| Basic Information | |
|---|---|
| Family ID | F036032 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 171 |
| Average Sequence Length | 43 residues |
| Representative Sequence | LALNALDLMPRGFRLLVVQLRGSGARQPPLRAVHNRHHHFQIA |
| Number of Associated Samples | 161 |
| Number of Associated Scaffolds | 171 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 26.32 % |
| % of genes near scaffold ends (potentially truncated) | 23.39 % |
| % of genes from short scaffolds (< 2000 bps) | 90.64 % |
| Associated GOLD sequencing projects | 152 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.33 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.322 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (9.357 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.468 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.047 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.80% β-sheet: 0.00% Coil/Unstructured: 66.20% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 171 Family Scaffolds |
|---|---|---|
| PF13384 | HTH_23 | 23.39 |
| PF00665 | rve | 19.88 |
| PF01695 | IstB_IS21 | 4.09 |
| PF02195 | ParBc | 1.75 |
| PF00589 | Phage_integrase | 1.17 |
| PF16355 | DUF4982 | 0.58 |
| PF13183 | Fer4_8 | 0.58 |
| COG ID | Name | Functional Category | % Frequency in 171 Family Scaffolds |
|---|---|---|---|
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 19.88 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 19.88 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 19.88 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 19.88 |
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 4.09 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.32 % |
| Unclassified | root | N/A | 4.68 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908041|P3_CLC_ConsensusfromContig83492 | All Organisms → cellular organisms → Bacteria | 1617 | Open in IMG/M |
| 2140918006|ConsensusfromContig119092 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 2140918007|ConsensusfromContig195764 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 2140918024|NODE_190269_length_2220_cov_8.247747 | All Organisms → cellular organisms → Bacteria | 2270 | Open in IMG/M |
| 3300000567|JGI12270J11330_10035724 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 2844 | Open in IMG/M |
| 3300001356|JGI12269J14319_10169161 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300001385|JGI20193J14888_1015244 | All Organisms → cellular organisms → Bacteria | 1401 | Open in IMG/M |
| 3300002068|JGIcombinedJ21913_10108131 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
| 3300002347|JGIcombinedJ26865_1054263 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300002558|JGI25385J37094_10107185 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300004019|Ga0055439_10026095 | All Organisms → cellular organisms → Bacteria | 1447 | Open in IMG/M |
| 3300005179|Ga0066684_10758560 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300005340|Ga0070689_100994278 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300005355|Ga0070671_101390443 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300005518|Ga0070699_100666550 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300005526|Ga0073909_10614560 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300005559|Ga0066700_10975612 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300005568|Ga0066703_10156240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1371 | Open in IMG/M |
| 3300005587|Ga0066654_10080306 | All Organisms → cellular organisms → Bacteria | 1527 | Open in IMG/M |
| 3300005602|Ga0070762_10750182 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300005944|Ga0066788_10035987 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
| 3300005949|Ga0066791_10034844 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
| 3300005980|Ga0066798_10222463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 508 | Open in IMG/M |
| 3300005993|Ga0080027_10268941 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300005995|Ga0066790_10109466 | All Organisms → cellular organisms → Bacteria | 1185 | Open in IMG/M |
| 3300005995|Ga0066790_10171772 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| 3300006034|Ga0066656_10115326 | All Organisms → cellular organisms → Bacteria | 1647 | Open in IMG/M |
| 3300006050|Ga0075028_100964143 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300006052|Ga0075029_101117983 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300006059|Ga0075017_100537029 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300006162|Ga0075030_100039416 | All Organisms → cellular organisms → Bacteria | 3996 | Open in IMG/M |
| 3300006358|Ga0068871_101578553 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300006642|Ga0075521_10547160 | Not Available | 569 | Open in IMG/M |
| 3300006791|Ga0066653_10273376 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300006794|Ga0066658_10766265 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300006795|Ga0075520_1371283 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300006800|Ga0066660_10510188 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
