10072045323300006057WatershedsVERVREKIEMRRRFEAAAATICNVNLKRFLKEKLREKEDREI*
Ga0075019_1116497823300006086WatershedsWAERVREKTEMRRRFDAAAATICSVNLKRFLKQKEDRQA*
Ga0075015_10009236913300006102WatershedsREKIEMRRRFEAAAATICNVNLKRFLKEKLREKEDREI*
Ga0075014_10035313313300006174WatershedsGKPKAFNIPAKLVEQVRQKVEMRRRFDAAAATVCGINLRRFLQEKENQ*
Ga0070765_10009955413300006176SoilLNVPAQWVERVREKIEMHRRFEAAAATICTVNLKRFLKEKLKEKEDRKI*
Ga0066658_1084069913300006794SoilAELAEKVREKIEMRRRFDAAAATICGVNLKRFLKEKEDRQA*
Ga0066659_1079258813300006797SoilAGLADKVRDKIELRRRFDSAAATICRLNLKRFLQEKETR*
Ga0066660_1018579113300006800SoilKVEMRRRFDSAAASICGINLKRFLEDKNKESRQT*
Ga0073928_1062876713300006893Iron-Sulfur Acid SpringKIEMRRRFEAAAATICGVNLKRFLKEKLKEKEDRQV*
Ga0075524_1032104823300006950Arctic Peat SoilHSQFQVSVLVEGKPKTFNIPAKLVSKVRQQVSMRHRFDAAAATICGINLRRFLKEKENQ*
Ga0075435_10173314623300007076Populus RhizosphereNIPAQLAEVVREKIEMRRRFDAAAATICGLNLKRFLKAKEDRQA*
Ga0104322_12233123300007819Permafrost SoilIELRRRFDAAAATICDVNLNRFLKEKEKQKEDRPA*
Ga0066710_10379477913300009012Grasslands SoilTPHIPAALAEKVREKIEMRRRFDSAAATICRLNLKRFLEENKTR
Ga0099829_1076329213300009038Vadose Zone SoilLNIPAALADKVRARIEMRRRFDSAAATICRLNLKRFLKDKETR*
Ga0099830_1020104213300009088Vadose Zone SoilEKIEMRRRFEAAAATICSVNLKRFLKEKLREKEDRPI*
Ga0099830_1131992313300009088Vadose Zone SoilALNIPAELAAKVREKIEMRRRFDSAAATICGLNLKRFLKQKKDRQA*
Ga0066709_10032427913300009137Grasslands SoilTLHIPAALAEKVREKIEMRRRFDSAAATICRLNLKRFLEENKTR*
Ga0066709_10323891613300009137Grasslands SoilTLHIPAALAEKVREKIEMRRRFDSAAATICRLNLKRFLEEKQTR*
Ga0105092_1016761823300009157Freshwater SedimentDQVRRKVEMRRRFDAAAASICGINLKRFLQEKENQ*
Ga0113563_1153764023300009167Freshwater WetlandsEKVRQKIEMRRRFDAAAATICHVNLKRFIKEKEERQV*
Ga0116214_119107113300009520Peatlands SoilELVEMVRQKIEMRRRFDAAAATICKVNLKRFLKEKKDRQV*
Ga0116222_105365213300009521Peatlands SoilWVETVRKKIEMPQRFEAAAATICSVNLKRFLKEKLREKEDRQV*
Ga0116218_135904113300009522Peatlands SoilKKIEMRQRFEAAAATICSVNLKRFLKEKLREKEDRQV*
Ga0116225_150336423300009524Peatlands SoilLVDGKPKAFNVPAKLVEQVRQQVAMRNRFDAAAATICGINLRRFLKKKEGL*
Ga0116106_125105223300009645PeatlandEQVRQRIEMHHRLDAAVATICSINLRRFLKQKEDQ*
Ga0116215_108196213300009672Peatlands SoilKTFNIPAKLVPKVRQQVEMRRRFDAAAATICGINLRRFLKEKENQ*
Ga0116224_1013733023300009683Peatlands SoilLVEGKPKTFNIPARLVEQVRQKVAMRHRFDAAAASICGINLRRFLKEKEQP*
Ga0116217_1058898813300009700Peatlands SoilLAVKVREKIEMRRHFDSAAATICRLNLKRFLKEKETR*
Ga0074045_1006014953300010341Bog Forest SoilVREKIEMRRRFDAAAATICGVNLKRFLKEKEGRQV*
