NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F035958

Metagenome / Metatranscriptome Family F035958

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F035958
Family Type Metagenome / Metatranscriptome
Number of Sequences 171
Average Sequence Length 106 residues
Representative Sequence MQDPSVQMELFNLGIKMEQPGGKAPEELNKEKVVELVMASNDHAFDLFKKEYLDVMQKDPMIMPVLISALAHDWVFKNHNWSEDQFKAALFEHKIYEDPNVAQHMQRK
Number of Associated Samples 157
Number of Associated Scaffolds 171

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 50.00 %
% of genes near scaffold ends (potentially truncated) 29.24 %
% of genes from short scaffolds (< 2000 bps) 97.08 %
Associated GOLD sequencing projects 146
AlphaFold2 3D model prediction Yes
3D model pTM-score0.74

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (97.076 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(15.205 % of family members)
Environment Ontology (ENVO) Unclassified
(46.784 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(56.140 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 60.29%    β-sheet: 0.00%    Coil/Unstructured: 39.71%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.74
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
a.123.1.1: Nuclear receptor ligand-binding domaind7axea_7axe0.59376
c.52.1.4: Restriction endonuclease BglId1dmua_1dmu0.58975
a.104.1.0: automated matchesd3b6ha13b6h0.58367
a.123.1.1: Nuclear receptor ligand-binding domaind1nq7a_1nq70.58122
a.104.1.0: automated matchesd3awma_3awm0.57911


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.25 %
UnclassifiedrootN/A1.75 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000120|SA_S2_NOR13_50mDRAFT_c1010968All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1554Open in IMG/M
3300000736|JGI12547J11936_1086376All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea578Open in IMG/M
3300001263|BBAY83_10039411All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1562Open in IMG/M
3300002835|B570J40625_100494098All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1152Open in IMG/M
3300003216|JGI26079J46598_1088420All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea572Open in IMG/M
3300003413|JGI25922J50271_10073522All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea740Open in IMG/M
3300004112|Ga0065166_10225469All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea745Open in IMG/M
3300004463|Ga0063356_103813492All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea649Open in IMG/M
3300004788|Ga0007742_10714571All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata571Open in IMG/M
3300005433|Ga0066830_10106469All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea597Open in IMG/M
3300005662|Ga0078894_11049740All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea698Open in IMG/M
3300005986|Ga0075152_10754693All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea518Open in IMG/M
3300006033|Ga0075012_10178277All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1534Open in IMG/M
3300006072|Ga0007881_1033740All Organisms → cellular organisms → Bacteria1373Open in IMG/M
3300006100|Ga0007806_1079675All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea610Open in IMG/M
3300006165|Ga0075443_10199809All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea716Open in IMG/M
3300006355|Ga0075501_1006266All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1011Open in IMG/M
3300006394|Ga0075492_1438531All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea610Open in IMG/M
3300006415|Ga0099654_10220394All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1690Open in IMG/M
3300006641|Ga0075471_10272987All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea865Open in IMG/M
3300006803|Ga0075467_10144274All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1373Open in IMG/M
3300006803|Ga0075467_10325732All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea813Open in IMG/M
3300006805|Ga0075464_10603637All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea676Open in IMG/M
3300007230|Ga0075179_1604212All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1409Open in IMG/M
3300007230|Ga0075179_1679587All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1446Open in IMG/M
3300007513|Ga0105019_1111327All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1474Open in IMG/M
3300007550|Ga0102880_1205008All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea515Open in IMG/M
3300007557|Ga0102821_1196873All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea514Open in IMG/M
3300007667|Ga0102910_1135107All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea578Open in IMG/M
3300007760|Ga0105018_1068274All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1380Open in IMG/M
3300007957|Ga0105742_1022947All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata736Open in IMG/M
3300008120|Ga0114355_1124558All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea963Open in IMG/M
3300009057|Ga0102892_1104070All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea556Open in IMG/M
3300009079|Ga0102814_10350392All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea803Open in IMG/M
3300009154|Ga0114963_10688646All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea530Open in IMG/M
3300009155|Ga0114968_10133082All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1490Open in IMG/M
3300009172|Ga0114995_10098852All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1637Open in IMG/M
3300009172|Ga0114995_10521114All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea650Open in IMG/M
3300009218|Ga0103848_1101563All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata581Open in IMG/M
3300009230|Ga0103855_10044757All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea799Open in IMG/M
3300009254|Ga0103867_1022889All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata641Open in IMG/M
3300009263|Ga0103872_1053709All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea595Open in IMG/M
3300009434|Ga0115562_1058914All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1661Open in IMG/M
3300009436|Ga0115008_10133011All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1822Open in IMG/M
3300009437|Ga0115556_1277809All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea593Open in IMG/M
3300009442|Ga0115563_1069797All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1590Open in IMG/M
3300009445|Ga0115553_1078658All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1441Open in IMG/M
3300009512|Ga0115003_10714680All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea583Open in IMG/M
3300009606|Ga0115102_10040151All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea773Open in IMG/M
3300009608|Ga0115100_10324346All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1221Open in IMG/M
3300009695|Ga0123337_10435292All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea624Open in IMG/M
3300009705|Ga0115000_10187977All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1366Open in IMG/M
3300010296|Ga0129348_1259207All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea584Open in IMG/M
3300010368|Ga0129324_10225194All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea754Open in IMG/M
3300010885|Ga0133913_11903402All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1483Open in IMG/M
3300012408|Ga0138265_1096233All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1409Open in IMG/M