| 3300006854|Ga0075425_102522784 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300006864|Ga0066797_1322813 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300006893|Ga0073928_10616211 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300009088|Ga0099830_10547899 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
| 3300009523|Ga0116221_1200514 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300009524|Ga0116225_1168379 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300009547|Ga0116136_1037003 | All Organisms → cellular organisms → Bacteria | 1444 | Open in IMG/M |
| 3300009636|Ga0116112_1058256 | All Organisms → cellular organisms → Bacteria | 1130 | Open in IMG/M |
| 3300009660|Ga0105854_1329284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 540 | Open in IMG/M |
| 3300009665|Ga0116135_1190752 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300009672|Ga0116215_1105454 | All Organisms → cellular organisms → Bacteria | 1262 | Open in IMG/M |
| 3300009672|Ga0116215_1307361 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300009814|Ga0105082_1008866 | All Organisms → cellular organisms → Bacteria | 1396 | Open in IMG/M |
| 3300009824|Ga0116219_10094851 | All Organisms → cellular organisms → Bacteria | 1743 | Open in IMG/M |
| 3300010039|Ga0126309_10801316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 615 | Open in IMG/M |
| 3300010303|Ga0134082_10285732 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300010337|Ga0134062_10717293 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300010375|Ga0105239_11848030 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300011269|Ga0137392_11155050 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300012205|Ga0137362_10426094 | Not Available | 1149 | Open in IMG/M |
| 3300012206|Ga0137380_11257310 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300012208|Ga0137376_10916617 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300012210|Ga0137378_10362843 | All Organisms → cellular organisms → Bacteria | 1345 | Open in IMG/M |
| 3300012285|Ga0137370_11015601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 510 | Open in IMG/M |
| 3300012350|Ga0137372_10368083 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
| 3300012354|Ga0137366_10610648 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300012362|Ga0137361_11399630 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300012922|Ga0137394_10581057 | Not Available | 948 | Open in IMG/M |
| 3300012958|Ga0164299_10203287 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
| 3300012960|Ga0164301_10278274 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
| 3300012972|Ga0134077_10080880 | All Organisms → cellular organisms → Bacteria | 1237 | Open in IMG/M |
| 3300014169|Ga0181531_10125246 | All Organisms → cellular organisms → Bacteria | 1545 | Open in IMG/M |
| 3300014201|Ga0181537_10466676 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300014490|Ga0182010_10138416 | All Organisms → cellular organisms → Bacteria | 1247 | Open in IMG/M |
| 3300014490|Ga0182010_10371302 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300014494|Ga0182017_10033150 | All Organisms → cellular organisms → Bacteria | 3504 | Open in IMG/M |
| 3300014495|Ga0182015_10956140 | Not Available | 534 | Open in IMG/M |
| 3300014496|Ga0182011_10646647 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300014498|Ga0182019_11429162 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300014499|Ga0182012_10108933 | All Organisms → cellular organisms → Bacteria | 2064 | Open in IMG/M |
| 3300014501|Ga0182024_11154947 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
| 3300014501|Ga0182024_12842633 | Not Available | 514 | Open in IMG/M |
| 3300014654|Ga0181525_10484127 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300014658|Ga0181519_10042591 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 3059 | Open in IMG/M |
| 3300014839|Ga0182027_12103823 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300015082|Ga0167662_1047916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 532 | Open in IMG/M |
| 3300015197|Ga0167638_1028184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1292 | Open in IMG/M |
| 3300015245|Ga0137409_11014114 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300016270|Ga0182036_11861787 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300017941|Ga0187850_10324075 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300017948|Ga0187847_10108322 | All Organisms → cellular organisms → Bacteria | 1529 | Open in IMG/M |
| 3300018004|Ga0187865_1296384 | Not Available | 534 | Open in IMG/M |
| 3300018006|Ga0187804_10385530 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300018020|Ga0187861_10482342 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300018034|Ga0187863_10414613 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300018046|Ga0187851_10230016 | All Organisms → cellular organisms → Bacteria | 1092 | Open in IMG/M |