Ga0074044_1018860743300010343Bog Forest SoilVREKIEMRRRFEAAVATICGVNLKRFLKEKEGRQV*
Ga0134066_1016665913300010364Grasslands SoilKVRERIELRRRFDAATTTICGINLKRFLKEKEPR*
Ga0134122_1068522313300010400Terrestrial SoilATMVEQVRRQVAMRHRFDAAAAAVCDINLRRFLEQKENP*
Ga0137391_1027369023300011270Vadose Zone SoilPAALVEKVREKIEMRRRFEAAAATICSVNLKRFLQEKEDLQV*
Ga0120156_101562513300011996PermafrostVEKVRAKIEMRRRFDAAAATICTVNLKRFLREKEDRQP*
Ga0137389_1026076733300012096Vadose Zone SoilREKIEMRRRFEAAAATICSVNLKRFLKEKLREKEDRPI*
Ga0137389_1043347513300012096Vadose Zone SoilAELAEKVREKIEMRRRFDAAAATICRVNLKRFLKAKEKEDRQA*
Ga0137383_1057283323300012199Vadose Zone SoilPAELAAKVRERIEMRRRFDSAAATICGLNLKRFLKEKQDGQA*
Ga0137382_1033016413300012200Vadose Zone SoilQLVAQVREKIEMRRRFDSAATTICGLNLKRFLKEKQDGPV*
Ga0137382_1132292323300012200Vadose Zone SoilRQKIEMRRRFEAAAATICSVNLKRFLKEKLKEKEDRQI*
Ga0137363_1057543613300012202Vadose Zone SoilEMRQRFDAAAAIICAVNLKRFLKEKLKEKEDRQS*
Ga0137381_1040591313300012207Vadose Zone SoilLNIPAELVEKVRQKIAMRRRFDAAAATICKVNLKRFLKEKEDRPV*
Ga0137387_1124676523300012349Vadose Zone SoilLNIPAELADKVREKIEMRRRFDSAAATICHLNLKRFLKERETR*
Ga0137366_1099936813300012354Vadose Zone SoilALNIPAGLAERVREKIEMRRRFDAAAATICRLNLKRFLKEKETR*
Ga0137385_1097345823300012359Vadose Zone SoilAELVEKVRQKIEMRRRFDAAAATICKVNLKRFLKEKKDRQV*
Ga0137375_1084009823300012360Vadose Zone SoilVREKIEMRRRFDAAAASICRINLKRFLKEKEGPQA*
Ga0137361_1062063523300012362Vadose Zone SoilVREKIEMRRRFEAAAATICSVNLKRFLKEKLREKEDRPI*
Ga0137358_1054857723300012582Vadose Zone SoilVRQKIEMRRRFDAAATICKVNLKRFLKEKKDRQV*
Ga0137416_1169212823300012927Vadose Zone SoilREKIEMRRRFDAAAATICAVNLKRFLKEKLKEKEDRQR*
Ga0137416_1186264323300012927Vadose Zone SoilRQKIEMRHRFDNAADTICGVNLKRFIKQKEDPQA*
Ga0137404_1226244923300012929Vadose Zone SoilSLLVDGKPKAFNIPAKLAEEVRQKIDMHHRLDAAVATICSINLRRFLKQKEDQ*
Ga0137407_1194439923300012930Vadose Zone SoilLNIPAEWVDQVREKIAMRRRFEAAAATICKLNLKRFLKEKEDRQV*
Ga0134110_1032508513300012975Grasslands SoilIPAELVEKVREKIAMRRRFDSAAATICGLNLKRFLKEKQDGPV*
Ga0181530_1000799213300014159BogIPAECAGEVREKIEMRRRFDAAALAICNVNLKRFLKEKEDRQA*
Ga0181528_1037487313300014167BogVPAKLVEQVRQQVTMRDRFDAAAATICGINLRRFLKQKEEP*
Ga0075325_103034823300014270Natural And Restored WetlandsKTFNVPAKLVEQVRHKVELRRRFDAAAATVCGINLRRFLKEKENR*
Ga0182018_1009351913300014489PalsaKIEMRRRFEAAAATICSVNLKRFLKEKLREKEDRQI*
Ga0182010_1056106923300014490FenQYQISVFVEGKPKAFNVPAQLVEQTRRKIDMRRRFDAAADTICGINLRRFLKEKETR*
Ga0182017_1068517813300014494FenSVLVEGKPKTFNIPAKLAPRVRQQVEMRRRYDATAATICGINLRRFLKDKENQ*
Ga0182015_1105540223300014495PalsaMLRKQIEMRRRFDSAAATICRLNLKRFLKEKETR*