3300012504|Ga0129347_1205205All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1175Open in IMG/M
3300012767|Ga0138267_1171937All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1388Open in IMG/M
3300012782|Ga0138268_1217701All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1278Open in IMG/M
3300012782|Ga0138268_1713064All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1473Open in IMG/M
3300012953|Ga0163179_11142013All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea686Open in IMG/M
3300013004|Ga0164293_10589944All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea723Open in IMG/M
3300013010|Ga0129327_10493976All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea662Open in IMG/M
3300015051|Ga0137414_1169081All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea3528Open in IMG/M
3300016746|Ga0182055_1058995All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea567Open in IMG/M
3300016776|Ga0182046_1183116All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea587Open in IMG/M
3300017724|Ga0181388_1138319All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea580Open in IMG/M
3300017749|Ga0181392_1151838All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea678Open in IMG/M
3300017751|Ga0187219_1139077All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea707Open in IMG/M
3300017783|Ga0181379_1052281All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1563Open in IMG/M
3300017783|Ga0181379_1176345All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea755Open in IMG/M
3300017818|Ga0181565_10993246All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea520Open in IMG/M
3300017957|Ga0181571_10139731All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1603Open in IMG/M
3300018628|Ga0193355_1030126All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea519Open in IMG/M
3300018684|Ga0192983_1031481All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea730Open in IMG/M
3300018692|Ga0192944_1003949All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1554Open in IMG/M
3300018692|Ga0192944_1005789All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1412Open in IMG/M
3300018730|Ga0192967_1073251All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea562Open in IMG/M
3300018739|Ga0192974_1010959All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1437Open in IMG/M
3300018766|Ga0193181_1029666All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea785Open in IMG/M
3300018813|Ga0192872_1088576All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea525Open in IMG/M
3300018871|Ga0192978_1016378All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1323Open in IMG/M
3300018942|Ga0193426_10064672All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea798Open in IMG/M
3300018961|Ga0193531_10089776All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1204Open in IMG/M
3300018964|Ga0193087_10099765All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea935Open in IMG/M
3300018979|Ga0193540_10070465All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea930Open in IMG/M
3300018982|Ga0192947_10132361All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea833Open in IMG/M
3300018982|Ga0192947_10249124All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea571Open in IMG/M
3300018989|Ga0193030_10189379All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea676Open in IMG/M
3300019001|Ga0193034_10163595All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea546Open in IMG/M
3300019017|Ga0193569_10261778All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea736Open in IMG/M
3300019021|Ga0192982_10061430All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1157Open in IMG/M
3300019021|Ga0192982_10353814All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea525Open in IMG/M
3300019032|Ga0192869_10484922All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea530Open in IMG/M
3300019036|Ga0192945_10086260All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea973Open in IMG/M
3300019123|Ga0192980_1093596All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea536Open in IMG/M
3300019200|Ga0180036_1000449All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea546Open in IMG/M
3300019277|Ga0182081_1054396All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea532Open in IMG/M
3300020159|Ga0211734_10226676All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea841Open in IMG/M
3300020159|Ga0211734_10600334All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea928Open in IMG/M
3300020162|Ga0211735_10976766All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea593Open in IMG/M
3300020166|Ga0206128_1292891All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea582Open in IMG/M
3300020172|Ga0211729_11122152All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea562Open in IMG/M
3300021108|Ga0214162_1019230All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1216Open in IMG/M
3300021336|Ga0210307_1332765All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea596Open in IMG/M
3300021379|Ga0213864_10636279All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea526Open in IMG/M
3300021954|Ga0063755_1060441All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea718Open in IMG/M
3300021962|Ga0222713_10336279All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea949Open in IMG/M
3300023108|Ga0255784_10499932All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea554Open in IMG/M
3300024301|Ga0233451_10148973All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1070Open in IMG/M
3300024343|Ga0244777_10167072All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata1418Open in IMG/M
3300025130|Ga0209594_1228114All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea542Open in IMG/M
3300025368|Ga0208620_1031308All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea547Open in IMG/M
3300025399|Ga0208107_1022085All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1084Open in IMG/M
3300025640|Ga0209198_1142809All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea675Open in IMG/M
3300025872|Ga0208783_10121944All Organisms → Viruses → Predicted Viral1127Open in IMG/M
3300025879|Ga0209555_10305362All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea608Open in IMG/M
3300025887|Ga0208544_10033062All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea2633Open in IMG/M
3300027687|Ga0209710_1062109All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1628Open in IMG/M
3300027720|Ga0209617_10067032All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1484Open in IMG/M
3300027752|Ga0209192_10240393All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea673Open in IMG/M
3300027769|Ga0209770_10095009All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1232Open in IMG/M
3300027781|Ga0209175_10057717All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1655Open in IMG/M
3300027786|Ga0209812_10099443All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1398Open in IMG/M
3300027797|Ga0209107_10554666All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea504Open in IMG/M
3300027805|Ga0209229_10455779All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea550Open in IMG/M
3300027833|Ga0209092_10090931All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1822Open in IMG/M
3300027851|Ga0209066_10137251All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1547Open in IMG/M