| 3300018076|Ga0184609_10285190 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300020022|Ga0193733_1152507 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300021180|Ga0210396_11453242 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300021363|Ga0193699_10415287 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300021477|Ga0210398_10942027 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300021478|Ga0210402_10005292 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 11581 | Open in IMG/M |
| 3300022756|Ga0222622_10025729 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 3068 | Open in IMG/M |
| 3300023091|Ga0224559_1071824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1326 | Open in IMG/M |
| 3300024225|Ga0224572_1068934 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300024288|Ga0179589_10558537 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300025324|Ga0209640_10452859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1052 | Open in IMG/M |
| 3300025457|Ga0208850_1058687 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300025484|Ga0208587_1032881 | All Organisms → cellular organisms → Bacteria | 1430 | Open in IMG/M |
| 3300025907|Ga0207645_10142740 | All Organisms → cellular organisms → Bacteria | 1560 | Open in IMG/M |
| 3300025913|Ga0207695_10457177 | All Organisms → cellular organisms → Bacteria | 1160 | Open in IMG/M |
| 3300025931|Ga0207644_11025727 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300025960|Ga0207651_11646033 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300026216|Ga0209903_1020915 | All Organisms → cellular organisms → Bacteria | 1075 | Open in IMG/M |
| 3300026216|Ga0209903_1022270 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
| 3300026217|Ga0209871_1008558 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1925 | Open in IMG/M |
| 3300026294|Ga0209839_10088846 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
| 3300026370|Ga0256816_1003424 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300026524|Ga0209690_1234971 | Not Available | 576 | Open in IMG/M |
| 3300026537|Ga0209157_1149026 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
| 3300026982|Ga0207854_1017150 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300027273|Ga0209886_1019989 | All Organisms → cellular organisms → Bacteria | 1000 | Open in IMG/M |
| 3300027590|Ga0209116_1104042 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300027625|Ga0208044_1058991 | All Organisms → cellular organisms → Bacteria | 1201 | Open in IMG/M |
| 3300027641|Ga0208827_1216832 | Not Available | 503 | Open in IMG/M |
| 3300027667|Ga0209009_1071415 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300027831|Ga0209797_10057108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1733 | Open in IMG/M |
| 3300027831|Ga0209797_10456163 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300027846|Ga0209180_10179734 | All Organisms → cellular organisms → Bacteria | 1220 | Open in IMG/M |
| 3300027853|Ga0209274_10656410 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300027862|Ga0209701_10286490 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300027882|Ga0209590_10237896 | All Organisms → cellular organisms → Bacteria | 1159 | Open in IMG/M |
| 3300027884|Ga0209275_10587055 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300027895|Ga0209624_10026453 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 3682 | Open in IMG/M |
| 3300027895|Ga0209624_10540047 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300027908|Ga0209006_10107301 | All Organisms → cellular organisms → Bacteria | 2473 | Open in IMG/M |
| 3300028020|Ga0265351_1001558 | All Organisms → cellular organisms → Bacteria | 1559 | Open in IMG/M |
| 3300028651|Ga0302171_10170840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 537 | Open in IMG/M |
| 3300028665|Ga0302160_10034056 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300028768|Ga0307280_10328635 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300029984|Ga0311332_10610082 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300030007|Ga0311338_11188922 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 724 | Open in IMG/M |
| 3300030019|Ga0311348_10143132 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1774 | Open in IMG/M |
| 3300030399|Ga0311353_10695428 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300030659|Ga0316363_10034757 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2535 | Open in IMG/M |
| 3300030707|Ga0310038_10340218 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300030737|Ga0302310_10446683 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300030763|Ga0265763_1036546 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300030838|Ga0311335_10967101 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300031122|Ga0170822_10952392 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300031231|Ga0170824_124891996 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300031234|Ga0302325_11956240 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300031236|Ga0302324_101852816 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300031344|Ga0265316_10558714 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300031446|Ga0170820_15895042 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300031474|Ga0170818_115101498 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300031521|Ga0311364_11650340 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300031823|Ga0307478_11274233 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300031938|Ga0308175_100170731 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2109 | Open in IMG/M |
