| Basic Information | |
|---|---|
| Family ID | F036361 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 170 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MREMIISELSQALHEIARGFAHFLPRLIVMLILAFVGWVIAYL |
| Number of Associated Samples | 156 |
| Number of Associated Scaffolds | 170 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.82 % |
| % of genes from short scaffolds (< 2000 bps) | 93.53 % |
| Associated GOLD sequencing projects | 147 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.882 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.765 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.118 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.235 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.93% β-sheet: 0.00% Coil/Unstructured: 45.07% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 170 Family Scaffolds |
|---|---|---|
| PF16657 | Malt_amylase_C | 9.41 |
| PF00535 | Glycos_transf_2 | 0.59 |
| PF00329 | Complex1_30kDa | 0.59 |
| PF02446 | Glyco_hydro_77 | 0.59 |
| PF00133 | tRNA-synt_1 | 0.59 |
| COG ID | Name | Functional Category | % Frequency in 170 Family Scaffolds |
|---|---|---|---|
| COG0060 | Isoleucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.59 |
| COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.59 |
| COG0495 | Leucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.59 |
| COG0525 | Valyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.59 |
| COG0852 | NADH:ubiquinone oxidoreductase 27 kD subunit (chain C) | Energy production and conversion [C] | 0.59 |
| COG1640 | 4-alpha-glucanotransferase | Carbohydrate transport and metabolism [G] | 0.59 |
| COG3262 | Ni,Fe-hydrogenase III component G | Energy production and conversion [C] | 0.59 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.88 % |
| Unclassified | root | N/A | 4.12 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2166559005|cont_contig117257 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_104281128 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300000789|JGI1027J11758_12849438 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| 3300001151|JGI12713J13577_1004056 | All Organisms → cellular organisms → Bacteria | 1406 | Open in IMG/M |
| 3300001411|JGI20182J14882_102738 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300001471|JGI12712J15308_10097915 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300001593|JGI12635J15846_10354182 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100489727 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
| 3300004153|Ga0063455_101018047 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300004635|Ga0062388_102199050 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300005435|Ga0070714_102299508 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300005591|Ga0070761_10945618 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300005921|Ga0070766_10265006 | All Organisms → cellular organisms → Bacteria | 1094 | Open in IMG/M |
| 3300005921|Ga0070766_10849097 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300005950|Ga0066787_10145953 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300006086|Ga0075019_10773484 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300006102|Ga0075015_100460141 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300006162|Ga0075030_101508885 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300006174|Ga0075014_100275607 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300006954|Ga0079219_10385759 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300007258|Ga0099793_10343944 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300007788|Ga0099795_10168998 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300009090|Ga0099827_11507198 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300009636|Ga0116112_1205276 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300009636|Ga0116112_1225004 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300009644|Ga0116121_1163594 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300009645|Ga0116106_1227823 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300009646|Ga0116132_1051496 | All Organisms → cellular organisms → Bacteria | 1322 | Open in IMG/M |
| 3300009683|Ga0116224_10192229 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300009709|Ga0116227_10794159 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300009760|Ga0116131_1219656 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300009839|Ga0116223_10347798 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300010343|Ga0074044_10050614 | All Organisms → cellular organisms → Bacteria | 2854 | Open in IMG/M |