3300027899|Ga0209668_10138253All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1464Open in IMG/M
3300028134|Ga0256411_1259122All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea533Open in IMG/M
3300028279|Ga0228613_1022394All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1480Open in IMG/M
3300028282|Ga0256413_1075306All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1205Open in IMG/M
3300028595|Ga0272440_1061607All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1488Open in IMG/M
3300029908|Ga0311341_10129387All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1659Open in IMG/M
3300029955|Ga0311342_10990672All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea625Open in IMG/M
3300030591|Ga0247626_1209838All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea560Open in IMG/M
3300030615|Ga0257185_10205443All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea656Open in IMG/M
3300030625|Ga0210259_11128668All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea766Open in IMG/M
3300030630|Ga0210282_10348394All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea537Open in IMG/M
3300030699|Ga0307398_10185587All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1095Open in IMG/M
3300030709|Ga0307400_10167466All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1354Open in IMG/M
3300030709|Ga0307400_10328691All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea971Open in IMG/M
3300030741|Ga0265459_11324331All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea802Open in IMG/M
3300030743|Ga0265461_10634040All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea939Open in IMG/M
3300030799|Ga0074010_11079569All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea729Open in IMG/M
3300030860|Ga0074000_13009524All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea512Open in IMG/M
3300030938|Ga0138299_10281557All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea585Open in IMG/M
3300030938|Ga0138299_10796269All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea541Open in IMG/M
3300031231|Ga0170824_101555514All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea565Open in IMG/M
3300031569|Ga0307489_10662649All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea725Open in IMG/M
3300031570|Ga0308144_1019805All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea853Open in IMG/M
3300031621|Ga0302114_10088636All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1442Open in IMG/M
3300031734|Ga0307397_10074926All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1333Open in IMG/M
3300031735|Ga0307394_10406296All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea545Open in IMG/M
3300031738|Ga0307384_10056265All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1460Open in IMG/M
3300032463|Ga0314684_10123801All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1336Open in IMG/M
3300032463|Ga0314684_10445822All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea761Open in IMG/M
3300032470|Ga0314670_10629824All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea553Open in IMG/M
3300032521|Ga0314680_10281976All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1000Open in IMG/M
3300032650|Ga0314673_10717123All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea513Open in IMG/M
3300032666|Ga0314678_10042330All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1479Open in IMG/M
3300032733|Ga0314714_10413796All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea759Open in IMG/M
3300032747|Ga0314712_10093944All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1323Open in IMG/M
3300032754|Ga0314692_10666053All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea549Open in IMG/M
3300032756|Ga0315742_12003712All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea645Open in IMG/M
3300032756|Ga0315742_12111347All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea631Open in IMG/M
3300033572|Ga0307390_10152719All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1281Open in IMG/M
3300033984|Ga0334989_0231825All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1005Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine15.20%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine11.70%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater5.26%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.26%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous5.85%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine4.68%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh4.68%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater2.34%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.34%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater2.34%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine2.34%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake2.92%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine2.92%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater2.92%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent2.92%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.75%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water1.75%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.75%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.75%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater1.17%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment1.17%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.17%
WatershedsEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Watersheds1.17%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.17%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine1.17%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.17%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment0.58%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment0.58%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.58%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton0.58%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.58%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater0.58%
Glacier ValleyEnvironmental → Aquatic → Freshwater → Ice → Glacier → Glacier Valley0.58%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.58%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.58%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.58%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine0.58%
Marine SedimentEnvironmental → Aquatic → Marine → Wetlands → Sediment → Marine Sediment0.58%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.58%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.58%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.58%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.58%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface0.58%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.58%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water0.58%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000120Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 2 sample NOR 13_50mEnvironmentalOpen in IMG/M
3300000736Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011EnvironmentalOpen in IMG/M
3300001263Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY83Host-AssociatedOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003216Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNAEnvironmentalOpen in IMG/M