Ga0182021_1373439813300014502FenIPAKLVPRVRQQVEMRRRFDAAAATICGINLRRFLKDKENQ*
Ga0181522_1009918113300014657BogSQFQISLLVDGKPKTFSIPAKWADQVRQRIQMHHRLDAAVATICSINLRRFLKQKEDQ*
Ga0167644_113691223300015206Glacier Forefield SoilLTEQVREKIEMRRRFDSAAATICRLNLKRFLKEKETL*
Ga0137409_1032354413300015245Vadose Zone SoilPATLVQQVRKQIEMRDRFDAAAATICGINLKRFLKQKEDQ*
Ga0132258_1132706623300015371Arabidopsis RhizosphereAAKVREKIEMRRRFDSAAATICGLNLKRFVKEKQDGRV*
Ga0187877_136606823300017931PeatlandVLVDGKPKVFNIPARLVPRVRQQVEMRRRFDAAAATICGINLRRFLKDKQNP
Ga0187778_1039254213300017961Tropical PeatlandLHSQFQISVLVDGKPKVFHIPAKLVPRVRQQVEMRRRFDAAAATICGINLRRFLKDKENQ
Ga0187860_107122713300018014PeatlandKNLHAQYQISVLVEGKPKAFHVPAQLVPQVRRQVEMRHRLDAAADTICGINLRRFLKEKENR
Ga0187858_1003279153300018057PeatlandKALNIPAELAEKVEEKIEMRRRFDSAAATICRLNLKRFLKEKETR
Ga0187858_1007823233300018057PeatlandVLVDGKPKVFHIPAKLVPRVRQQVEMRRRFDAAAATICGINLRRFLKDKENQ
Ga0187765_1032730823300018060Tropical PeatlandVPRVRQQVEMRRRFDAAAATICGINLRRFLKDKENQ
Ga0187784_1134032223300018062Tropical PeatlandLVDKVREQIELRHRFDAAAATICGINLQRFLQEKGER
Ga0066667_1201736623300018433Grasslands SoilVRQKIEMRRRFDAAAATICKVNLKRFLKEKKDRQV
Ga0066662_1264978223300018468Grasslands SoilAELVEKVRQKIEMRRRFDAAAATICKVNLKRFLKEKKDRQV
Ga0182022_114075233300019785FenMACRKLSNIPAEVAEKVREKIEMRRRFDSAAATICRLNLKRFLKEKKVR
Ga0137408_141457313300019789Vadose Zone SoilMGGPGREKIAMRRRFEAAAATICKLNLKRFLREKEDRQV
Ga0193733_115020223300020022SoilLVEKVREKIEMRRRFDAAAATICGVNLKRFLKEKEDRQV
Ga0194112_1068653213300020109Freshwater LakeVLVEGKPKIFNVPPKMVEQVRQQVAMRHRFDAAAATICGINLRRFLKQC
Ga0163154_1032605523300020201Freshwater Microbial MatIPAELVEKVREKTDMRRRFDDAAAAIRDINLKRLLREKENR
Ga0210403_1140130713300020580SoilKIEMRQRFEAAAATICSVNLKRFLKEKLREKEDRPI
Ga0210382_1034435913300021080Groundwater SedimentAGLAERVREKIEMRRRFDSAAATICRLNLKRFLKEKETR
Ga0210388_1070695623300021181SoilAEKVREKIEMRQRFESAAATICRVNLKRFLKEKETR
Ga0210383_1169094613300021407SoilLVEKVREKIEMRRRFEAAAATICGVNLKRFLKEKLKEKEDRQV
Ga0210394_1022623813300021420SoilAEQVRQKIEMRHRLDAAVATICGINLRRFLKQKEGP
Ga0210394_1039193113300021420SoilPTRWVETVREKIEMRRRFEAAAATICSVNLKRFLKEKLRDKQDRQI
Ga0210394_1092689413300021420SoilPAKWVDKVREKIEMRQRFEAAAATICRVNLKRFLQEKLHEKKKKLQEKEDRQI
Ga0210409_1042947013300021559SoilRVREKIEMRRRFDAAAATICGVNLKRFLKEKEDRQV
Ga0224534_109980713300022524SoilFNIPARLVPKVRQQVEMRRRFDAAAATICGINLRRFLKEKESR
Ga0236339_113588333300022650FreshwaterLVPRVRQQVEMRRRFDAAAATICGINLRRFLKDKENQ
Ga0236339_124288713300022650FreshwaterLVPRVRQQVEMRRRFDAAAATICGINLRRFLKEKENQ