| 3300010343|Ga0074044_10374639 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300010343|Ga0074044_10845112 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300010880|Ga0126350_10558667 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300012189|Ga0137388_11510829 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300012199|Ga0137383_10757847 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300012203|Ga0137399_10639419 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300012357|Ga0137384_11125209 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300012918|Ga0137396_10399394 | All Organisms → cellular organisms → Bacteria | 1019 | Open in IMG/M |
| 3300012925|Ga0137419_11575926 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300012929|Ga0137404_12196772 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300014156|Ga0181518_10490223 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300014164|Ga0181532_10176207 | All Organisms → cellular organisms → Bacteria | 1268 | Open in IMG/M |
| 3300014199|Ga0181535_10286931 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300014200|Ga0181526_10211705 | All Organisms → cellular organisms → Bacteria | 1239 | Open in IMG/M |
| 3300014200|Ga0181526_10502413 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300014489|Ga0182018_10056015 | All Organisms → cellular organisms → Bacteria | 2396 | Open in IMG/M |
| 3300014495|Ga0182015_10157362 | Not Available | 1541 | Open in IMG/M |
| 3300014654|Ga0181525_10873104 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300015054|Ga0137420_1364486 | All Organisms → cellular organisms → Bacteria | 5846 | Open in IMG/M |
| 3300015264|Ga0137403_11249985 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300015372|Ga0132256_100928622 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300016404|Ga0182037_11343065 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300017935|Ga0187848_10485232 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300017948|Ga0187847_10176475 | All Organisms → cellular organisms → Bacteria | 1166 | Open in IMG/M |
| 3300017948|Ga0187847_10798348 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300018006|Ga0187804_10110494 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
| 3300018012|Ga0187810_10494948 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300018014|Ga0187860_1412032 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300018024|Ga0187881_10467668 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300018026|Ga0187857_10532143 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300018038|Ga0187855_10537400 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300018042|Ga0187871_10353331 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300018044|Ga0187890_10233136 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
| 3300018046|Ga0187851_10018573 | All Organisms → cellular organisms → Bacteria | 4917 | Open in IMG/M |
| 3300018046|Ga0187851_10039737 | All Organisms → cellular organisms → Bacteria | 3140 | Open in IMG/M |
| 3300018085|Ga0187772_10977726 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300019868|Ga0193720_1048771 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300019890|Ga0193728_1145143 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
| 3300020579|Ga0210407_10158080 | All Organisms → cellular organisms → Bacteria | 1749 | Open in IMG/M |
| 3300020582|Ga0210395_10681311 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300020583|Ga0210401_11583330 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300021170|Ga0210400_10472711 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
| 3300021401|Ga0210393_10651175 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300021402|Ga0210385_10708497 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300021403|Ga0210397_10377643 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
| 3300021405|Ga0210387_11008891 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300021420|Ga0210394_10356866 | Not Available | 1285 | Open in IMG/M |
| 3300021432|Ga0210384_11126162 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300021432|Ga0210384_11626641 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300021433|Ga0210391_10350048 | All Organisms → cellular organisms → Bacteria | 1159 | Open in IMG/M |
| 3300021433|Ga0210391_11488342 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300021475|Ga0210392_10834677 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300021479|Ga0210410_10941583 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300021559|Ga0210409_10120569 | All Organisms → cellular organisms → Bacteria | 2411 | Open in IMG/M |