| 3300031939|Ga0308174_10186107 | All Organisms → cellular organisms → Bacteria | 1574 | Open in IMG/M |
| 3300031996|Ga0308176_12066731 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300031996|Ga0308176_12821445 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300032074|Ga0308173_10096186 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2292 | Open in IMG/M |
| 3300032076|Ga0306924_11356533 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300032160|Ga0311301_10025089 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 16170 | Open in IMG/M |
| 3300032160|Ga0311301_12507121 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300032160|Ga0311301_12751239 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300032770|Ga0335085_11453615 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 716 | Open in IMG/M |
| 3300032828|Ga0335080_10172053 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2392 | Open in IMG/M |
| 3300033402|Ga0326728_10178180 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2207 | Open in IMG/M |
| 3300033433|Ga0326726_11852401 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300033486|Ga0316624_12180218 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300034065|Ga0334827_119763 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300034124|Ga0370483_0059558 | All Organisms → cellular organisms → Bacteria | 1216 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.36% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 8.19% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 5.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.09% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 4.09% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.51% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 3.51% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 3.51% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.34% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 2.34% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.92% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.92% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.92% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.75% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.75% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.75% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.75% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.17% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 1.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.17% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 1.17% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.17% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.17% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.17% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.17% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.17% |
| Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 0.58% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.58% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.58% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.58% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.58% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.58% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.58% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.58% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.58% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.58% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.58% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.58% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.58% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.58% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.58% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.58% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.58% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.58% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.58% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.58% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.58% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.58% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908041 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P3 | Environmental | Open in IMG/M |
| 2140918006 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P1 | Environmental | Open in IMG/M |
| 2140918007 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_all | Environmental | Open in IMG/M |
| 2140918024 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_all | Environmental | Open in IMG/M |