3300003413Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DDEnvironmentalOpen in IMG/M
3300004112Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2)EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004788Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005433Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF45BEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300005986Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 6/11/14 C2 DNAEngineeredOpen in IMG/M
3300006033Freshwater microbial communities in response to fracking from Pennsylvania, USA - Allegheny Zone_MetaG_DW_15EnvironmentalOpen in IMG/M
3300006072Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09EnvironmentalOpen in IMG/M
3300006100Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09EnvironmentalOpen in IMG/M
3300006165Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNAEnvironmentalOpen in IMG/M
3300006355Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006394Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006415Algae and Fungi communities from freshwater lake (pre-blooming) in Auvergne, France - collected by filtering lake water, a 'reference genome' of the lake communityEnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300007230Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C RNA (Eukaryote Community Metatranscriptome)EngineeredOpen in IMG/M
3300007513Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300007550Estuarine microbial communities from the Columbia River estuary - metaG 1549A-3EnvironmentalOpen in IMG/M
3300007557Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715EnvironmentalOpen in IMG/M
3300007667Estuarine microbial communities from the Columbia River estuary - metaG 1558A-3EnvironmentalOpen in IMG/M
3300007760Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate aEnvironmentalOpen in IMG/M
3300007957Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459A_3.0umEnvironmentalOpen in IMG/M
3300008120Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NAEnvironmentalOpen in IMG/M
3300009057Estuarine microbial communities from the Columbia River estuary - metaG 1553A-3EnvironmentalOpen in IMG/M
3300009079Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741EnvironmentalOpen in IMG/M
3300009154Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaGEnvironmentalOpen in IMG/M
3300009155Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaGEnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009218Microbial communities of water from Amazon river, Brazil - RCM1EnvironmentalOpen in IMG/M
3300009230Microbial communities of water from Amazon river, Brazil - RCM8EnvironmentalOpen in IMG/M
3300009254Microbial communities of water from Amazon river, Brazil - RCM20EnvironmentalOpen in IMG/M
3300009263Eukaryotic communities of water from the North Atlantic ocean - ACM27EnvironmentalOpen in IMG/M
3300009434Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009437Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414EnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009442Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519EnvironmentalOpen in IMG/M
3300009445Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331EnvironmentalOpen in IMG/M
3300009512Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009695Glacier valley bacterial and archeal communities from Borup Fiord, Nunavut, Canada, to study Microbial Dark Matter (Phase II) - frozenSSSS metaGEnvironmentalOpen in IMG/M
3300009705Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128EnvironmentalOpen in IMG/M
3300010296Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNAEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300012408Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA23.A_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012504Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012767Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA29.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012782Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA30.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300013010Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNAEnvironmentalOpen in IMG/M
3300015051Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300016746Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101401AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016776Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011505AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017724Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17EnvironmentalOpen in IMG/M
3300017749Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15EnvironmentalOpen in IMG/M
3300017751Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2)EnvironmentalOpen in IMG/M
3300017783Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10EnvironmentalOpen in IMG/M
3300017818Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017949Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017957Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018628Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001820 (ERX1782125-ERR1711885)EnvironmentalOpen in IMG/M
3300018684Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782225-ERR1712160)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018730Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782285-ERR1712028)EnvironmentalOpen in IMG/M
3300018739Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789514-ERR1719246)EnvironmentalOpen in IMG/M
3300018766Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000317 (ERX1789428-ERR1719465)EnvironmentalOpen in IMG/M
3300018813Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782297-ERR1712172)EnvironmentalOpen in IMG/M
3300018871Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001026 (ERX1789475-ERR1719345)EnvironmentalOpen in IMG/M
3300018942Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002295 (ERX1782357-ERR1712003)EnvironmentalOpen in IMG/M
3300018961Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002783 (ERX1789414-ERR1719458)EnvironmentalOpen in IMG/M
3300018964Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000939 (ERX1782328-ERR1712130)EnvironmentalOpen in IMG/M
3300018979Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782403-ERR1712037)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019001Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001043 (ERX1782383-ERR1712007)EnvironmentalOpen in IMG/M
3300019017Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002781EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019123Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782390-ERR1712195)EnvironmentalOpen in IMG/M
3300019200Estuarine microbial communities from the Columbia River estuary - R.1175 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019277Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071412AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020159Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1EnvironmentalOpen in IMG/M
3300020162Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1EnvironmentalOpen in IMG/M
3300020166Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1EnvironmentalOpen in IMG/M
3300020172Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1EnvironmentalOpen in IMG/M
3300021108Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnionEnvironmentalOpen in IMG/M