| 3300021560|Ga0126371_12401493 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300023068|Ga0224554_1110141 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300024238|Ga0224523_1123166 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300024295|Ga0224556_1061314 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300025448|Ga0208037_1091363 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300025461|Ga0208851_1066360 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300025878|Ga0209584_10005352 | All Organisms → cellular organisms → Bacteria | 4190 | Open in IMG/M |
| 3300025898|Ga0207692_10268891 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
| 3300025905|Ga0207685_10051542 | All Organisms → cellular organisms → Bacteria | 1590 | Open in IMG/M |
| 3300025929|Ga0207664_11620858 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300026281|Ga0209863_10031782 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1596 | Open in IMG/M |
| 3300026294|Ga0209839_10023799 | All Organisms → cellular organisms → Bacteria | 2378 | Open in IMG/M |
| 3300026467|Ga0257154_1033966 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300027034|Ga0209730_1036878 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300027334|Ga0209529_1001665 | All Organisms → cellular organisms → Bacteria | 3174 | Open in IMG/M |
| 3300027439|Ga0209332_1050963 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300027537|Ga0209419_1017979 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1271 | Open in IMG/M |
| 3300027545|Ga0209008_1021529 | Not Available | 1507 | Open in IMG/M |
| 3300027567|Ga0209115_1025492 | Not Available | 1326 | Open in IMG/M |
| 3300027575|Ga0209525_1128338 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300027590|Ga0209116_1058722 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300027648|Ga0209420_1130684 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300027667|Ga0209009_1036768 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
| 3300027674|Ga0209118_1145921 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300027684|Ga0209626_1165622 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300027738|Ga0208989_10240286 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300027825|Ga0209039_10363245 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300027867|Ga0209167_10806459 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300027884|Ga0209275_10105881 | Not Available | 1446 | Open in IMG/M |
| 3300027889|Ga0209380_10178574 | All Organisms → cellular organisms → Bacteria | 1244 | Open in IMG/M |
| 3300027894|Ga0209068_10899196 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300027898|Ga0209067_10193409 | All Organisms → cellular organisms → Bacteria | 1092 | Open in IMG/M |
| 3300028536|Ga0137415_10510789 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
| 3300028748|Ga0302156_10266026 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300028860|Ga0302199_1233060 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300028866|Ga0302278_10371037 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300028874|Ga0302155_10494569 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300029636|Ga0222749_10225589 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300029908|Ga0311341_10247096 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
| 3300029943|Ga0311340_11409897 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300029944|Ga0311352_11296335 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300029951|Ga0311371_11970395 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300029952|Ga0311346_11027906 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300030007|Ga0311338_11801540 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300030399|Ga0311353_10026058 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6299 | Open in IMG/M |
| 3300030503|Ga0311370_10410295 | All Organisms → cellular organisms → Bacteria | 1698 | Open in IMG/M |
| 3300030518|Ga0302275_10071654 | All Organisms → cellular organisms → Bacteria | 2456 | Open in IMG/M |
| 3300030520|Ga0311372_10980216 | All Organisms → cellular organisms → Bacteria | 1120 | Open in IMG/M |
| 3300030580|Ga0311355_10655910 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300030659|Ga0316363_10185351 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300030688|Ga0311345_10270673 | All Organisms → cellular organisms → Bacteria | 1637 | Open in IMG/M |
| 3300030813|Ga0265750_1073336 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300030814|Ga0265741_107491 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300031057|Ga0170834_101959703 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300031057|Ga0170834_112657828 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