Ga0242673_111236423300022716SoilAELAEKVRAKIEMRHRFDAAAATICSVNLKRFLKEKKEEPSA
Ga0208935_103928723300025414PeatlandPAGLADEVREKIELRRRFDAAAATICDVNLKLFLKEKDERPA
Ga0208077_100298023300025427Arctic Peat SoilVDKVREKIEMRRRFDAAAATICRVNLKRFLKEKEERQV
Ga0208323_104767313300025439PeatlandVREKIEMRRRFEAAAATICGVNLKRFLKEKLKEKEDRQV
Ga0208850_102676413300025457Arctic Peat SoilFQISLLVEGKPKTFNIPAKLLPKVRQQVEMRRRFDAAAATICGINLRRFLKEKENQ
Ga0207928_103268923300025494Arctic Peat SoilDKVREKTEMRRRFDAAAATICGVNLKRFLKEKEERQS
Ga0207932_102334933300025495Arctic Peat SoilVRQKIELRRRFDAAAATICDLNLKRFLKEKEDQPV
Ga0208819_110317213300025498PeatlandVREKIEMRRRFEAAAATICSVNLKRFLKEKLREKEDRQI
Ga0208937_107391733300025506PeatlandAFHVPAQLVPQVRRQVEMRHRLDAAADTICGINLRRFLKEKENR
Ga0208188_107951923300025507PeatlandREKIEMRRRFEAAAATICSVNLKRFLKEKLREKEDRQI
Ga0209539_133258913300025764Arctic Peat SoilAKLVSKVRQQVEMRHRFDAAAATICGINLRRFLKDKENQ
Ga0209158_125942423300026333SoilLVEMVRQKIEMRRRFDAAAATICKVNLKRFLKEKKDRQV
Ga0257173_100267523300026360SoilLNIPAEWVDQVREKIAMRRRFEAAAATICKLNLKRFLKEKEDRQV
Ga0256802_101093123300026492SedimentIPADLVEKVRQKIEMRRRFDAAAATICGVNLKRFLKEKEERPV
Ga0257159_104682613300026494SoilIPAELAAKVREKIEMRRRFDSAAATICGLNLKRFLKEKQDGQA
Ga0209056_1019642723300026538SoilNIPAELAEMVQERIEMRRRFDSAAATICRLNLKRFLKEKETR
Ga0209577_1081170413300026552SoilALNIPAELVEKVRQKIEMRRRFDAAAATICKVNLKRFLKEKKDRQV
Ga0207722_101321623300027003Tropical Forest SoilLHAQYVISVLVEGKPKTFHIPARLVDQVRQKVDMRHRFDAAAATICGINLRRFLKDKENL
Ga0207815_103936713300027014Tropical Forest SoilTFHIPARLVDQVRQKVDMRHRFDAAAATICGINLRRFLKDKENL
Ga0209329_114692013300027605Forest SoilAEWAEKVREKIEMRRRFETAAATICRVNLKRFLKDKEDRPA
Ga0209422_106944913300027629Forest SoilRLAEKVRAKIEMRRRFDTAATTICLVNLKRFLQEKLEKKDPQD
Ga0209446_100421933300027698Bog Forest SoilVREKIEMRRRFEAAVATICGVNLKRFLKEKEGRQV
Ga0209274_1044068523300027853SoilAFNIPAELAEKVREKIEMRQRFESAAATICRVNLKRFLKEKETR
Ga0209693_1029793213300027855SoilKIEMRRRFETAAATICSVNLKRFLKEKLRDKQDRQI
Ga0209166_1027006223300027857Surface SoilKALNIPAELAVKVREKIEMRGRFDSAAATICGLNLKRFLKEKQDGQA
Ga0209450_1056813713300027885Freshwater Lake SedimentSVLVEGKPKVFHIPAKFVPKVRQQVEMRHRFDAAAATICGINLRRFLKEKERP
Ga0209068_1038763613300027894WatershedsKTFHIPAKLVEQVRQKVDMRHRFDAAAATICGINLRRFLKDKENR
Ga0209067_1088356323300027898WatershedsWAERVREKTEMRRRFDAAAATICSVNLKRFLKQKEDRQA
Ga0265358_10456313300028010RhizosphereIEMRRRFEAAAATICNVNLKRFLKEKLREKEDRPI
Ga0265352_100670913300028021SoilEAVREKIEMRRRFEAAAATICSINLKRFLREKLRDKQDRQI