3300021336Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1073 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021379Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247EnvironmentalOpen in IMG/M
3300021954Marine eukaryotic phytoplankton communities from the Norwegian Sea - 10m ARK-5M Euk ARK-5-1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300023108Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaGEnvironmentalOpen in IMG/M
3300024301Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504CT (spades assembly)EnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300025130Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Crystal Spring (SPAdes)EnvironmentalOpen in IMG/M
3300025368Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Jun08 (SPAdes)EnvironmentalOpen in IMG/M
3300025399Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Oct07 (SPAdes)EnvironmentalOpen in IMG/M
3300025640Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 (SPAdes)EnvironmentalOpen in IMG/M
3300025872Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025879Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025887Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027687Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes)EnvironmentalOpen in IMG/M
3300027720Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027752Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes)EnvironmentalOpen in IMG/M
3300027769Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027781Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C2 DNA (SPAdes)EngineeredOpen in IMG/M
3300027786Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 7/17/14 B DNA (SPAdes)EngineeredOpen in IMG/M
3300027797Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027805Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027851Freshwater microbial communities in response to fracking from Pennsylvania, USA - Allegheny Zone_MetaG_DW_15 (SPAdes)EnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300028134Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_12 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028279Seawater microbial communities from Monterey Bay, California, United States - 14DEnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028595Marine sediment archaeal communities from Little Sippewissett salt marsh, Falmouth, MA, United States - SSM-MMB-Aug17EnvironmentalOpen in IMG/M
3300029908II_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029955II_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300030591Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bb3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030615Metatranscriptome of plant litter fungal communities from Pinus contorta in Bitterroot National Forest, Montana, United States - GP1-LITTER (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300030625Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO122-ANR120SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030630Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO151-VCO115SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030741Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assemblyEnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300030799Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Wood GP-3A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030860Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Litter GP-1A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030938Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_OS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031570Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB9_547_5m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031621Marine microbial communities from Western Arctic Ocean, Canada - AG5_SurfaceEnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031735Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032463Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032470Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032521Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032650Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032666Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032733Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032747Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032754Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032756Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined AssemblyEnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033984Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Mar2001-rr0030EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
SA_S2_NOR13_50mDRAFT_101096843300000120MarineMELFNLGIKMEQPGGKAPTELNKEKVIELVMQSNDHAFDLFKKEYLDVMTKDPMIMPVLISALAHDWVFKNHNWSEDQFKAALFEHKIYEDPTVAQHMQRK*
JGI12547J11936_108637623300000736Freshwater And SedimentMDPYVSMELFNMGISMEQPSSAAPAELTQEKTVSLVKESNNFAFELFKKEYLDQMRYDPMIMPVLISAIAHDWVFKNHGFSEEQFKAALFAHKIYEDPEVAMHMQQK*
BBAY83_1003941123300001263Macroalgal SurfaceMQDPAVQMELFNLGIKMEQPPGKAPENLKRDDVVDLVKKSNDFAFDLFKKEYLNIMQKDPMIMPVLISAIAHDWVFKNHQWTEEQFKCALFEHKIYEDPTVAQHMQQK*
B570J40625_10049409823300002835FreshwaterMNDPYVSMELFNLGIAMEQPATTTPDALTLEKTIELVRLSNDYAFDRFKKDYIDQMMMDPMIAPVLISAIAHDWVLVNHNYPEDDFKAALFSHKIYENPEIS*
JGI26079J46598_108842023300003216MarineERSQQTLMQDPSVQMELFNLGIKMEQPGGKAPTELNKEKVIELVMQSNDHAFDLFKKEYLDVMTKDPMIMPVLISALAHDWVFKNHNWSEDQFKAALFEHKIYEDPQVAQHMQRK*
JGI25922J50271_1007352213300003413Freshwater LakeMFDRLCITPEFFERSQQELMMDPYVSMELFNMGISMEQPSSAAPAELTADKTVALVKESNNFAFELFKKEYLDQMRYDPMIMPVLISAIAHDWVYKNHNFTEEQFKAALFAHKIYENPEVAMHM
Ga0065166_1022546913300004112Freshwater LakeMEMFDRLCITPEFFERSQQELMMDPYVSMELFNMGISMEQPSSAAPAELTADKTVALVKESNNFAFELFKKEYLDQMRYDPMIMPVLISAIAHDWVYKNHNFTEEQFKAALFAHKIYENPEVAMHMQ*
Ga0063356_10381349213300004463Arabidopsis Thaliana RhizosphereMMDPYVSMELFNMGISMEQPSSKCPDELTYQKTVELVKESNNFSFDLFKKEYLDQMRYDPMMMPVLISAIAHDWVFKNHGFTEDQFKAALFHHKIYEDPEVAMH
Ga0007742_1071457123300004788Freshwater LakeMNDPYVSMELFNLGIAMEQPATTTPDALTLEKTIELVRLSNDYAFDRFKKDYIDQMMMDPMIAPVLISAIAHDWVLVNHNYPEDDFKAALFSHKIY
Ga0066830_1010646923300005433MarineMQDPSVQMELFNLGIKMEQPAGKAPDGLEKETVIDLVIQSNDHAFDLFKKEYLDVMTKDPMIMPVLISAIAHDWVFKNHGWKEDQFKAALFEHKIYEDRKVAEHM*
Ga0078894_1104974013300005662Freshwater LakeMFDRLCITPEFFERSQQELMMDPYVSMELFNMGISMEQPSSAAPAELTADKTVALVKESNNFAFELFKKEYLDQMRYDPMIMPVLISAIAHDWVYKNHNFTEEQFKAALFAHKIYENPEVAMHMQ*
Ga0075152_1075469313300005986Wastewater EffluentMDPYVSMELFNMGISMEQPSGEAPAELTQEKTIQLVKESNNFAFDLFKKEYLDQLRYDPMMMPVLISAIAHDWVFKNHGFTEDQFKAALFNHKIYEDPEVAMHMQ*
Ga0075012_1017827723300006033WatershedsMELFNMGIAMEQPSGKAPEALTHEKTVELVKESNNFAFDLFKKEYLDQMKYDPMMMPVLVSAIAHDWVYKNHGYGEEQFKAALFQHKIYEDPEVAMHMQTK*
Ga0007881_103374033300006072FreshwaterMNDPYVSMELFNMGISMEQPSSKAPAELTKDRTVTLVKESNTFAFDLFKKEYLDQMRYDPMIMPVLISAIAHDWVFKNHGFNEEQFKAALFEHKIYEDPEVAMHMQQKQM
Ga0007806_107967523300006100FreshwaterMNDPYVSMELFNMGISMEQPSSKAPAELTKDRTVTLVKESNTFAFDLFKKEYLDQMRYDPMIMPVLISAIAHDWVFKNHGFNEEQFKAALFEHKIY
Ga0075443_1019980913300006165MarineMQDPSVQMELFNLGIKMEQPAAKAPAELEKQVVIDLVMQSNDHAFDLFKTEYLDVMQKDPMIMPVLISALAHDWVFKNHNWTEDQFKAALFEHKIYEDPAVAQHMQKKQFELMMLAS*
Ga0075501_100626623300006355AqueousMNDPYVSMELFNLGIAMEQPVGATNANLNRELSVDLVKLSNDYAFDKFKKDYIGEMAKDPMIAPVLISSIAHDWVFVNHGYSEEEFKAALFEHRSTRIPT*
Ga0075492_143853123300006394AqueousMNDPYVSMELFNLGIAMEQPSGGAPEALTAEKTVELVMQSNDFAFNLFQTHYLDAMGADPMMMPVLISAIAHDWVYSEHNWKEEEFKSALFAHKIYENPAVS*