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001385 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-092012 | Environmental | Open in IMG/M |
| 3300002068 | Barrow Graham LP Ref core NGADG0004-212 (Barrow Graham LP Ref core NGADG0004-212,NGADG0011-311, ASSEMBLY_DATE=20131010) | Environmental | Open in IMG/M |
| 3300002347 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-072012 (NGEE Surface samples 415 (1, 2, 3 deep-072012) AP id is 1030520, ASSEMBLY_DATE=20131219) | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004019 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
| 3300005949 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil leachate replicate DNA2013-051 | Environmental | Open in IMG/M |
| 3300005980 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil leachate replicate DNA2013-203 | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006795 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006864 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009547 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 | Environmental | Open in IMG/M |
| 3300009636 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 | Environmental | Open in IMG/M |
| 3300009660 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-058 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009814 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014490 | Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaG | Environmental | Open in IMG/M |
| 3300014494 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014496 | Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaG | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014499 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
| 3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015082 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11c, vegetated hydrological feature) | Environmental | Open in IMG/M |
| 3300015197 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6B, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300018004 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300023091 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 30-34 | Environmental | Open in IMG/M |
| 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5 | Host-Associated | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025457 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025484 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026216 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil leachate replicate DNA2013-051 (SPAdes) | Environmental | Open in IMG/M |
| 3300026217 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes) | Environmental | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300026370 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 F5 | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026982 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 7 (SPAdes) | Environmental | Open in IMG/M |
| 3300027273 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 (SPAdes) | Environmental | Open in IMG/M |
| 3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027831 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028020 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE4 | Environmental | Open in IMG/M |
| 3300028651 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_2 | Environmental | Open in IMG/M |
| 3300028665 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_3 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030019 | II_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030838 | I_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| 3300034065 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 1-5 | Environmental | Open in IMG/M |
| 3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| P3_CLC_01256630 | 2124908041 | Soil | MELLLNALQLMPRGLALLVIQLRGSRARQPTLRAVHNRHHHFQIA |
| P1_C_01920040 | 2140918006 | Soil | LALNALDLMPRGFALLGIQIRGRGASQSTLRAVHNRHHHLQIA |
| A_all_C_02615960 | 2140918007 | Soil | LALNALDLMPRGFRLLVVQLRGSGARQPPLRAVHNRHHHFQIA |
| B_all_v_01754210 | 2140918024 | Soil | MELLLNALQLMPRGLALLVIQLRGSRARQPTLRAAHNRHHHFQIA |
| JGI12270J11330_100357243 | 3300000567 | Peatlands Soil | MELFLNAIDLLPRGVRLLVIQIRGSGARQSPLRTVHNRHHHFQIA* |
| JGI12269J14319_101691612 | 3300001356 | Peatlands Soil | LALNALDLMPRGFRLLVIQLRDSGPRQSPLRAVHNRHHHFQIA* |
| JGI20193J14888_10152442 | 3300001385 | Arctic Peat Soil | MELLLNALQLMLRGLALLVIQLRGSRARQPTLRAAHNRHHHFQIA* |
| JGIcombinedJ21913_101081311 | 3300002068 | Arctic Peat Soil | LNALQLMLRGLALLVIQLRGSRARQPTLRAAHNRHH |
| JGIcombinedJ26865_10542632 | 3300002347 | Arctic Peat Soil | LNALQLMLRGLALLVIQLRGSRARQPTLRAAHNRHHHF |
| JGI25385J37094_101071852 | 3300002558 | Grasslands Soil | LVLNALDLMPRSLRLLVIQLRASGARQPPLRAVRNRHHHFQIA* |
| Ga0055439_100260951 | 3300004019 | Natural And Restored Wetlands | MELLLNTFQLIPRGLALLVIQLRGSCARQPTLRAVHNRHHHFQIA* |
| Ga0066684_107585602 | 3300005179 | Soil | LDYFVDAVELALNAFDLVPRGLRLLVIQLRGSGASQPPLRAVHNRHHHFQIA* |
| Ga0070689_1009942781 | 3300005340 | Switchgrass Rhizosphere | LNAVDLAPRGFALLVIQLRGSGAGQPPLRSVHNRGHHLQIP* |