Ga0302156_1011389923300028748BogRLVPKVRQQVEMRRRFDAAAATICGINLRRFLKEKENR
Ga0307504_1028494013300028792SoilEGQPKVFHVPASMVEQVRQQVAMRHRFDAAAATICGINLRRFLRKKENP
Ga0302278_1040356513300028866BogARLVPKVRQQVEMRRRFDAAAATICGINLRRFLKEKENR
Ga0222749_1004061013300029636SoilAEKVRQKIEMRRRFDAAAATICGVNLKRFLKEKEDRQV
Ga0311361_1036777413300029911BogPKVRQQVEMRRRFDAAAATICGINLRRFLKEKENR
Ga0311358_1015431933300029915BogEEVRNKIELRRRFDAAAATICEVNLKRFLKEKEDRPA
Ga0311331_1087069223300029954BogFQVSVLVEGKPKTFNIPAKLVSKVRQQVEMRHRFDAAAATICGINLRRFLKEKESR
Ga0311342_1070379813300029955BogVPKVRQQVEMRRRFDAAAATICGINLRRFLKEKENR
Ga0302283_121464723300029994FenKPKTFNIPARLVPKVRQQVEMRRRFDAAAATICGINLRRFLKEKENR
Ga0302184_1005536813300030490PalsaPKAINIPAELAEKVREKIEMRRRFESAAATICRLNLKRFLKEKENG
Ga0302183_1009630613300030509PalsaPEEWVEKVREKIEMRRRFDAAAATICKINLKRFLKEKEDRQP
Ga0311335_1108523113300030838FenNNLHTQFQISVLVDGKPKAFNVPPKLVEQVRHQVAMRDRFDAAAATICGINLRRFLKTKEDQ
Ga0265316_1065421613300031344RhizosphereTFNIPAKLVPRVRQQVEMRRRFDAAAATICGINLRRFLKDKENQ
Ga0311364_1180209523300031521FenSVLVEGKPKTFNIPATLVPRVRQQVEMRRRFDAAAATICGINLRRFLKDKENQ
Ga0311364_1217606913300031521FenVDGKPKAFNVPATLVEQVRKQVAMRDRFDAAAATVCGINLRRFLKQKEDQ
Ga0307475_1133456023300031754Hardwood Forest SoilPAELVEKVRAKIEMRHRFDAAAATICSVNLKRFLKEKKEEPSA
Ga0315290_1069539023300031834SedimentGKPKTFNVPAKLVEQVRHKVELRRRFDAAAATVCGINLRRFLKEKENR
Ga0315275_1138311213300032401SedimentNVPAKLVEQVRQKVELRRRFDAAAATVCGINLRRFLKEKENQ
Ga0335394_1114581523300032456FreshwaterIPAELVEKVREKTDMRRRFDDAAAAIRGINLKRFL
Ga0335078_1033623613300032805SoilFQISALVDGQPKVFNVPTNLVPKVRQQVDMRRRFDAATATICGINLRRFLKEKENQ
Ga0335071_1147807223300032897SoilADGKDLHTQYVISVLVEGKPKTFHIPAKLVAQVRQQVEMRRRFDAAAATICGINLRRFLKNKQNP
Ga0335072_1036163523300032898SoilPADWADKVREKTEMRRRFEAAAATICGLNLKRFLKEKEERPS
Ga0334722_1016877223300033233SedimentPAKLVAQVREKIEMRRRFDAAAASICRINLKRFLQEKENP
Ga0326728_1018923813300033402Peat SoilNIPAKLVEQVRRKVEMRRRFDAAAATICGINLKRFLQEKENR
Ga0326727_1096616523300033405Peat SoilPADWADKVREKTEMRRRFDAAAATICGVNLKRFLKEKEERQS
Ga0316627_10018903923300033482SoilAQFQISLLVEGKPKTFNVPAKLVEQVRQQIEMRRRFDAAAATICGINLRRFLHRKENQ
Ga0316630_1150604613300033487SoilSVLVEGKPKTFHIPAKLVPKVRQQVEMRHRFDAAAATICGINLRRFLKEKDRP
Ga0334844_097105_395_5713300033743SoilVQYQISVLVEGKPKAFNVPAKLVEQVRQQVAMRDRFDAAVATICGINLRRFLKSKEDL
Ga0334811_074160_758_8893300033891SoilFNIPAKLVSKVRQQVEMRHRFDAAAATICGINLRRFLKEKESR
Ga0371488_0434912_2_1663300033983Peat SoilISVLVEGKPKAFNVPAKLVEQVRQQVAMRDRFDAAVATICGINLRRFLKSKEDL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.