Ga0099654_1022039433300006415LakeMSDPYISMELFNLGISMEQPSSKCPDALSQDKTVELVIASNDFAFDMFKSEYLSQMRQDPMMMPVLISCIAHDWVRVNHGFSEDEFKSALFHHKIYENP*
Ga0075471_1027298723300006641AqueousMLFEKLAISPEMFERSQQFLMQDPALQMELFQLGIKMEQPPGKAPEDLKKETVVDLVKQSNDFAFDLFKKRYISVMQQDPMIMPVLISAIAHDWVFKNHNWSEDQFKSALFEHKIYEDPSVAQHMQSK*
Ga0075467_1012626613300006803AqueousPQQFERTQQALMNDPYVSMELFNLGISMEQPASTCPEDLTADKTIELVKASNDYAFDIFKKEYLSQMSADPMMMPVLISAIAHDWVKVNHNFSEETFKAALFAHKIYENPEVS*
Ga0075467_1014427413300006803AqueousMNDPYVSMELFNLGIAMEQPSGGAPEALTAEKTVELVMQSNDFAFNLFQTHYLDAMGADPMMMPVLISAIAHDWVYSEHNWKEEEFKSALCAHKIYESPAVS*
Ga0075467_1032573213300006803AqueousMNDPYVSMELFNLGIAMEQPSGGAPEALTAEKTIELVMQSNDFAFNLFQTQYLDAMSADPMMMPVLISAIAHDWVYSEHSWKEEEFKSALFAHRIYENPAVSQHMQQK*
Ga0075464_1060363713300006805AqueousMNDPYVSMELFNLGIAMEQPSTGTPEALTKEKTIELVKTSNDFAFERFKTKYMDQISQDPMLMPVLISAIAHDWVLKNHGFTEDEFKAALFTHKIYEDPSVSEHMQQK*
Ga0075179_160421223300007230Wastewater EffluentMDPYVSMELFNMGISMEQPSGDAPAELTQEKTITLVKESNNFAFDLFKKEYLDQLRYDPMMMPVLISAIAHDWVFKNHGFTEDQFKAALFTHKIYEDPDVAMHMQ*
Ga0075179_167958723300007230Wastewater EffluentMMDPYVSMELFNMGISMEQPSGEAPAELTQEKTIQLVKESNNFAFDLFKKEYLDQLRYDPMMMPVLISAIAHDWVFKNHGFTEDQFKAALFNHKIYEDPEVAMHMQ*
Ga0105019_111132723300007513MarineMEMFNLGIKMEKPNATTPEGLKKDVVVDLVKQSNDFAFDLFKKEYLSMMAQDPMIMPVLISAIAHDWVFTEHKWSEEQFKAALFDFKIYEDPQVAQHMQSKLFELMMLA*
Ga0102880_120500823300007550EstuarineLGIKMEQPGGKAPTELNKEKVIELVMQSNDHAFDLFKKEYLDVMTKDPMIMPVLISALAHDWVFKNHNWSEDQFKAALFEHKIYEDPQVAQHMQRK*
Ga0102821_119687313300007557EstuarineMELFNLGIKMEQPGGKAPAELNKEKVIELVTASNDHAFDLFKKEYLDVMTKDPMIMPVLISALAHDWVYKNHNWTEDQFKSALFEHKIYEDPTVAQHMQRK*
Ga0102910_113510723300007667EstuarineKTQQTLMNDPYVSMELYNLGISMEQPNSDVPTDLTSERTVELVKASNDYAFDLFKREYSSQVTADPMLMPVLISAIAHDWVKVNHSIDEDNFKAALFKHKIYENPEVSEHMQ*
Ga0105018_106827443300007760MarineMEMFNLGIKMEKPNATTPEGLKKDVVVDLVKQSNDFAFDLFKKEYLSMMAQDPMIMPVLISAIAHDWVFTEHKWSEEQFKAALFDFKIYEDPQVAQHMQSKQFELMMLA*
Ga0105742_102294723300007957Estuary WaterMNDPYVSMELYNLGISMEQPNSDVPTDLTSERTVELVKASNDYAFDLFKREYSSQVTADPMLMPVLISAIAHDWVKVNHSIDEDNFKAALFKHKIYENPEVSEHMQ*
Ga0114355_112455823300008120Freshwater, PlanktonMSDPYISMELFNLGISMEQPATATPEALNVDKTIELVIASNDFAFDLFKKDYISQMRQDPMMMPVLISCIAHDWVKMHHGWTEDEFKAALFQHKIYENPK
Ga0102892_110407013300009057EstuarineENFERSQQTLMQDPSVQMELFNLGIKMEQPGGKAPTELNKEKVIELVMQSNDHAFDLFKKEYLDVMTKDPMIMPVLISALAHDWVFKNHNWSEDQFKAALFEHKIYEDPQVAQHMQRK*
Ga0102814_1035039223300009079EstuarineMQDPSMQMELFNLGIKMEQPPGKTPEGLNKEQVVDLVKQSNDFAFDLFKKEYLSMMAKDPMIMPVLISAIAHDWVFQNHKWNEDQFKAALFEFKIYEDPQVA*
Ga0114963_1068864613300009154Freshwater LakeMMDPYVSMELFNMGISMEQPSSAAPAELTQEKTVSLVKESNNFAFELFKKEYLDQMRYDPMIMPVLISAIAHDWVFKNHSFSEEQFKAAL
Ga0114968_1013308223300009155Freshwater LakeMMDPYVSMELFNMGISMEQPSSAAPAELTQEKTVSLVKESNNFAFELFKKEYLDQMRYDPMIMPVLISAIAHDWVFKNHGFSEEQFKAALFAHKIYEDPEVAMHMQQK*
Ga0114995_1009885233300009172MarineMELFNLGIKMEQPASKSPTDLTEPKVIELVKTSNDFAFDLFKREYLEVMQKDPMIMPVLISAIAHDWVYKNHKWTEDEFKAALFEHKIYEDPNVAQHMQKK*
Ga0114995_1052111423300009172MarineMELFNLGIKMEQPASKSPEALTEPIVIDLVKRSNDFAFDLFKREYLEVMQKDPMIMPVLISAIAHDWVYQKEKWTEDEFKAALFEHKIYEDPNVAQHMQKK*
Ga0103848_110156313300009218River WaterMNDPYVSMELFNLGISMEQPSGAQPEALTLDKTIELVIASNDYAFDLFKKEYISQMRADPMMMPVLISCIAHDWVKVQHGFSEDEFKAALFAHK
Ga0103855_1004475713300009230River WaterMEQPSGAQPEALTLDKTIELVIASNDYAFDLFKKEYISQMRADPMMMPVLISCIAHDWVKVQHGFTEDEFKAALFAHKIYENPKVSEHMQIKQMELLSIAA*
Ga0103867_102288923300009254River WaterMELFNLGISMEQPAEPAPKALDLLKTVELVIASNDYAFELFKKEYLSQMRADPMMMPVLISCIAHDWVKVQHGYTEDEFKAALFEHKIYENPKVSEHMQM
Ga0103872_105370923300009263Surface Ocean WaterMQDPSVQMELFNLGIKMEQPGGKAPEELNKEKVVELVMASNDHAFDLFKKEYLDVMQKDPMIMPVLISALAHDWVYKNHNWSEDQFKAALFEHKIYEDPNVAQHMQRK*
Ga0115562_105891423300009434Pelagic MarineMELFNLGIKMEQPASKAPAELEKQVVIDLVMQSNDHAFDLFKTEYLDVMQKDPMIMPVLISALAHDWVFKNHNWTEDQFKAALFEHKIYEDPAVAQHMQKKQFELMMLAS*
Ga0115008_1013301143300009436MarineMELFNLGIKMEQPAGAAPSELTKEKVIDLVMKSNDYAFELFKKEYTDVMMKDPMIMPVLISAIAHDWVFKNHQWSEENFKAALFEHKIYEDPNVAQHMQKK*
Ga0115556_127780923300009437Pelagic MarineLCISPENFERSQQTLMQDPSVQMELFNLGIKMEQPGGKAPTELNKEKVIELVMQSNDHAFDLFKKEYLDVMTKDPMIMPVLISALAHDWVFKNHNWSEDQFKAALFEHKIYEDPQVAQHMQRK*
Ga0115007_1050150713300009441MarineMELFNLGIKMEQPATKAPAGLDKAKIVELVMASNDFAFDQFKKDFTDVMGKEPMLMPVLISALAHDWVYKNHNWTEDEFKAALFEHKIYEDASVAEHMQKKQFELMMMAQRANPMMMGGMPGGGGMPF*
Ga0115563_106979733300009442Pelagic MarineMQDPSVQMELFNLGIKMEQPASKAPAELEKQVVIDLVMQSNDHAFDLFKTEYLDVMQKDPMIMPVLISALAHDWVFKNHNWTEDQFKAALFEHKIYEDPAVAQHMQKKQFELMMLAS*
Ga0115553_107865833300009445Pelagic MarineMELFNLGIKMEQPGGKAPTELNKEKVIELVMQSNDHAFDLFKKEYLDVMTKDPMIMPVLISALAHDWVFKNHNWSEDQFKAALFEHKIYEDPQVAQHMQRK*
Ga0115003_1071468013300009512MarineMELFNLGIKMEQPASKSPSDLTEPKVIELVKQSNDFAFDLFKREYLEVMQKDPMIMPVLISAIAHDWVYKNHKWTEDEFKAALFEHKIYEDPNVAQHMQKK*
Ga0115102_1004015123300009606MarineMQDPSVQMELFNLGIKMEQPGGKAPEELNKEKVVELVMASNDHAFDLFKKEYLDVMQKDPMIMPVLISALAHDWVFKNHNWSEDQFKAALFEHKIYEDPNVAQHMQRK*
Ga0115100_1032434623300009608MarineMELFNLGIKMEQPAGKAPEELQKEKVVELVMQSNDHAFDLFKKEYLSVMGSDPMIMPVLISALAHDWVFKNHNWTEEQFKAALFEHKIYED*
Ga0123337_1043529213300009695Glacier ValleyMMMDPYVSMELFNLGISMEQPTSAAPAALNKEKTVELVKASNDFAFELFKKEYLDSMKHVPMMMPVLIRAIAHDWVLKEHGYTEEEFKAALFAHKIYEDPSVA*
Ga0115000_1018797713300009705MarineMELFNLGIKMEQPASKSPSDLTEPKVIELVKQSNDFAFDLFKREYLEVMQKDPMIMPVLISAIAHDWVYKNHKWTEDEFKAALFEHKIYEDPNVAQH
Ga0129348_125920723300010296Freshwater To Marine Saline GradientMADPYVSMELYNLGISMEQPSAAVPSELSVERTIELVKGSNDYAFDLFKREYTSQISGDPMLMPVLISAIAHDWVKVNHGIEEDNFKAALFQHKIYENPEVSAHMQEK
Ga0129324_1022519423300010368Freshwater To Marine Saline GradientMELFNLGIKMEQPGGKAPAELNKEKVIELVIASNDHAFDLFKKEYLDVMTKDPMIMPVLISALAHDWVYKNHNWTEDQFKSALFEHKIYEDPTVAQHMQRK*
Ga0133913_1190340223300010885Freshwater LakeMNDPYVSMELFNLGIAMEQPASGTPEALTKDRTIELVMASNDFAFERFKAKYMDQISQDPMLLPVLISAIAHDWVLKNHGFNEDEFKAALFTHKIYEDPTVSEHMQ*
Ga0138265_109623313300012408Polar MarineMELFNLGIKMEQPASKAPEGLAKETVIDLVIKSNDHAFDLFKKEYIDVMTKDPMIMPVLISAIAHDWVFTEHAWKEDEFKAALFEYKIYEDRKVAEHMQKKQFELMMMA*
Ga0129347_120520513300012504AqueousMQDPSVQMELFNLGIKMEQPATKAPDGLDKDKIVELVMASNDYAFDIFKKDFTDVMSKEPMLMPVLISALAHDWVYKNHNWTEDEFKAALFAHKIYEDAKVAEHM*
Ga0138267_117193733300012767Polar MarineMELFNLGIKMEQPASKAPDGLAKETVIDLVIKSNDHAFDLFKKEYIDVMTKDPMIMPVLISAIAHDWVFTEHAWKEDEFKAALFEYKIYEDRKVAEHMQKKQFELMMMA*
Ga0138268_121770123300012782Polar MarineMQDPSIQMELFNLGIKMEKPSDSQPNDLTREKTIKLVKESNDFAFDLFKSQYLDTMQKDPMIMPVLISAIAHDWVLKNHNYSEDVFKASLFANKIYEDPTIAQHMQQK*
Ga0138268_171306443300012782Polar MarineMQDPSVQMELFNLGIKMEQPAAKAPEELVKATVVDLVMQSNDHAFDLFKQEYLDVMQKDPMIMPVLISALAHDWVFKNHNWTEDQFKAALFEHKIYDDPAVAQHM*
Ga0163179_1114201323300012953SeawaterMELFNMGISMEQPSSEAPAELTPERTVELVKASNDFAFEEFKKEYISQISQDPMMMPVLISAIAHDWVKVNHGFPEEAFKAALFAHKIYENPEVSEHMQMKQMELLSIAA*
Ga0164293_1058994413300013004FreshwaterMELFNMGISMEQPGTETPAELTAEKTVELVIKSNDYAFDRFKKDYLDQMMQDPMLAPVLISAIAHDWVLVNHNFPEDDFKSALFTHKIYENPEVS*
Ga0129327_1049397623300013010Freshwater To Marine Saline GradientMNDPYVSMELYNLGISMEQPNSDVPTDLTSERTVELVKASNDYAFDLFKREYSSQVTSDPMLMPVLISAIAHDWVKVNHGIDEDNFKAALFKHKIYENPEVSEHMQ*
Ga0137414_116908163300015051Vadose Zone SoilMDPYASMELFNLGINMEAPTAKAPASLTKDKTIELVKASNDYAFDLFKKEYIDQLRNDPMMMPVLISAIAHDWVYKEHGFTEEEFKAALF*
Ga0182055_105899523300016746Salt MarshMQDPSVQMELFNLGIKMEQPGGKAPTELNKEKVIELVMQSNDHAFDLFKKEYLDVMTKDPMIMPVLISALAHDWVFKNHNWSEDQFKAALFEHKIY
Ga0182046_118311623300016776Salt MarshMNDPYVSMELFNMGISMEQPGTETPKELTQEKTVELVMASNDYAFDRFKKDYLDQMMADPMLAPVLISAIAHDWVLVNHNWPEDDFKSALFTHKIYENPEVSAHMQQKQ
Ga0181388_113831933300017724SeawaterEQPASKSPTDLSEEKVVELVKQSNDFAFDLFKREYLEVMQKDPMIMPVLISAIAHDWVYKNHKWTEDEFKAALFEHKIYEDPNVAQHMQKK