| 3300031231|Ga0170824_118171103 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300031249|Ga0265339_10387849 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300031249|Ga0265339_10507599 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300031250|Ga0265331_10183430 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300031258|Ga0302318_10302291 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300031474|Ga0170818_107579698 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300031525|Ga0302326_11154121 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
| 3300031708|Ga0310686_110465650 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300031712|Ga0265342_10715037 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300031715|Ga0307476_10329455 | All Organisms → cellular organisms → Bacteria | 1122 | Open in IMG/M |
| 3300031718|Ga0307474_11186809 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300031720|Ga0307469_10155801 | All Organisms → cellular organisms → Bacteria | 1718 | Open in IMG/M |
| 3300031754|Ga0307475_10195016 | All Organisms → cellular organisms → Bacteria | 1618 | Open in IMG/M |
| 3300031754|Ga0307475_10294063 | Not Available | 1303 | Open in IMG/M |
| 3300031754|Ga0307475_10348247 | All Organisms → cellular organisms → Bacteria | 1190 | Open in IMG/M |
| 3300031890|Ga0306925_10751577 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
| 3300031918|Ga0311367_10628403 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
| 3300032008|Ga0318562_10814174 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300032035|Ga0310911_10397508 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300032160|Ga0311301_10692904 | Not Available | 1435 | Open in IMG/M |
| 3300032261|Ga0306920_100558526 | All Organisms → cellular organisms → Bacteria | 1696 | Open in IMG/M |
| 3300033412|Ga0310810_10799883 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300033433|Ga0326726_10658536 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
| 3300033475|Ga0310811_11217036 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300033545|Ga0316214_1024610 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300033545|Ga0316214_1051174 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300033826|Ga0334847_013431 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300033888|Ga0334792_144094 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.76% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 10.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.65% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 6.47% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.29% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 5.29% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 4.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.12% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.53% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.53% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.53% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.94% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 2.94% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.35% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.35% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 2.35% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.76% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.76% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.18% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.18% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.18% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.18% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 1.18% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.18% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.18% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 1.18% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.59% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.59% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.59% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.59% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.59% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.59% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.59% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.59% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.59% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 0.59% |
| Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.59% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.59% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001151 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 | Environmental | Open in IMG/M |
| 3300001411 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 shallow-072012 | Environmental | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005950 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009636 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 | Environmental | Open in IMG/M |