| Ga0070671_1013904432 | 3300005355 | Switchgrass Rhizosphere | LNALDLALGGFAWLAIQLQSRGAGQSPVRTVHDRGHHLQIPYQFGR |
| Ga0070699_1006665502 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | LNAIDLMPRRFRLLGIQLHGSGAGQPPLRAVHDRHHHFQIA* |
| Ga0073909_106145601 | 3300005526 | Surface Soil | LNAIDLAPRGFALLVIQLRGSGAGQPPLRSVHNRGHHLQIP* |
| Ga0066700_109756122 | 3300005559 | Soil | LALNALDLMPRSLRLLVIQLHGSGARQPPLRAVHNRHHHFQIA* |
| Ga0066703_101562402 | 3300005568 | Soil | LVLNALDLMPRSLRLLVIQLCGSGARQPPLRSVHNRHHHLQIA* |
| Ga0066654_100803062 | 3300005587 | Soil | LLLNAFNLVPCGFRLLVIQLRDNGARQPPLRAVHNRHHHFQIA* |
| Ga0070762_107501821 | 3300005602 | Soil | LVLNTLDLTPRGLRLLLIQLRNSGASQPPLRAVHNRHHHFQIA* |
| Ga0066788_100359872 | 3300005944 | Soil | LLLNAFDLVPCGFRLLVIQLRDNGARQPPLRAIHYCHHHFQIA* |
| Ga0066791_100348442 | 3300005949 | Soil | LALNALDLMPRGLRLLGIQLGGSSASQSPLRAIHNRCHHLQIA* |
| Ga0066798_102224632 | 3300005980 | Soil | LALNALDLMPRGFALLVIQLGDRCARQPPLRAVHNRHHHFQIA* |
| Ga0080027_102689412 | 3300005993 | Prmafrost Soil | LALNALDLMPRGFALLVVQLRGRGASQSTLRAVHNRHHHLQIA* |
| Ga0066790_101094662 | 3300005995 | Soil | MELLLNALDLMPRGLRLLVIQIGGRARQSPLRAVHNRHHHFQIA* |
| Ga0066790_101717722 | 3300005995 | Soil | LALNALDLMPRGFALLVVHLGGSGASQPPLRAVQNRHHHFQIA* |
| Ga0066656_101153262 | 3300006034 | Soil | LALNALDLMPRGFALLVIQLRGSGASQPPLRAVHNRHHHLQIA* |
| Ga0075028_1009641431 | 3300006050 | Watersheds | VELLLNAVDLMPRGFRLLLIQLRGSGAGQPSLRAIHNRHHHLQ |
| Ga0075029_1011179831 | 3300006052 | Watersheds | LVLNVVDLMPRGFELLVIQLRGSGARQPTMHAVRDGGHHFQIA* |
| Ga0075017_1005370292 | 3300006059 | Watersheds | LALNAFYLMSRTFRLLLIQLRGSGAGQPPLRAVHDRHYHLQIA* |
| Ga0075030_1000394168 | 3300006162 | Watersheds | LVLNALDLMPRGLALLGIQLRGSGAGQPPLRAGHNRHHHLQIA* |
| Ga0068871_1015785531 | 3300006358 | Miscanthus Rhizosphere | MELLLNALDLMPRGSRLLAIQLHGTGAGQPPLRAVHNPHHHFQIAQ |
| Ga0075521_105471601 | 3300006642 | Arctic Peat Soil | MELLLNALQLMLRGLALLVIQLRGSRARQPALRAVHNRHHHFQIA* |
| Ga0066653_102733762 | 3300006791 | Soil | LVLNALDLLPRSLRLLVIQLRGGSPRQPPLRAVHNRHHHFQIA* |
| Ga0066658_107662653 | 3300006794 | Soil | LNALDLMPRSLRLLVIQLRASGARQPPLRAVRNRHHHFQ |
| Ga0075520_13712832 | 3300006795 | Arctic Peat Soil | MELLLNAFQLMPRGLALLVIQLRGSCARQPALRAVHNRHHHFQIA* |
| Ga0066660_105101882 | 3300006800 | Soil | LVLNTIDLVPCGLALLVIQLCGSGARQPPLRAAHNRHHHLQIS* |
| Ga0075425_1025227841 | 3300006854 | Populus Rhizosphere | VELFLNAIHLVPRGLRLLVIQLSGSGPRQPALRAVHNRHHHF |
| Ga0066797_13228131 | 3300006864 | Soil | LDFFVDAMELLLNAVDLMPHGFALLGIQLHGSGPRQPAMRTVHNRHHHFQIA* |
| Ga0073928_106162112 | 3300006893 | Iron-Sulfur Acid Spring | LNAVDLMPRSLELLVIQLRGSGARQPTMRAVRDGGHHF |
| Ga0099830_105478991 | 3300009088 | Vadose Zone Soil | LVLNTIDLAPCGFALLVIQLGGSGARQPPLRAVHNRHHHLQIS* |
| Ga0116221_12005142 | 3300009523 | Peatlands Soil | LLLNAFDLVPCGFRLLVIQLRDNGASQPPLRAVHNLHHHFQIA* |
| Ga0116225_11683792 | 3300009524 | Peatlands Soil | MELLLNPIDLVPRGFRLLFIQLCGSGAGQPPLRAVDDRHHHLQVA* |
| Ga0116136_10370032 | 3300009547 | Peatland | VELLLNAFDLMPRGFRLLLIQLRDSGASQPPLRAVYNRYHHFQIA* |
| Ga0116112_10582562 | 3300009636 | Peatland | VELLLNAFDLMPRGFRLLLIQLRDSTARQPPLRAVHNRHHHFQIA* |
| Ga0105854_13292842 | 3300009660 | Permafrost Soil | MPRGIRLLGIQIHGSGARQPSLRPVHNRHHHFQIA* |
| Ga0116135_11907522 | 3300009665 | Peatland | VAEFVLNALDLMPRGSRLLAVQLRGCGAGQSPLRAVHN |
| Ga0116215_11054542 | 3300009672 | Peatlands Soil | LVLNALDLVLGGFRLLVIQLRGRGSGQPPVRAVYDRHHHFQIA* |
| Ga0116215_13073612 | 3300009672 | Peatlands Soil | MELLLNALNLLPRGFRLLLIQFRGSGAGQPTLRAVHNRHHHFQIA* |
| Ga0105082_10088662 | 3300009814 | Groundwater Sand | LVLNALDLMPRGFRLLGIQLHGSGAGQPPLRAVHDGHHHI |
| Ga0116219_100948512 | 3300009824 | Peatlands Soil | VDLALNALDLLPRGFRLLVIQLRGSGARQSPLRAVHNRHHHLQVA* |
| Ga0126309_108013162 | 3300010039 | Serpentine Soil | LLLNAVDLMPRGFRLLGIQLRGSGARQPSLRAVHDRHHHFQIA* |
| Ga0134082_102857322 | 3300010303 | Grasslands Soil | LVLNTLDLMPRGFALLVVQLRGSGPRQPPLRSVHNRHHHFQIA* |
| Ga0134062_107172932 | 3300010337 | Grasslands Soil | LVLNALDLMPRSLRLLVIQLHGSGARQPPLRSVHDRRHHLQI |
| Ga0105239_118480302 | 3300010375 | Corn Rhizosphere | LVLNALDLLPRSLRLLVIQLRGSSPHQPPLRAGHNRQRHFQIA* |
| Ga0137392_111550502 | 3300011269 | Vadose Zone Soil | LVFNTIDLAPCGIALLSIQFCDSGSGQPPLRAVHNRDHHLQIS* |
| Ga0137362_104260942 | 3300012205 | Vadose Zone Soil | LVLNAVDLMPRGLALLVIQLRGSGARQPPLGAVHNRDHHLQIS* |
| Ga0137380_112573102 | 3300012206 | Vadose Zone Soil | MELLLNALQLMPRGLALLVIQLRGSRARQPTLRAVHNRHHHFQIA* |
| Ga0137376_109166171 | 3300012208 | Vadose Zone Soil | LVLNALDLMPRGSRLLTIQLRRGGARQPPLRAVHNRHHHFQIA* |
| Ga0137378_103628431 | 3300012210 | Vadose Zone Soil | LVLNALDLLPRGLHLLVIQLCDSGARQPPLRAVHNRRHHLQIA* |
| Ga0137370_110156012 | 3300012285 | Vadose Zone Soil | LNTIDLMPRSFRLLVIQLCGARQPPLRSVHNRHHHLQIA* |
| Ga0137372_103680831 | 3300012350 | Vadose Zone Soil | LAFNTLDLMPRGFRLLVVQLRGSGARQPPLRAGHN |
| Ga0137366_106106482 | 3300012354 | Vadose Zone Soil | LAFNTLDLMPRGFRLLVVQLRGSGARQPPLRAVHNRHHHFQIA* |
| Ga0137361_113996302 | 3300012362 | Vadose Zone Soil | LTLNALDLIPRSLRLLVIQLCGSGARQPPLRSVHNR |