Ga0181392_115183823300017749SeawaterMELFNLGIKMEQPASTAPEGLAKEKVVELVTQSNDYAFDLFKKEYIDVMTKDPMIMPVLISAIAHDWVFKNHGWTEDQFKAALFEHKIYEDPSVAQHMQKK
Ga0187219_113907723300017751SeawaterMELFNLGIKMEQPASKSPTDLSEEKVVELVKQSNDFAFDLFKREYLEVMQKDPMIMPVLISAIAHDWVYKNHKWTEDEFKAALFEHKIYEDPNVAQHMQKK
Ga0181379_105228113300017783SeawaterMQDPSVQMELFNLGIKMEQPASTAPEGLAKEKVVELVTQSNDYAFDLFKKEYLEVMTKDPMIMPVLISAIAHDWVFKNHGWTEDQFKAALFEHKIYEDPSVAQHMQKK
Ga0181379_117634513300017783SeawaterMQDPSVQMELFNLGIKMEQPAAKAPGDLSKEKIVELVTQSNDFAFDLFKKEYLKVMGEDPMIMPVLISALAHDWVYKNHGKPEDEFKAALFEHKIYEDPDVA
Ga0181565_1099324623300017818Salt MarshNLGIKMEQPGGKAPTELNKEKVIELVMQSNDHAFDLFKKEYLDVMTKDPMIMPVLISALAHDWVFKNHNWSEDQFKAALFEHKIYEDPQVAQHMQRK
Ga0181584_1055496213300017949Salt MarshMFERSQQFLMQEPALQMELFNLGIKMEQPPGSAPADLAKETVVDLVKKSNDFAFDLFKKEYIKVMQTDPMIMPVLISAIAHDWVYKNHNWTEDQFKAALFEHKIYEEPSVAQHMQSKQFELMMMAQQQNPMMGMGGMGGMPGAPG
Ga0181571_1013973133300017957Salt MarshMQDPSVQMELFNLGIKMEQPGGKAPTELNKEKVIELVMQSNDHAFDLFKKEYLDVMTKDPMIMPVLISALAHDWVFKNHNWSEDQFKAALFEHKIYEDPQVAQHMQRK
Ga0193355_103012613300018628MarineMELFNLGIKMEQPASKAPDGLDKDTIVKLVIESNDYAFDIFKKNYLEVMTKDPMIMPVLISALAHDWVFKNHSWSEDDFKAALFTHKIYED
Ga0192983_103148123300018684MarineMELFNLGIKMEQPASKAPEGLAKETVIDLVIKSNDHAFDLFKKEYIDVMTKDPMIMPVLISAIAHDWVFTEHAWKEDEFKAALFEYKIYEDRKVAEHMQKKQFELMMMA
Ga0192944_100394923300018692MarineMELFNLGIKMEQPASKSPEELTEGKVIELVKTSNDFAFDLFKREYLEVMQKDPMIMPVLISAIAHDWVFKNHKWTEDEFKAALFEHKIYEDPNVAQHMQKK
Ga0192944_100578923300018692MarineMQDPSVQMELFNLGIKMEQPASKAPAELEKQVVIDLVMQSNDHAFDLFKTEYLDVMQKDPMIMPVLISALAHDWVFKNHNWTEDQFKAALFEHKIYEDPAVAQHMQKKQFELMMLAS
Ga0192967_107325123300018730MarineLGIKMEQPASKSPEELTEGKVIELVKTSNDFAFDLFKREYLEVMQKDPMIMPVLISAIAHDWVFKNHKWTEDEFKAALFEHKIYEDPNVAQHMQKK
Ga0192974_101095943300018739MarineMADPYVSMELYNLGISMEQPADTEVPADLTSDRTVELVKASNDYAFDLFKSEYASKVMSDPMIMPVLISAIAHDWVKVNHQYDEESFKAALFKFKIYENPEVSAHMQEK
Ga0193181_102966623300018766MarineMELFNLGIKMEQPASKAPEGLGKDKVVELVTQSNDYAFDLFKKEYLDVMTKDPMIMPVLISAIAHDWVFKNHEWTEDQFKAALFEHKIYEDPVVAQHMQKK
Ga0192872_108857613300018813MarineEQPQGSAPKELTAEKTVELVKASNDFAFDEFKKEYISQISADPMMMPVLISAIAHDWVKVNHGFPEEQFKAALFEHKIYENPEVSEHMQTKQMELLSLAA
Ga0192978_101637823300018871MarineMQDPSVQMELFNLGIKMEQPAGAAPADLTREKVIELVMSSNDYAFDLFKKEYTDVMLKDPMIMPVLISAIAHDWVYKNHQWTEENFKSALFEHKIYEDPNVAQHMQKK
Ga0193426_1006467213300018942MarineKSQQTYMNDPYVSMELFNMGISMEQPQGDPPKDLTSELTVKLVKESNDFAFEYFKKEYISQITADPMMMPVLISAIAHDWVLVNHKYPEEAFKAALFSHKIYENPEVSEHMQMKQMELL
Ga0193531_1008977613300018961MarineMADPYVSMELYNLGISMEQPSKAVPEDLTNERTVELVKASNEYAFDLFKREYADKVMSDPMIMPVLISAIAHDWVKVNHGYDEESFKAALFKHKIYEKPEVSAHMQEK
Ga0193087_1009976513300018964MarineMELYNLGISMEQPSSEVPEDLTVERTVELVKGSNDYAFDLFKKEYSSQVTSDPMLMPVLISAIAHDWVKVNHGYDEDNFKAALFKHKIYENPEVSEHMQQKQMELMMMAMQ
Ga0193540_1007046523300018979MarineMFEAICITPEMFERTQQMMMNDPYVSMELFNMGIAMEQPAGQAPAELTKEKTVELVKASNDFAFEEFKKEYVAQISQDPMMMPVLISAIAHDWVKVNHNFPEE
Ga0192947_1013236123300018982MarineMFERSQQALMQDPSIQMELFNLGIKMEQPAETKESDLTKERTIQLVKDSNDFAFDLFKSQYLDTMQKDPMIMPVLISAIAHDWVLKNHNYTEEVFKASLFANKVYEDQAVAQHMQQK
Ga0192947_1024912413300018982MarineMELFNLGIKMEQPAGSAPAGLNREKVIELVMQSNDYAFDLFKKEYTEVMAKDPMIMPVLISAIAHDWVYKNHQWTEENFKASLFEHKIYEDPNVAQHMQKK
Ga0193030_1018937923300018989MarineMADPYVSMELYNLGISMEQPSKAVPEDLTNERTVELVKASNEYAFDLFKREYADKVMSDPMIMPVLISAIAHDWVKVNHGYDEESFKAALFKHKIYENPEVSAHMQEK
Ga0193034_1016359513300019001MarineYPYVSMELFNMGISMEQPQGEPPKDLTSELTVKLVKESNDFAFEYFKKEYISQITADPMMMPVLISAIAHDWVLVNHKYPEEAFKAALFSHKIYENPEVSEHMQMKQMELL
Ga0193569_1026177813300019017MarineMNDPYVSMELYNLGISMEQPNSDVPTDLTSERTVELVKASNDYAFDLFKREYSSQVTADPMLMPVLISAIAHDWVKVNHGVDEDNFKAALFKHKIYENPEVSEHMQ
Ga0192982_1006143033300019021MarineMQDPSVQMELFNLGIKMEQPAAKAPVELEKQVVIDLVMQSNDHAFDLFKTEYLDVMQKDPMIMPVLISALAHDWVFKNNWTEDQFKAALFEHKIYEDPAVAQHMQKKQFELMMLAS
Ga0192982_1035381413300019021MarineMADPYVSMELYNLGISMEQPADTEGPADLTSDRTVELVKASNDYAFDLFKSEYASKVMSDPMIMPVLISAIAHDWVKVNHQYDEESFKAALFKFKIYENPEVSAHMQEK
Ga0192869_1048492223300019032MarineISQLHMQDPSVQMELFNLGIKMEQPAGAAPTDLSRDKVIKLVMESNDYAFDLFKKEYTDVMTKDPMIMPVLISAIAHDWVFKNHQWSEENFKSALFEHKIYEDPNVAQHMQKK
Ga0192945_1008626043300019036MarineMELFNLGIKMEQPAGSAPAGLNREKVIELVMQSNDYAFDLFKKEYTSVMAKDPMIMPVLISAIAHDWVYKNHQWTEENFKASLFEHKIYEDPNVAQHMQKK
Ga0192980_109359613300019123MarineMELFNLGIKMEQPAGAAPADLTREKVIELVMSSNDYAFDLFKKEYTDVMLKDPMIMPVLISAIAHDWVYKNHQWTEENFKSALFEHKIYEDPNVAQHMQKK
Ga0180036_100044913300019200EstuarineDPSVQMELFNLGIKMEQPGGKAPTELNKEKVIELVMQSNDHAFDLFKKEYLDVMTKDPMIMPVLISALAHDWVFKNHNWSEDQFKAALFEHKIYEDPQVAQHMQRK
Ga0182081_105439613300019277Salt MarshIIFDKLCISPENFERSQQQLMQDPSVQMELFNLGIKMEQPASKAPEDLGKEKVVELVMQSNDFAFDLFKKQYLDVMQKDPMIMPVLISAIAHDWVFKNHQWTEDQFKAALFEHKIYEDPNVAQHM
Ga0211734_1022667613300020159FreshwaterMNDPYVSMELFNLGIAMEQPATGAPSDLTKEKTAELVMTSNDYAFERFKTKYMDQISQDPMLLPILISAMAHDWVLKNHGFTEDQFKAALFTHKIYEDP
Ga0211734_1060033423300020159FreshwaterMNDPYVSMELFNLGIAMEQPSTGCPQALTPEKTIELVKEANDYAFDRFKQQYMDQISQDPMLMPVLISALAHDWVMINHNFTEDEFKAGLFLHKIYENPSVSEHM
Ga0211735_1097676613300020162FreshwaterMNDPYVSMELFNLGIAMEQPATGAPSDLTKEKTAELVMTSNDYAFERFKTKYMDQISQDPMLLPVLISAMAHDWVLKNHGFTEDQFKAALFTHKIYEDP
Ga0206128_129289113300020166SeawaterMQDPSLQMELFNLGIKMEQPPSDAPKELMKATVIDLVKKSNDFAFDLFKKEYLSTMASDPMIMPVLISAIAHDWVFKNHTWTEDQFKAALFEHKIYEDPSVATHMQ
Ga0211729_1112215223300020172FreshwaterMNDPYVSMELFNLGIAMEQPATTTPDALTLEKTIELVRLSNDYAFDRFKKDYIDQMMMDPMIAPVLISAIAHDWVLVNHNYPEDDFKAALFSHKIYENPEIS
Ga0214162_101923023300021108FreshwaterMNDPYVSMELFNLGIAMEQPSTGTPEALTKEKTIELVKTSNDFAFERFKTKYMDQISQDPMLMPVLISAIAHDWVLKNHGFTEDEFKAALFTHKIYEDPSVSEHMQQK
Ga0210307_133276523300021336EstuarineMELFNLGIKMEQPGGKAPAELNKEKVIELVTASNDHAFDLFKKEYLDVMTKDPMIMPVLISALAHDWVYKNHNWTEDQFKSALFEHKIYEDPTVAQHMQRK
Ga0213864_1063627913300021379SeawaterMQDPSVQMELFNLGIKMEQPGGKAPEELNKEKVVELVMASNDHAFDLFKKEYLDVMQKDPMIMPVLISALAHDWVYKNHNWSEDQFKAALFEHKIYEDPNVAQHMQRK
Ga0063755_106044123300021954MarineMEIFNLGISMEQPSTKCPEALNASKTIELVKASNDFAFDLFKKEYLSQMDPMNQDMMMMPVLISAIAHDWVKINHGFAEEDFKAALFHYKIYENPEVAQHMQHK
Ga0222713_1033627923300021962Estuarine WaterLGIKMEQPGGKAPAELTKEKVIELVMQSNDHAFDLFKKEYLDVMSKDPMIMPVLISALAHDWVYKNHNWSEDQFKAALFEHKIYEDPTVAQHMQRK
Ga0255784_1049993213300023108Salt MarshLMQDPSVQMELFNLGIKMEQPGGKAPTELNKEKVIELVMQSNDHAFDLFKKEYLDVMTKDPMIMPVLISALAHDWVFKNHNWSEDQFKAALFEHKIYEDPQVAQHMQRK
Ga0233451_1014897323300024301Salt MarshMADPIVQMTLFQLGVKMEQPASKAPAELSREKVVDLVIKSNDFAFDLFKKEYIDILSKDPMIMPVLISAIAHDWVFKNHNFTEDQFKAGLFEHKIYEDQKVAQHMQSK
Ga0244777_1016707233300024343EstuarineMNDPYVSMELYNLGISMEQPNSDVPTDLTSERTVELVKASNDYAFDLFKREYSSQVTADPMLMPVLISAIAHDWVKVNHSIDEDNFKAALFKHKIYENPEVSEHMQ
Ga0209594_122811413300025130GroundwaterMGINMEQPTTKPPAELDYNKTVNLVKDSNNFAFDLFKKEYIDQMRYDPLIMPVLISAIAHDWVFKNHGFSEEQFKAALFAHKIYEDPEVAMHMQ
Ga0208620_103130823300025368FreshwaterMNDPYVSMELFNMGISMEQPSSKAPAELTKDRTVTLVKESNTFAFDLFKKEYLDQMRYDPMIMPVLISAIAHDWVFKNHGFNEEQFKAALF
Ga0208107_102208523300025399FreshwaterMNDPYVSMELFNLGIAMEQPSTSTPESLTKDKTVELVMASNDFAFDRFKTQHMDCISQDPMLMPVLISAIAHDWVKINHGFTEDEFKAALFSHKIYEDPKVSEHMQQK
Ga0209198_114280913300025640Pelagic MarineMQDPSVQMELFNLGIKMEQPASKAPAELEKQVVIDLVMQSNDHAFDLFKTEYLDVMQKDPMIMPVLISALAHDWVFKNHNWTEDQFKAALFEHKIYEDPAVAQHM
Ga0208783_1012194423300025872AqueousMLFEKLAISPEMFERSQQFLMQDPALQMELFQLGIKMEQPPGKAPEDLKKETVVDLVKQSNDFAFDLFKKRYISVMQQDPMIMPVLISAIAHDWVFKNHNWSEDQFKSALFEHKIYEDPSVAQHMQSK
Ga0209555_1030536223300025879MarineMELFNLGIKMEQPGGKAPTELNKEKVIELVMQSNDHAFDLFKKEYLDVMTKDPMIMPVLISALAHDWVFKNHNWSEDQFKAALFEHKIYEDPQVAQHMQRK