| 3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300009646 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009709 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fb - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
| 3300009760 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_100 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018014 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40 | Environmental | Open in IMG/M |
| 3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300019868 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s1 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300023068 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 20-24 | Environmental | Open in IMG/M |
| 3300024238 | Peat soil microbial communities from Stordalen Mire, Sweden - C.F.S.T50 | Environmental | Open in IMG/M |
| 3300024295 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5 | Environmental | Open in IMG/M |
| 3300025448 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025461 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300026467 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-A | Environmental | Open in IMG/M |
| 3300027034 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027334 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027439 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027537 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027567 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028748 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028860 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_3 | Environmental | Open in IMG/M |
| 3300028866 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028874 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_1 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029908 | II_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029952 | II_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030518 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030688 | II_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300030813 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030814 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
| 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Host-Associated | Open in IMG/M |
| 3300031258 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1 | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Host-Associated | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Host-Associated | Open in IMG/M |
| 3300033826 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 E2 1-5 | Environmental | Open in IMG/M |
| 3300033888 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-3-X1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| cont_0013.00006880 | 2166559005 | Simulated | MREIIINELTQALQDLARGFAHYLPRLVVMLIIAFVGWMSPTY |
| INPhiseqgaiiFebDRAFT_1042811281 | 3300000364 | Soil | MREIIITELTQASQELARGFAHYLPRMIVMLIIAFVGWVIAYLLK |
| JGI1027J11758_128494382 | 3300000789 | Soil | MQEMIINELTQAVHDLARGFAHFLPRLIVMLILAFVGWLIAYLVKVTLRSIL |
| JGI12713J13577_10040562 | 3300001151 | Forest Soil | MREMIVSELSQALHEMARGFAHLLPRIIVMLILAALGWVIAYVVKVVLRSILRL |
| JGI20182J14882_1027381 | 3300001411 | Arctic Peat Soil | MREMIISELSQALYELARGFAHFLPRLIVMLILTFVGWVIAYVLRV |
| JGI12712J15308_100979151 | 3300001471 | Forest Soil | MREMIISELSQAVQDLARGFAHYLPRFIVMLILGLAGWA |
| JGI12635J15846_103541821 | 3300001593 | Forest Soil | MREMIISELSQALHEIVRGFAHFLPRLIVMLILAFVGWVIAYVAKVVLRS |
| JGIcombinedJ26739_1004897271 | 3300002245 | Forest Soil | MREIIWAELTQATQEIVREFAHLLPRLIVMLIIAFAGWVIAYLLX |
| Ga0063455_1010180471 | 3300004153 | Soil | MRDLIISELTQAVHDLARGFAHYLPRLIVMLILAILGWLIAYVVKIVLRSFLR |
| Ga0062388_1021990502 | 3300004635 | Bog Forest Soil | MREMIISELSQALHDIARGFAHFLPRFIVMLILAAVGWVIAYVVKVV |
| Ga0070714_1022995081 | 3300005435 | Agricultural Soil | MKEMIISELTQAVQELVRGFARFLPRFIVLVIIAFAGWLIAHLV |
| Ga0070761_109456181 | 3300005591 | Soil | MREMIISELSQAMHELARGFAHYLPRLIVMLILAFAGWAVAYVA |
| Ga0070766_102650062 | 3300005921 | Soil | MREMIISELTQALHELARGFAHFLPRLIVMLILAFLGWVLAYVAKVILRSILRLIK |
| Ga0070766_108490972 | 3300005921 | Soil | MREMITSELVQALHELARGFAHFLPRLIVMLILAFV |
| Ga0066787_101459532 | 3300005950 | Soil | MREMIISELSQALQEIARSFAHFLPRVIVMLILAVVGWLLAVVAKVTVRGILRLV |
| Ga0075019_107734841 | 3300006086 | Watersheds | MREMIISELTQAVQDLARGFAHYLPRLIVMLILAFVGWLI |
| Ga0075015_1004601412 | 3300006102 | Watersheds | MREIIITELTQALQELARGFAHYLPRLIVMLIIAF |
| Ga0075030_1015088852 | 3300006162 | Watersheds | MREMIISELSQAVHELARGFAHYLPRLIVMLILAFAGWAIAYVVKVALRSILRLI |
| Ga0075014_1002756072 | 3300006174 | Watersheds | MREMIVSELTQALHDLARGFAHYLPRLIVLLILAFLGWVIAYVVK |
| Ga0079219_103857591 | 3300006954 | Agricultural Soil | MKSEGRMREIIISELTQASHELARTFAHYLPRLVVMIILALIGWAIAYLL |