| Ga0137394_105810572 | 3300012922 | Vadose Zone Soil | LVLNAVDLMPRGLALLVIQLRGSGARQPPLRAVHNRHH |
| Ga0164299_102032871 | 3300012958 | Soil | LALNALDLMPRGFRLLVVQLRDRGASQSPLRAIHNRHHHLQIA* |
| Ga0164301_102782741 | 3300012960 | Soil | LALNALDLMPRGFRLLVVQLRDRGASQSPLRAIHNRHHRLQIA* |
| Ga0134077_100808802 | 3300012972 | Grasslands Soil | LNAVDLMLRGFALLVIQLRGSGARQPAMRAVHDGGHHFQIA* |
| Ga0181531_101252461 | 3300014169 | Bog | VLNAVDLMPRGLALLVIQLRGSGARQPPMHSVHNRDHHLQIS* |
| Ga0181537_104666762 | 3300014201 | Bog | LNALDLMPCGFRLLVIQLRSSGAGQSPLRTGYNRDHHLKVA* |
| Ga0182010_101384161 | 3300014490 | Fen | LFLNAIDLLPRGFRLLVIQIRGGGAGQSPLRAVHDRQHHLQVA* |
| Ga0182010_103713022 | 3300014490 | Fen | MELALNAVDLAPRGFRLLVIQLHGSGASQPSLRAGHDRHHHLQIA* |
| Ga0182017_100331505 | 3300014494 | Fen | LFLNAIDLLPRGFRLLVIQIRGGGAGQSPLRAVHDRHH |
| Ga0182015_109561402 | 3300014495 | Palsa | LLLNAFNLVPCGFRLLVIQLRDSRARQPPLRTVHNRHHHFQIA* |
| Ga0182011_106466472 | 3300014496 | Fen | LALNALDLMPRGFALLVVHLGGSGARQPTLRAVHNRHHHFQIA* |
| Ga0182019_114291622 | 3300014498 | Fen | LFLNAFNLVPCGFRLLVIQLRDNGARQSPLRAVHNRHHHLQIA* |
| Ga0182012_101089332 | 3300014499 | Bog | LLLNAFNLVPCGFRLLVIQLRDNGARQPPLRAVHNRHHHFQIAQ* |
| Ga0182024_111549472 | 3300014501 | Permafrost | MELLLNAVDLMPRSFALLVIQLGGSGGRQPTMRSVRDGGHHFQ |
| Ga0182024_128426332 | 3300014501 | Permafrost | MELLLNALDLVPRGFRLLVIQLRDSSARQPPLRAVHYRHHHFQIA* |
| Ga0181525_104841273 | 3300014654 | Bog | LNAVDLMPRGFALLVIQLRGSGARQPTMRAVHNRDNHLQVA* |
| Ga0181519_100425914 | 3300014658 | Bog | VLNAVDLMPRGFALLVIQLRGSGARQPPMHSVHNRDHHLQIS* |
| Ga0182027_121038231 | 3300014839 | Fen | VELPLNPIDLVPRGFRLLFIQLCGSGAGQLPLRAVDDRHHHLQVA* |
| Ga0167662_10479162 | 3300015082 | Glacier Forefield Soil | LNALDLMPRGFRLLVVQLRGSGARQPPLRAVHNRHHHFQIA* |
| Ga0167638_10281842 | 3300015197 | Glacier Forefield Soil | LALNALDLMPRGFRLLRIQVHGSGASQPPLRAVHNRHHHFQIA* |
| Ga0137409_110141142 | 3300015245 | Vadose Zone Soil | LALNALNLMAYCFALLVVQLRGSGARQPPLGAVHNRDHHLQIS* |
| Ga0182036_118617871 | 3300016270 | Soil | MELLLNAIDLMPRGAALLVIQLRGSGAGQPPLRSVHNRHHHLQLAQEFSAGS |
| Ga0187850_103240751 | 3300017941 | Peatland | LALNTLDLMPRGFRLLVIQLRHSGAGQLPLRAVHNRHHHFQIA |
| Ga0187847_101083222 | 3300017948 | Peatland | VELLLNAFDLMPRGFRLLLIQLRDSGASQPPLRAVYNRYHHFQIA |
| Ga0187865_12963841 | 3300018004 | Peatland | VLNAVDLMPRGFALLVIQLRGSGARQPPMHSVHNRDHHLQIS |
| Ga0187804_103855302 | 3300018006 | Freshwater Sediment | MELLLNAIDLVPRGFRLLIIQLRGSGARQPPLRAVHNRHHHLQIA |
| Ga0187861_104823421 | 3300018020 | Peatland | VAEFVLNALDLMPRGSRLLAVQLRGCGAGQSPLRAVHNRHHHFQIA |
| Ga0187863_104146131 | 3300018034 | Peatland | LVLNAVDLMPRGFALLVIQLRDNGTRQPPLRAVHNRHHHFQIA |
| Ga0187851_102300161 | 3300018046 | Peatland | LALNALDLMPRGFPLLVVQLRAGGARQPPLRAVHNRYHHFQIA |
| Ga0184609_102851901 | 3300018076 | Groundwater Sediment | LVLNALDLMPRSLRLLVIQLCGSSARQPPLRSVHNRHRHFQIA |
| Ga0193733_11525072 | 3300020022 | Soil | LALNALDLMPRGFALLVVQLRGRCARQSTLRAVHNRHHHLQIA |
| Ga0210396_114532422 | 3300021180 | Soil | LNAFNLVPCGFRLLVIQLRDNGARQPPLRAVHNRHHHFQIA |
| Ga0193699_104152872 | 3300021363 | Soil | LNALDLMPRGLRLLVIQLRHSGARQSPLRAVHNRHHHFQIA |
| Ga0210398_109420271 | 3300021477 | Soil | MKLLLNAVDLMPRGCALLVIQLRGSGARQPTMRSVRDGGHHFQIA |
| Ga0210402_1000529210 | 3300021478 | Soil | LALNALDLMPRGFRLLVVHLGGSGARQPPLRAVHNRHHHLQIA |
| Ga0222622_100257295 | 3300022756 | Groundwater Sediment | LALNALDLMPRGFALLVVQLLGRCARQSTLRAVHNRHHHLQIT |
| Ga0224559_10718242 | 3300023091 | Soil | VELALNALDLMPRGFALLVVQLSGRCARQSTLRAVYNRHHHFEIA |
| Ga0224572_10689342 | 3300024225 | Rhizosphere | LNALNLAPRGVALLAIQIDRRRAGQPPLRAVHNRRHHFQIAEQFGARPRGRPGCSSL |
| Ga0179589_105585371 | 3300024288 | Vadose Zone Soil | LNALDLMLCGFALLGIQIRGSGASQSTLRPVHNRHHHLQIA |
| Ga0209640_104528591 | 3300025324 | Soil | MAELVLNALDLMPRGLRLLAIQLRGSGVGQPPLRPVHDRHHHFQIA |
| Ga0208850_10586871 | 3300025457 | Arctic Peat Soil | MELLLNALQLMLRGLALLVIQLRGSRARQPTLRAAHNRHHHFQIA |
| Ga0208587_10328812 | 3300025484 | Arctic Peat Soil | MELLLNALQLMPRGLALLVIQLRGCRARQPTLRAVHNRHHHFQIA |
| Ga0207645_101427402 | 3300025907 | Miscanthus Rhizosphere | LNAFDLLPCGFRLLVIQLRRGGARQPPLRAVHNCHHHFQIA |
| Ga0207695_104571771 | 3300025913 | Corn Rhizosphere | LNVLDLMPRDFCLLVIQLRGSGSGQPPLRAVHDRHHHLQIAQQFGA |
| Ga0207644_110257272 | 3300025931 | Switchgrass Rhizosphere | LNAVDLAPRGLALLVIQLRGSGAGQPPLRSVHNRGY |
| Ga0207651_116460331 | 3300025960 | Switchgrass Rhizosphere | LFLNAFNLVPCGFRLLVIQLRDNGARQPPLRAVHNRHHHFQIA |
| Ga0209903_10209151 | 3300026216 | Soil | LLLNAFDLVPCGFRLLVIQLRDNGARQPPLRAIHYCHHHFQIA |
| Ga0209903_10222702 | 3300026216 | Soil | LALNALDLMPRGLRLLGIQLGGSSASQSPLRAIHNRCHHLQIA |
| Ga0209871_10085581 | 3300026217 | Permafrost Soil | MELLLNALDLMPRGFALLVIQLRGRGASQPPLGSVHNRYYHFQIA |
| Ga0209839_100888462 | 3300026294 | Soil | MELLLNALDLMPRGLRLLGIQLGGSSASQSPLRAIHNRCHHLQIA |
| Ga0256816_10034242 | 3300026370 | Sediment | LVLNALDLMPRGSRLLAIQLRGSGAVQPPLRAVHDSHHHLQIPQQFGASPG |
| Ga0209690_12349712 | 3300026524 | Soil | LALNALDLMPRSLRLLVIQLHGSGARQPPLRAVHNRHHHFQIA |
| Ga0209157_11490262 | 3300026537 | Soil | LVLNALDLLPRSLRLLGIQLHGGGARQPPLRAVHNRHHHFQIA |
| Ga0207854_10171501 | 3300026982 | Tropical Forest Soil | MKPFLNALDLMPRCFGLLVIQLHGSGARQPPLGAVYNRHHHLQIA |