Ga0208544_1003306233300025887AqueousMNDPYVSMELFNLGIAMEQPSGGAPEALTAEKTIELVMQSNDFAFNLFQTQYLDAMSADPMMMPVLISAIAHDWVYSEHSWKEEEFKSALFAHRIYENPAVS
Ga0209710_106210933300027687MarineMELFNLGIKMEQPASKSPTDLTEPKVIELVKTSNDFAFDLFKREYLEVMQKDPMIMPVLISAIAHDWVYKNHKWTEDEFKAALFEHKIYEDPNVAQHMQKK
Ga0209617_1006703223300027720Freshwater And SedimentMDPYVSMELFNMGISMEQPSSAAPAELTQEKTVSLVKESNNFAFELFKKEYLDQMRYDPMIMPVLISAIAHDWVFKNHGFSEEQFKAALFAHKIYEDPEVAMHMQQK
Ga0209192_1024039313300027752MarineMELFNLGIKMEQPASKSPEALTEPIVIDLVKRSNDFAFDLFKREYLEVMQKDPMIMPVLISAIAHDWVYQKEKWTEDEFKAALFEHKIYEDPNVAQHMQKK
Ga0209770_1009500923300027769Freshwater LakeMFDRLCITPEFFERSQQELMMDPYVSMELFNMGISMEQPSSAAPAELTADKTVALVKESNNFAFELFKKEYLDQMRYDPMIMPVLISAIAHDWVYKNHNFTEEQFKAALFAHKIYENPEVAMHMQ
Ga0209175_1005771723300027781Wastewater EffluentMDPYVSMELFNMGISMEQPSGEAPAELTQEKTIQLVKESNNFAFDLFKKEYLDQLRYDPMMMPVLISAIAHDWVFKNHGFTEDQFKAALFNHKIYEDPEVAMHMQ
Ga0209812_1009944313300027786Wastewater EffluentMDPYVSMELFNMGISMEQPSGDAPAELTQEKTITLVKESNNFAFDLFKKEYLDQLRYDPMMMPVLISAIAHDWVFKNHGFTEDQFKAALFTHKIYEDPDVAMHM
Ga0209107_1055466613300027797Freshwater And SedimentVSMELFNLGIAMEQPATTTPDALTLEKTIELVRLSNDYAFDRFKKDYIDQMMMDPMIAPVLISAIAHDWVLVNHNYPEDDFKAALFSHKIYENPEIS
Ga0209229_1045577913300027805Freshwater And SedimentDPYVSMELFNMGISMEQPSSQPPAELTQEKTIELVKASNNYAFDLFKKEYLEQMRYDPMIMPVLISAIAHDWVFKNHGFNEEQFKSALFAHKIYEDPEIAMHMQQKQMELL
Ga0209092_1009093143300027833MarineMELFNLGIKMEQPAGAAPSELTKEKVIDLVMKSNDYAFELFKKEYTDVMMKDPMIMPVLISAIAHDWVFKNHQWSEENFKAALFEHKIYEDPNVAQHMQKK
Ga0209066_1013725123300027851WatershedsMELFNMGIAMEQPSGKAPEALTHEKTVELVKESNNFAFDLFKKEYLDQMKYDPMMMPVLVSAIAHDWVYKNHGYGEEQFKAALFQHKIYEDPEVAMHMQTK
Ga0209668_1013825313300027899Freshwater Lake SedimentMELFNLGIKMEQPASKAPEALGRDRTVQLVTESNDFAFELFKKEYLDVMQKDPMIMPVLISAIAHDWVMKNHSWTEDQFKAALFEHKIYEDP
Ga0256411_125912213300028134SeawaterMELFNLGIKMEQPAGSAPADLTREKVVELVMASNDYAFDLFKKEYTDVMQKDPMIMPVLISAIAHDWVFKNHNWTEENFKAALFEHKIYEDPNVAQHMQKK
Ga0228613_102239433300028279SeawaterMFERSQQMHMQDPSVQMELFNLGIKMEQPAGAAQSDLTRDVVVDLVMQSNDYAFDLFKKEYTEIMTKDPMIMPVLISAIAHDWVFKNHNRTEEDFKAALFEHMIYEDPKVAQHMQKK
Ga0256413_107530623300028282SeawaterMELFNLGIKMEQPASKAPEGLGKDKVVELVTQSNDYAFDLFKKEYLDVMTKDPMIMPVLISAIAHDWVFKNHQWTEDQFKAALFEHKIYEDPIVAQHMQKK
Ga0272440_106160733300028595Marine SedimentLMQDPSVQMELFNLGIKMEQPAGKAPEDLNKETVVKLVTQSNDFSFDLFKKEYLDVMTKDPMIMPVLISAIAHDWVYKEHNWTEEQFKAALFEHKVYEDPSVAQHMQKKQLELMMMA
Ga0311341_1012938743300029908BogMDPYVSMELFNMGINMEQPTSAAPEELTQEKTIEMVKESNNFAFDLFKKEYLDQMRYDPLIMPVLISAIAHDWVYINHKYTEEQFKAALFAHKIYEDPEVAMHMQ
Ga0311342_1099067223300029955BogMMDPYVSMELFNMGINMEQPTSAAPEELTQEKTIEMVKESNNFAFDLFKKEYLDQMRYDPLIMPVLISAIAHDWVYINHKYTEEQFKAALFAHKIYEDPEVAMHMQ
Ga0247626_120983823300030591SoilMYDPYASMELFNMGIGMEQPSSAPPAELTKEKTIELVKQSNDFAFDLFKKEYLDQVQSDPLMMPVLISAIAHDWVFKHHGFSEEQFKAALF
Ga0257185_1020544323300030615Host-AssociatedMYDPYASMELMNIGIGMEQPTAAAPDALTREKTIELVKSSNDFAFDLFKKEYMDQIQQDPLMMPVLISAIAHDWVFKFSGFTEEQFKSALFTHKIYEDQSVAMHMQTK
Ga0210259_1112866823300030625SoilMMDPYASMELFNLGINMEAPSAKAPASLTKDKTIELVKASNDYAFDLFKKEYIDQLRNDPMMMPVLISAIAHDWVYKEHGFTEEEFKAALFEHKIYEDQSVSFHMQQK
Ga0210282_1034839413300030630SoilMYDPYASMELFNMGIGMEQPTTTPPEELTKERTIELVKASNDFAFDLFKKEYIDQISSDPLMMPVLISAIAHDWVFKNHNFNEEQFKAALFTHKIYEDPSVAMHMQ
Ga0307398_1018558713300030699MarineMNDPYVSMELFNMGISMEQPEGPAPKELTAEKTVKLVKDSNDFAFDEFKKEYINQISQDPMMMPVLISAIAHDWVKVNHGFPEEQFKAALFEHKIYENPEVSEHM
Ga0307400_1016746633300030709MarineMQDPSVQMELFNLGIKMEQPAAKAPVELEKQVVIDLVMQSNDHAFDLFKTEYLDVMQKDPMIMPVLISALAHDWVFKNHNWTEDQFKAALFEHKIYEDPAVAQHMQKKQFELMMLAS
Ga0307400_1032869133300030709MarineMELFNLGIKMEQPASKSPEELTEGKVIELVKTSNDFAFDLFKREYLEVMQKDPMIMPVLISAIAHDWVFKNHKWTEDEFKAALFEHKIYEDPNVAQH
Ga0265459_1132433113300030741SoilMYDPYASMELFNMGIGMEQPTTTPPEELTKEKTIELVKASNDFAFDLFKKEYIDQISSDPLMMPVLISAIAHDWVFKNHNFNEEQFKAALFTHKIYEDPSVAMHMQ
Ga0265461_1063404013300030743SoilMGIGMEQPTTTPPEELTKERTIELVKASNDFAFDLFKKEYIDQISSDPLMMPVLISAIAHDWVFKNHNFNEEQFKAALFTHKIYEDPSVAMHMQ
Ga0074010_1107956913300030799SoilMYDPYASMELMNIGIGMEQPTASDPDALTREKTIELVKSSNDFAFDLFKKEYMDQIQQDPLMMPVLISAIAHDWVFKFSGFTEEQFKSALFTHKIYEDQSVAMHMQTK
Ga0074000_1300952413300030860SoilMYDPYASMELMNIGIGMEQPTASAPVELTKEKTIELVKSSNDFAFDLFKKEYMDQIQQDPLMMPVLISAIAHDWVFKFSGFTEEQFKSA
Ga0138299_1028155713300030938SoilMMNPYASMELFNLGINMEAPSTKAPASLTKEKTIELVKASNDYAFDLFKKEYIDQLRNDPMMMPVLISAIAHDWVYKEHGFSEEEFKAALFEHKIYEDQSVSFHMQQK
Ga0138299_1079626913300030938SoilGIGMEQPTSTPPDALTKDKTIELVKASNDFAFDLFKKEYIDQVSSDPLMMPVLISAIAHDWVFKNHNFTEEQFKAALFSHKIYEDPSVAQHMQMK
Ga0170824_10155551423300031231Forest SoilMYDPMASMELFNMGIGMENPSTTPPDSLTKDKTIELVKQSNDFAFDLFKKEYMDQIKQDPLLMPVLISAIAHDWVFVNHQYPEEQFKAALFTHKIYEDSSVAMHMQSK
Ga0307489_1066264923300031569Sackhole BrineMELFNLGIKMEQPAGKAPVELTKEKVVELVMSSNDHAFDLFKKEYLDVMSKDPMIMPVLISALAHDWVYKNHKWTEDQFKSALFEHKIYEDPTVAQHMQRK
Ga0308144_101980513300031570MarineMELFNLGIKMEQPASKSPTDLTEPKVIELVKTSNDFAFDLFKREYLEVMQKDPMIMPVLISAIAHDWVYQKEKWTEDEFKAALFEHKIYEDPNVAQHMQKK
Ga0302114_1008863613300031621MarineMGIKMEQPASKAPVELEKQVVIDLVMQSNDHAFDLFKKEYIDVMQKDPMIMPVLISALAHDWVFKNHNWTEDQFKAALFEHKIYEDPSV
Ga0307397_1007492633300031734MarineMELFNLGIKMEQPASKSPEELTEGKVIELVKTSNDVAFDLFKREYLEVMQKDPMIMPVLISAIAHDWVFKNHKWTEDEFKAALFEHKIYEDPNVAQHMQKK
Ga0307394_1040629613300031735MarineELFNMGISMEQPEGPAPKELTAEKTVKLVKDSNDFAFDEFKKEYINQISQDPMMMPVLISAIAHDWVKVNHGFPEEQFKAALFEHKIYENPEVSEHM
Ga0307384_1005626523300031738MarineMQDPSVQMELFNLGIKMEQPAGAAPTALSREKVVELVMQSNDYAFDLFKKEYTEVMLKDPMIMPVLISAIAHDWVFKNHEWSEENFKAALFEHKIYEDPNVAQHMQKKQFELMMMAQ
Ga0314684_1012380123300032463SeawaterMQDPSVQMELFNMGIKMEQPASKAPVELEKQVVIDLVMQSNDHAFDLFKKEYIDVMQKDPMIMPVLISALAHDWVFKNHNWTEDQFKAALFEHKIYEDPSVAQHMQKKQFELMMLASQNNPGGFGGM
Ga0314684_1044582223300032463SeawaterMQDPSVQMELFNLGIKMEQPAAKAPEELEKQVVIDLVMQSNDHAFDLFKTEYLDVMQKDPMIMPVLISALAHDWVFKNHNWTEDQFKAALFEHKIYEDPAVAQHMQKKQFELMMLAS
Ga0314670_1062982413300032470SeawaterQDPSVQMELFNLGIKMEQPAAKAPEELEKQVVIDLVMQSNDHAFDLFKTEYLDVMQKDPMIMPVLISALAHDWVFKNHNWTEDQFKAALFEHKIYEDPAVAQHMQKKQFELMMLAS
Ga0314680_1028197623300032521SeawaterMQDPSVQMELFNLGIKMEQPASKAPAELEKQVVIDLVMQSNDHAFDLFKTEYLDVMQKDPMITPVLISALAHDWVFKNHNWTEDQFKAALFEHKIYEDPAVAQHMQKKQFELMMLAS
Ga0314673_1071712323300032650SeawaterLMQDPSVQMELFNLGIKMEQPAAKAPAELEKQVVIDLVMQSNDHAFDLFKTEYLDVMQKDPMIMPVLISALAHDWVFKNHNWTEDQFKAALFEHKIYEDPAVAQHMQKKQFELMMLAS
Ga0314678_1004233023300032666SeawaterMQDPSVQMELFNMGIKMEQPASKAPVELEKQVVIDLVMQSNDHAFDLFKKEYIDVMQKDPMIMPVLISALAHDWVFKNHNWTEDQFKAALFEHKIYEDPSVAQHMQKKQFELMMLAS
Ga0314714_1041379623300032733SeawaterMQYPSVQMELFNLGIKMEQPAAKAPEELEKQVVIDLVMQSNDHAFDLFKTEYLDVMQKDPMIMPVLISALAHDWVFKNHNWTEDQFKAALFEHKIYEDPAVAQHMQKKQFELMMLAS
Ga0314712_1009394423300032747SeawaterMQDPSVQMELFNMGIKMEQPASKAPVELEKQVVIDLVMQSNDHAFDLFKKEYIDVMQKDPMIMPVLISALAHDWVFKNHNWTEDQFKAALFEHKIYEDPSVAQHMQKKQFELMMLASQNNPGGF
Ga0314692_1066605313300032754SeawaterMQDPSVQMELFNLGIKMEQPASKAPAELEKQVVIDLVMQSNDHAFDLFKTEYLDVMQKDPMIMPVLISALAHDWVFKNHNWTEDQFKAALFEHKIYEDPAVAQ
Ga0315742_1200371223300032756Forest SoilMDPYASMELFNLGINMEAPTAKAPATLTKEKTIELVKASNDYAFDLFKKEYIDQLRNDPMMMPVLISAIAHDWVYKEHGFTEEEFKAALFEHKIYEDQSVSIHMQ
Ga0315742_1211134733300032756Forest SoilMYDPYASMELFNMGIGMEQPTTTPPEDLTKEKTIELVKSSNDFAFDLFKKEYIDQISSDPLMMPVLISAIAHDWVFKNHNYNEEQFKAALFTHKIYEDPSVAMHMQ
Ga0307390_1015271913300033572MarineMFERSQQFLMQDPALQMELFNLGIKMEQPPTAAPEDLKKDTVIDLVKKSNDFAFELFKKEYLKVMSADPMIMPVLISAIAHDWVFKNHSWSEDQFKAALFEHKIYEEPSVAQHM
Ga0334989_0231825_207_4823300033984FreshwaterMNDPYVSMELFNLGIAMEQPSTESPAQLTADKTIELVKASNDYAFDRFKQQYMDQINQDPMLMPVLISALAHDWVMVNHGFTEDEFKAALF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.