| Ga0099793_103439442 | 3300007258 | Vadose Zone Soil | MREIIVAELTQASQELARGFAHYLPRMIVMLIIAFVGWVLAYLFK |
| Ga0099795_101689981 | 3300007788 | Vadose Zone Soil | MREMIISELSQALHELVRGFAHFLPRLIVMLILAFVGWVVA |
| Ga0099827_115071981 | 3300009090 | Vadose Zone Soil | MREMIISELTQALHELARGFAHFLPRLIVMLILAFV |
| Ga0116112_12052761 | 3300009636 | Peatland | MREMIISELSQALHEIARGFAHFLPRLIVIVILAFVG |
| Ga0116112_12250041 | 3300009636 | Peatland | MREMIISELSQALHEIARGFAHFLPRLIVMLLLALVGWV |
| Ga0116121_11635941 | 3300009644 | Peatland | MREMIINELSHSLQEIARSFAQFLPRLIVMLLFAILGWVIAYV |
| Ga0116106_12278232 | 3300009645 | Peatland | MREMIISELSQAVQELAKGFAHYLPRLIVMLILAFAGWAIAYLVKIVL |
| Ga0116132_10514962 | 3300009646 | Peatland | MREMIISELTQAMQELTRGFAHILPRIIVLVIIAFAGWVVAYFLKVFL |
| Ga0116224_101922291 | 3300009683 | Peatlands Soil | MREMIISELSQAVHELARGFAHYLPRLIVMLILAFAGWAIAYVVKVALRSI |
| Ga0116227_107941591 | 3300009709 | Host-Associated | MREMIMSELHQAVLELTRGFAHFLPRFIVLLIIAFAGWVVAYLLQIFLRSIL |
| Ga0116131_12196561 | 3300009760 | Peatland | MREMIIRELNQSLHEIARGFAHFLPRLIVMLMFAFVGWL |
| Ga0116223_103477981 | 3300009839 | Peatlands Soil | MREMIISELSQALHEIARDFAHFLPRLIVMLILAFVGWV |
| Ga0074044_100506143 | 3300010343 | Bog Forest Soil | MREMIISELSQALHEIARGFAHFLPRLIVIVILAFVGWVI |
| Ga0074044_103746391 | 3300010343 | Bog Forest Soil | MREMIISELSQALHEMARDFAHFLPRVIVMLILALVGWVIAYV |
| Ga0074044_108451121 | 3300010343 | Bog Forest Soil | MREMIISELTQAMEELSRGFAHILPRIIVLVIIAFAGW |
| Ga0126350_105586671 | 3300010880 | Boreal Forest Soil | MREMIISELSQALHEIARGFAHFLPRLIVMLILAFVGWVIAYL |
| Ga0137388_115108292 | 3300012189 | Vadose Zone Soil | MREMIISELSQALHELVRGFAHFLPRLIVMLILALVGWVIAY |
| Ga0137383_107578472 | 3300012199 | Vadose Zone Soil | MREMIISELTQAMHELARGFAHYLPRLIVMLILAFVGWAIAYVVK |
| Ga0137399_106394191 | 3300012203 | Vadose Zone Soil | MRDMIVSELSQAMHELARGFAHFLPRLIVMLVLAFVG |
| Ga0137384_111252092 | 3300012357 | Vadose Zone Soil | MREMIISELSQAVHDLARGFAHYLPRLIVMLVIAFA |
| Ga0137396_103993942 | 3300012918 | Vadose Zone Soil | MREMIISELSQALHELVRGFAHFLPRLIVMLILAFLGWVIA |
| Ga0137419_115759261 | 3300012925 | Vadose Zone Soil | MREMIISELSQALHELVRGFAHFLPRLIVMLILAFVGWVIAY |
| Ga0137404_121967721 | 3300012929 | Vadose Zone Soil | MREIIIAELTQASHDLARGFAHYLPRMIVMLIIAFIGWVIAYLLKVVV |
| Ga0181518_104902232 | 3300014156 | Bog | MREMIISELSQALHEIARNFAHFLPRLIVMLILAFA |
| Ga0181532_101762071 | 3300014164 | Bog | MREMIISELSHARHDIARVFAHFLPRLIVMLILAVVGWVIAYVAKVV |
| Ga0181535_102869311 | 3300014199 | Bog | MREMIISELSQALHEIARDFAHFLPRLIVMLILAV |
| Ga0181526_102117051 | 3300014200 | Bog | MREMIISELSQALHEIARDFAHFLPRLIVMLILAVVG |
| Ga0181526_105024131 | 3300014200 | Bog | MREMIINELSQSLHEIARGFAHFLPRLIVMLMFAFVGWLIA |
| Ga0182018_100560153 | 3300014489 | Palsa | MREMIVSELTQAVHELARGFAHYLPRLIVMLIIAFAGWAVAY |
| Ga0182015_101573621 | 3300014495 | Palsa | MREMIISELSQALQELARGFAHYLPRLIVMLILAFLG |
| Ga0181525_108731042 | 3300014654 | Bog | MREMIVSELGQALQDIARSFAHFLPRLIVMLVLALVGWIIAYVV |
| Ga0137420_13644866 | 3300015054 | Vadose Zone Soil | MREMIISELSQALHEFARGFAHYLPRLIVMLILAFGAG* |
| Ga0137403_112499852 | 3300015264 | Vadose Zone Soil | MREMIISELSQALHEMTRGFAHFLPRLIVMLILAFVGWVIAYV |
| Ga0132256_1009286222 | 3300015372 | Arabidopsis Rhizosphere | MREMIISELSQAVHDLARGFAHYLPRLIVLLIFAIVGWLIAY |
| Ga0182037_113430651 | 3300016404 | Soil | MRDMIIGELTQAMQEFIRGFAHILPRLIVLLIIACVGWAIAYFVKLFL |
| Ga0187848_104852321 | 3300017935 | Peatland | MREMIISELSHAVHEMARGFAHFLPRLVVTLILAFGGWVIAYVVKAVLRS |
| Ga0187847_101764751 | 3300017948 | Peatland | MREMIISELSQALHEIARDFAHFLPRLIVMLILAVVGWVIAYVAKVVLRSFL |
| Ga0187847_107983481 | 3300017948 | Peatland | MREMITSELIQALHELARGFAHFLPRLIVMLILAFVGWVIAYVVKV |
| Ga0187804_101104941 | 3300018006 | Freshwater Sediment | MWEIIITELTQVLQGLASGFAHYVPRLAVMLIIAFIG |
| Ga0187810_104949481 | 3300018012 | Freshwater Sediment | MGTMREMIISELSLALHELKGGFAHFLPRLIVMLILAFLGWVVASVAKV |
| Ga0187860_14120322 | 3300018014 | Peatland | MREMIISELSQALHEIARSLAHFLPRVIVMLILALVGWVFAY |
| Ga0187881_104676681 | 3300018024 | Peatland | MREMIVSELTQAVHELARGFAHYLPRLIVMLIIAFAG |
| Ga0187857_105321431 | 3300018026 | Peatland | MREMIIRELNQSLHEIARGFAHFLPRLIVMLLLALVGWV |
| Ga0187855_105374001 | 3300018038 | Peatland | MREMIISELSQAVHEMARGFAHFLPRLVVTLILAFG |
| Ga0187871_103533311 | 3300018042 | Peatland | MREMIISELSQALHEMARGFAHFLPRVIVMLILAVGGWVIA |
| Ga0187890_102331362 | 3300018044 | Peatland | MREMIISELSQALHEIARGFSHFLPLLIVIVILAFVGWVIAYV |
| Ga0187851_100185735 | 3300018046 | Peatland | MWKMIVSELMQAMQELARSFAHILPRIIVVVIMALVGWVVAYLTKV |
| Ga0187851_100397373 | 3300018046 | Peatland | MREMIISELSQALHEMARGFAHFLPRLIVMLILAFAGWVIAYAV |
| Ga0187772_109777261 | 3300018085 | Tropical Peatland | MQEVVVNEPMRDIIVNELTQALHEMGREFAHYVPRLIVMLIIAFAGWLI |
| Ga0193720_10487712 | 3300019868 | Soil | MREMIVNELTQAMHEIIRDVAHFLPRLIVMLVIALVG |