| Ga0209886_10199892 | 3300027273 | Groundwater Sand | LNALDLMPRGFRLLGIQLHGSGAAQPPLRAVHDGHHHFQ |
| Ga0209116_11040422 | 3300027590 | Forest Soil | LVLNVVDLTPRGFELLVIQLRGSGAREPTKRAVRDGGHHFQIA |
| Ga0208044_10589912 | 3300027625 | Peatlands Soil | MELLLNALNLLPRGFRLLLIQFRGSGAGQPTLRAVHNRHHHFQIA |
| Ga0208827_12168322 | 3300027641 | Peatlands Soil | LLLNAFDLVPCGFRLLVIQLRDNGASQPPLRAVHNLHPHFQIA |
| Ga0209009_10714151 | 3300027667 | Forest Soil | LALNALDLMPRGFRLLVIQLRGSSASQPSLRAVHNRHYHFQIT |
| Ga0209797_100571081 | 3300027831 | Wetland Sediment | VDAAELVLNALDLLPRGFRLLRIQLHGCGASQPPLRPGHNRQRHFQIA |
| Ga0209797_104561632 | 3300027831 | Wetland Sediment | LVLNALDLMPRGFALLVVQFGGSGARQPPLRPVHNRHHHFQIA |
| Ga0209180_101797342 | 3300027846 | Vadose Zone Soil | LVLNALDLMPRSLRLLVIQLRASGARQPPLRAVRNRHHHFQIA |
| Ga0209274_106564102 | 3300027853 | Soil | LVLNALDLMPCGFRLLVIQLRGRGASQSPLRAVHNRHHHLQIA |
| Ga0209701_102864902 | 3300027862 | Vadose Zone Soil | LVLNTIDLAPCGFALLVIQLGGSGARQPPLRAVHNRHHHLQIAQ |
| Ga0209590_102378961 | 3300027882 | Vadose Zone Soil | LALNALDLMPRGFRLLGIQIDHRCAGQPPLRAAHNRGHHLQIP |
| Ga0209275_105870552 | 3300027884 | Soil | LVLNTLDLTPRGLRLLLIQLRNSGASQPPLRAVHNRHHHFQIA |
| Ga0209624_100264531 | 3300027895 | Forest Soil | MELLLNPIDLVPRGFRLLFIQLCGSGAGQPPLRAVDDSHHHLQVA |
| Ga0209624_105400472 | 3300027895 | Forest Soil | LLLNALNLVPCGFRLLVIQLRDNGARQPPLRAVHNRHHHFQIA |
| Ga0209006_101073012 | 3300027908 | Forest Soil | LLLNAFNLVPCGFRLLVIQLRDNGARQPPLRAVHNRHHHFQIA |
| Ga0265351_10015582 | 3300028020 | Soil | LLLNAFNLVPCGFRLLVIQLRDSRARQPPLRTVHNRHHHFQIA |
| Ga0302171_101708402 | 3300028651 | Fen | LALNALDLMPRGFRLLVIQLGGGGASQPPLRAVHNRHYHFQIA |
| Ga0302160_100340562 | 3300028665 | Fen | MELLLNALDLMPRGFGLLVIQLRGSRARQPPLRAVHNRHYHF |
| Ga0307280_103286352 | 3300028768 | Soil | LALNTLDLMPRGFRLLVVQLRGSGARQPPLRAVHNRHHHFQIA |
| Ga0311332_106100822 | 3300029984 | Fen | LLLNAFNLVPCGFRLLVIQFRDNGARQPPLRAVHNRHHHFQIA |
| Ga0311338_111889222 | 3300030007 | Palsa | MELPLNAVDLIPRGFALLVIQLRGGGARQPAMRSVRYGNHHFQIA |
| Ga0311348_101431323 | 3300030019 | Fen | MELLLNALDLMPRGFGLLVIQLRGSRARQPPLRAVHNRHYHFQI |
| Ga0311353_106954282 | 3300030399 | Palsa | MELFFNTFDLMPRGFRLLVIQLRRGGGQSPLRTVHNRHHHFQIA |
| Ga0316363_100347574 | 3300030659 | Peatlands Soil | MELFLNAIDLLPRGVRLLVIQIRGSGARQSPLRTVHN |
| Ga0310038_103402182 | 3300030707 | Peatlands Soil | LVLNALDLVLGGFRLLVIQLRGRGSGQPPVRAVYDRHHHFQIA |
| Ga0302310_104466832 | 3300030737 | Palsa | VLNAVDLMPRGFALLLIQLRGSGARQPTMRAVRDGGHHFQIAQQFG |
| Ga0265763_10365462 | 3300030763 | Soil | VELALNALDLMPRGLRLLVIQLGGRGASQPPLRAVHNRHHHFQIA |
| Ga0311335_109671011 | 3300030838 | Fen | VNALDLMPCGFRLLVIQLRGCGASQSPLRAVHNRHHHLQIA |
| Ga0170822_109523922 | 3300031122 | Forest Soil | LNALDLMPRGFALLVIQLRGSGASQPPLRAVHNRHHHFQ |
| Ga0170824_1248919962 | 3300031231 | Forest Soil | MELLLNAVDLMPRGFRLLLIQLRGSGASQSPLRAVHDRHHHFQIAQQFGARSG |
| Ga0302325_119562402 | 3300031234 | Palsa | LVLNAVNLMLRGVELLVIQLRGSGTSQPTMRAIRDGGHHFQIA |
| Ga0302324_1018528162 | 3300031236 | Palsa | LVLNAVNLMLRGFELLVIQLRGSGTSQPTMRAIRDGGHHFQIA |
| Ga0265316_105587142 | 3300031344 | Rhizosphere | LFLNAIDLLPRGFRLLVIQIRGGGAGQSPLRAVHDRHHHLQIA |
| Ga0170820_158950421 | 3300031446 | Forest Soil | LNAFNLVPCGFRLLVIQLRDNGARLPPLRAVHNRHHQ |
| Ga0170818_1151014982 | 3300031474 | Forest Soil | LLLNAFNLVPCGFRSLVIQLRGNGARQPPLRAVHNRHHHFQIA |
| Ga0311364_116503402 | 3300031521 | Fen | LLLNAFDLVSCGFRLLVIQLRDNGARQPPLRTVHNRHHHFQIA |
| Ga0307478_112742332 | 3300031823 | Hardwood Forest Soil | LNAIDLMPRRFRLLGIQLHGSGAGQPPLRAVHDRHHHFQIA |
| Ga0308175_1001707313 | 3300031938 | Soil | VELALNALDLMPRGFALLVVQLSGRCARQSTLRAVHNRHHHFQIA |
| Ga0308174_101861072 | 3300031939 | Soil | VELALNALDLMPRGFRLLVVQLRDNGARQPPLRAVHNRHHHFQIA |
| Ga0308176_120667311 | 3300031996 | Soil | VELFLNAIHLVPRGLRLLVIQLSGSGPRQPALRAVHNRHHHFEIAQ |
| Ga0308176_128214452 | 3300031996 | Soil | MELLLNAIDLVSRGFRLLIIQFRGRGPRQPALRTVYNRHYHFQIAQQFGAR |
| Ga0308173_100961861 | 3300032074 | Soil | VELFLNAIHLVPRGLRLLVIQLSGSGPRQPALRAVHNRHH |
| Ga0306924_113565332 | 3300032076 | Soil | LYALDLMPRGFALLVIQLRDSGARQSPLRAVHNRHHHF |
| Ga0311301_100250894 | 3300032160 | Peatlands Soil | MELFLNAIDLLPRGVRLLVIQIRGSGARQSPLRTVHNRHHHFQIA |
| Ga0311301_125071212 | 3300032160 | Peatlands Soil | LNALDLMPRGFALLVVQLRGGGARQPPLRAVHNRRHHFQIAQQFGAGP |
| Ga0311301_127512391 | 3300032160 | Peatlands Soil | MELLLNPLDLVPRGFRLLVIQLRGGGAGQSPLRAVHDRRYHFQIAQQFG |
| Ga0335085_114536152 | 3300032770 | Soil | LVLNAVDLMPRGFALLVIQLRGSGARQPTMRSVRDGGHHLQIA |
| Ga0335080_101720533 | 3300032828 | Soil | LLLNAFNLVPCGFRFLVIQLRDNGARQPPLRAVHNRHHHFQIA |
| Ga0326728_101781805 | 3300033402 | Peat Soil | LLLNALDLAPRGFALLVIQLHGSGPGQPPLRAVHNRRHHLQIA |
| Ga0326726_118524011 | 3300033433 | Peat Soil | LALNAIDLMPRGFRLLGIQFHGCRTRQPSMRAVHDR |
| Ga0316624_121802182 | 3300033486 | Soil | MELLLNAIDLMPRGFRLLLIQLRGSCAGQPPLRAVHNRRYHFQ |
| Ga0334827_119763_642_776 | 3300034065 | Soil | LLLNAFNLVPCGFRLLVIQLRDNGARQPPLRAVHNRHHHFQIAQ |
| Ga0370483_0059558_858_983 | 3300034124 | Untreated Peat Soil | LNAFDLMPRGLRLLVVQIRGSGASQPPLRAVYNRHHHFQIA |
| ⦗Top⦘ |