| Ga0193728_11451431 | 3300019890 | Soil | MRDMIVSELSQAMHELARGFAHFLPRLIVMLLLAFVGWVIAYLA |
| Ga0210407_101580803 | 3300020579 | Soil | MREMIISELSQALHELVRGFAHFLPRLIVMVILAFVG |
| Ga0210395_106813111 | 3300020582 | Soil | MREMIISELTQAVHDLARGFAHYLPRLIVILILAFAGWLIAYVVKVI |
| Ga0210401_115833302 | 3300020583 | Soil | MREMIVNELTQAVQDLARGFAHYLPRLIVMLILAFAGW |
| Ga0210400_104727112 | 3300021170 | Soil | MREMIVNELTQAVQDLARGFAHYLPRLIVMLILAFAG |
| Ga0210393_106511752 | 3300021401 | Soil | MREMIVSELTQAAHELAKGFAHFLPRLIVMLILAFVGWVIAYLAKV |
| Ga0210385_107084972 | 3300021402 | Soil | MREMIISELMQAVQELARGFARFLPRFVVLVIIAFVGW |
| Ga0210397_103776432 | 3300021403 | Soil | MREMITSELSQAVQDLARGFAHYLPRLIVMLVIAFAG |
| Ga0210387_110088912 | 3300021405 | Soil | MRELIIAELTQALQELARGFAYYSPRLVVLLIIALVGWVI |
| Ga0210394_103568661 | 3300021420 | Soil | MREMIMSELTQAYHEFGRELAHLLPRLIEMLIIVLL |
| Ga0210384_111261622 | 3300021432 | Soil | MWKMINSELSQALRELVRGFAHFLPRLIVMLILAFVGWLIA |
| Ga0210384_116266412 | 3300021432 | Soil | MREMIISELSQAVHDLARGFAHYLPRLIVMLVIAFAGWLIAY |
| Ga0210391_103500481 | 3300021433 | Soil | MREMIISELSQAMHELARGFAHYLPRLIVMLILAFAGWAVAYVAK |
| Ga0210391_114883421 | 3300021433 | Soil | MREMIISELTQALHELARDFAHFLPRLIVMLILAFLGWLIA |
| Ga0210392_108346772 | 3300021475 | Soil | MREMIISELTQAMQDLARGFAHYLPRLLVMLILAFLGWLVAY |
| Ga0210410_109415832 | 3300021479 | Soil | MREMIISELSQALHEIARGFAHLLPRLIVMLILAILGWVIAYVVKVVLRSI |
| Ga0210409_101205691 | 3300021559 | Soil | MRDMIVSELSQAMHELARGFAHFLPRLIVMLILAFVGWVIAYIA |
| Ga0126371_124014932 | 3300021560 | Tropical Forest Soil | MHEMRELIMTELSQAMQEMLRSAAHLLPRLIVMLIIV |
| Ga0224554_11101411 | 3300023068 | Soil | MREMIISELSQSLHEIARGFAHFLPRFIVMLMFAFVGW |
| Ga0224523_11231661 | 3300024238 | Soil | MREMIISELSQALHEIAGSFAHFLPRLIVMLILAFLGWVI |
| Ga0224556_10613141 | 3300024295 | Soil | MREMIVEELSQAMHELARGFAHYLPRLIVMLILGFAGWAFAYIVKLVLRNIL |
| Ga0208037_10913632 | 3300025448 | Peatland | MRELIISELSQALHEIARGFAHFLPRLIVMLILAFVGWVIAYVVK |
| Ga0208851_10663602 | 3300025461 | Arctic Peat Soil | MREMIISELSQALHELARGFAHFLPRLIVMLILTFVGWVIAYVL |
| Ga0209584_100053525 | 3300025878 | Arctic Peat Soil | MREMIISELSQALYELARGFAHFLPRLIVMLILTFVGWVIAYVLRVA |
| Ga0207692_102688912 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MREMIISELSQAIHDLARGFAHYLPRLIVMLILAFLGWAIAY |
| Ga0207685_100515421 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MREMIISELSQAIHDLARGFAHYLPRLIVMLILAFLGWAI |
| Ga0207664_116208581 | 3300025929 | Agricultural Soil | MREMIIGELTQAVHDLARGFAHYLPRLIVMLILVLAGWLIAYIAKVILRSI |
| Ga0209863_100317822 | 3300026281 | Prmafrost Soil | MREMIISELTRAMDELARGFAHFLPRLIVMLILGFVGWVIASIVKVALRSLLRLI |
| Ga0209839_100237991 | 3300026294 | Soil | MREMIISELSQAVHDLARGFAHYLPRLIVMLILAFIG |
| Ga0257154_10339661 | 3300026467 | Soil | MREMIISELTQALHELARDFAHFLPRLIVMLILAFLGWVIAYVAKVVL |
| Ga0209730_10368782 | 3300027034 | Forest Soil | MREMIIGELTQALHELARDFAHFLPRLIVMLILALLGWVIAFIARVVLR |
| Ga0209529_10016651 | 3300027334 | Forest Soil | MREMIVSELSQALHEMARGFAHLLPRIIVMLILAALGWVIAYVVKVVLRSIL |
| Ga0209332_10509632 | 3300027439 | Forest Soil | MREMIVSELTQALHEVARGFAHYLPRLIVMLILAFMGWVIAYLVKVILRSILQFMK |
| Ga0209419_10179793 | 3300027537 | Forest Soil | MREMIIGELTQALHELARDFAHFLPRLIVMLILAFLGWVIAYVAKVVLRSLLRL |
| Ga0209008_10215292 | 3300027545 | Forest Soil | MREMIISELSQALQELARGFAHYLPRLIVMLILAFLGWVFAYVVKIVLRSILRLIR |
| Ga0209115_10254922 | 3300027567 | Forest Soil | MREMIISELTQAMHDLARGFAHYLPRLIVMLILAFVGWLIA |
| Ga0209525_11283382 | 3300027575 | Forest Soil | MREMIISELSQALHDIARGFAHFLPRLIVLLILALLGWVIAYAIKAVLRSA |
| Ga0209116_10587221 | 3300027590 | Forest Soil | MREMIISELIQALHDLARGFAHFLPRLIVMLILAFAGWVIAYVV |
| Ga0209420_11306842 | 3300027648 | Forest Soil | MREMIVSELSQALQDIARSFAHFLPRLIVMLVLAI |
| Ga0209009_10367681 | 3300027667 | Forest Soil | MREMIISELTEALHELARDFAHFLPRLIVMLILAFLGWV |
| Ga0209118_11459212 | 3300027674 | Forest Soil | MREMIISELSQALQELARGFAHYLPRLIVMLILAFLGWVFAYVVKTV |
| Ga0209626_11656221 | 3300027684 | Forest Soil | MREMIISELSQALHELVRGFAHFLPRLIVMLILAFV |
| Ga0208989_102402861 | 3300027738 | Forest Soil | MRDMIVSELSQAMHELARGFAHFLPRLIVMLILAFVGWVIAYVA |
| Ga0209039_103632451 | 3300027825 | Bog Forest Soil | MREMIISELTQAMLELTRGFAHILPRIIVLVIIAFVGWVVAYL |
| Ga0209167_108064592 | 3300027867 | Surface Soil | MREMIISELSQALHEIARDFAHFLPRLIVMLILALVGWIIAYLAKVALRSILRLV |
| Ga0209275_101058811 | 3300027884 | Soil | MREIIWAELTQATQEIVREFAHLLPRLIVMLIIAFAGWVIAYLLKWIL |
| Ga0209380_101785742 | 3300027889 | Soil | MREMIISELMQAVQELARGFARFLPRFVVLVIIAFVGWVI |
| Ga0209068_108991961 | 3300027894 | Watersheds | MREMIFNELSEAWHELARGFAHFIPRLIEMLVLAFLGWLIAYMLKVVLRGILR |
| Ga0209067_101934091 | 3300027898 | Watersheds | MREMIVNELTQAVQDLARGFAHYLPRLIVMLILAFVGWLIAY |
| Ga0137415_105107891 | 3300028536 | Vadose Zone Soil | MREMIISELTQALHELAREFAHFLPRLIVMLILAFLGWVIAYIAKVV |
| Ga0302156_102660261 | 3300028748 | Bog | MREMIISELSQALHEMARGFAHFLPRLIVMLILAFAGWVIAYVVKA |
| Ga0302199_12330602 | 3300028860 | Bog | MQEMIVSELSQAMHDIARDFAHFLPRLIVMLIIALA |
| Ga0302278_103710372 | 3300028866 | Bog | MREMIVGELMQAMHDIAHGFAHFLPRFIVMVIVAVAGWLIAYVVKVL |
| Ga0302155_104945691 | 3300028874 | Bog | MREMIVEELSQAMHELARGFAHYLPRLIVMLILGFAGWAFAYIVKLVLRSILRLI |
| Ga0222749_102255891 | 3300029636 | Soil | MREMIVSELSQALREIARGFAHLLPRVIVMLILASAGWVIAYAAKAVLRSILRLVKFDKL |
| Ga0311341_102470962 | 3300029908 | Bog | MREMIVEELSQAMHELARGFAHYLPRLIVMLILGFA |
| Ga0311340_114098971 | 3300029943 | Palsa | MREMIISELSEALHEIAKGFAHFLPRVLVMLIFAVLGWLIASVAKVILR |
| Ga0311352_112963352 | 3300029944 | Palsa | MREMIISELTQAMQEIIRGFAHILPRIIVLVIIAFVGWVVAYFL |
| Ga0311371_119703951 | 3300029951 | Palsa | MREMIISELSQAVQDLARGFAHYLPRLIVMLVIALAGWLIAY |
| Ga0311346_110279062 | 3300029952 | Bog | MREMIMSELHQAVLELTRGFAHFLPRFIVLLIIAFAGWVV |
| Ga0311338_118015401 | 3300030007 | Palsa | MREMIISELSQAVQDLARGFAHYLPRLIVMLVIALAGWLIA |
| Ga0311353_100260589 | 3300030399 | Palsa | MREMIISELSQALQEIARGFAHYLPRLIVMLILAAVGWVIAFVA |
| Ga0311370_104102953 | 3300030503 | Palsa | MREMIISELIQALHDLARGFAHFLPRLIVMLILAFAGWVIAYVVKVVLRS |
| Ga0302275_100716541 | 3300030518 | Bog | MREMIVGELMQAMHDIAHGFAHFLPRFIVMVIVAVAGWLIAYVVKVLLRSILRLVRFD |
| Ga0311372_109802162 | 3300030520 | Palsa | MREMIISELTQAMQEIIRGFAHILPRIIVLVIIAFVGWV |
| Ga0311355_106559102 | 3300030580 | Palsa | MREMIISELSQAVQDLARGFAHYLPRLIVMLVIALAGWLIAYVIQVV |
| Ga0316363_101853512 | 3300030659 | Peatlands Soil | MREMIISELSQALHEIARDFAHFLPRLIVMLILALAGWAIAYVVKA |
| Ga0311345_102706733 | 3300030688 | Bog | MREMIVGELMQAMHDIAHGFAHFLPRFIVMVIVAVAGWLIAYVVKVLLRSILR |
| Ga0265750_10733362 | 3300030813 | Soil | MKEMIVSELSQALHELARGFAHYLPRLIVMLILAFAGWAVAYLVKVILRSLL |
| Ga0265741_1074912 | 3300030814 | Soil | MREMIISELTQAMQDLARGFAHYLPRLIVMLILAFA |
| Ga0170834_1019597031 | 3300031057 | Forest Soil | MREMIISELSQALHEIARGFAHFLPRLIVMVVLTFVGWVTAYLIKAVL |
| Ga0170834_1126578282 | 3300031057 | Forest Soil | MREMIISELTQAMQDLARGFAHYLPRLLVMLILAFLGWLVA |
| Ga0170824_1181711031 | 3300031231 | Forest Soil | MREMIISELTQAMHDLARGFAHYLPRLIVMLIFAFVGWAIGYVVKA |
| Ga0265339_103878492 | 3300031249 | Rhizosphere | MREMIISELTQAVQDLARGFAHYLPRLIVMLILAF |
| Ga0265339_105075991 | 3300031249 | Rhizosphere | MREMIISELSQALHDIARGFAHYLPRIIVMLILALV |
| Ga0265331_101834302 | 3300031250 | Rhizosphere | MREIITNELSRALQDLARGFAHYLPRVVVMLIIAFIGWAIAYL |
| Ga0302318_103022912 | 3300031258 | Bog | MREMIISELSQALHEMARGFAHFLPRLIVMLILAFAGWVIAYVVKAVLR |
| Ga0170818_1075796981 | 3300031474 | Forest Soil | MIISELTQAMHDLARGFAHYLPRLIVMLIFAFVGWAIGYV |
| Ga0302326_111541211 | 3300031525 | Palsa | MREMIISELSQALLELRMGFAHYLPRLIVMLILALAGWAIAYAVKVILRSILR |
| Ga0310686_1104656502 | 3300031708 | Soil | MREMIVSELSQALHELARGFAHFLPRLIVMLILAFVGWVIAYVVKVVLHSI |
| Ga0265342_107150371 | 3300031712 | Rhizosphere | MRDMIISELTQALHELARGFAHYLPRLIVMLILAFLGWVIAYVVKVVLRS |
| Ga0307476_103294552 | 3300031715 | Hardwood Forest Soil | MREMIVSELSQALHEMARGFAHFLPRIIVMLILAALGWV |
| Ga0307474_111868092 | 3300031718 | Hardwood Forest Soil | MREMIISELTQAMQDLARGFAHYLPRLLVMLILAFLGWLVAYLVKVILRSI |
| Ga0307469_101558013 | 3300031720 | Hardwood Forest Soil | MREMIISELTQALHELARDFAHFLPRLIVMLILAFLGWVIAYVAKVVLRSILRL |
| Ga0307475_101950163 | 3300031754 | Hardwood Forest Soil | MREMIISELTQALHDLARGFAHFLPRLIVMLILAFVGWVIAFI |
| Ga0307475_102940631 | 3300031754 | Hardwood Forest Soil | MREIIITELTQAFQDLVRGFAHYLPRLIVMLIIALVGWMI |
| Ga0307475_103482471 | 3300031754 | Hardwood Forest Soil | MRDMIVSELSQAMHELARGFAHFLPRLIVMLILAFVGWVIAYIAKILLRSIL |
| Ga0306925_107515772 | 3300031890 | Soil | MREIIVTELTQALQELLRAFAHYLPRLIVMLIIAFLGWL |
| Ga0311367_106284032 | 3300031918 | Fen | MREMIMSELSQALYELARGFAHFLPRLIVMLILMSVG |
| Ga0318562_108141741 | 3300032008 | Soil | MRDLIISELTQALHDIARRFAHFLPRLIVMLILAMLGWVIAYVVK |
| Ga0310911_103975081 | 3300032035 | Soil | MRDLIISELTQALHDIARRFAHFLPRLIVMLILAMLGWV |
| Ga0311301_106929042 | 3300032160 | Peatlands Soil | MREIIITELTQALQELARGFAHYLPRLIVMLIIAFSGWVVAYLLK |
| Ga0306920_1005585261 | 3300032261 | Soil | MREIIITELTQAFQDLVRGFAHYLPRLIVMLMIAFV |
| Ga0310810_107998832 | 3300033412 | Soil | MREIIIAELTQAWQELARGFAHYLPRLIVMLIIAFVGWAIAYLL |
| Ga0326726_106585362 | 3300033433 | Peat Soil | MWEIIIAELTQAVQELARGFAHYLPRLIVMLIIAFLGWVIACLLKVLARSI |
| Ga0310811_112170362 | 3300033475 | Soil | MREMIIGELTQAVHDLARGFAHYLPRLIVMLILVLAGWLI |
| Ga0316214_10246101 | 3300033545 | Roots | MREMIISELSQAVHDLARGFAHYLPRLIVMLVIACVGWLIAYAVKVILR |
| Ga0316214_10511741 | 3300033545 | Roots | METVVSEVIMRQMIIDELTQAMQELTRGFAHILPRIIVLVIIAFAGWVVAYL |
| Ga0334847_013431_2_124 | 3300033826 | Soil | MREMIISELSQALHEIARGFAHFLPRLIVMLILVFVGWVIA |
| Ga0334792_144094_2_112 | 3300033888 | Soil | MREMIISELSQALHEIARSFAHFLPRLIVMLILALVG |
| ⦗Top⦘ |