| Basic Information | |
|---|---|
| Family ID | F035932 |
| Family Type | Metagenome |
| Number of Sequences | 171 |
| Average Sequence Length | 42 residues |
| Representative Sequence | AQQLVVVEKDLNGRVTTKEIMPVLFSVLEGSDQPAFRAS |
| Number of Associated Samples | 112 |
| Number of Associated Scaffolds | 171 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 5.88 % |
| % of genes near scaffold ends (potentially truncated) | 92.98 % |
| % of genes from short scaffolds (< 2000 bps) | 90.06 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (66.082 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (29.825 % of family members) |
| Environment Ontology (ENVO) | Unclassified (52.047 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (63.158 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 25.37% Coil/Unstructured: 74.63% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 171 Family Scaffolds |
|---|---|---|
| PF13460 | NAD_binding_10 | 5.26 |
| PF00072 | Response_reg | 3.51 |
| PF01597 | GCV_H | 2.34 |
| PF04392 | ABC_sub_bind | 1.75 |
| PF00676 | E1_dh | 1.75 |
| PF02586 | SRAP | 1.75 |
| PF01135 | PCMT | 1.75 |
| PF00487 | FA_desaturase | 1.17 |
| PF06233 | Usg | 1.17 |
| PF02826 | 2-Hacid_dh_C | 1.17 |
| PF00856 | SET | 1.17 |
| PF00313 | CSD | 0.58 |
| PF03734 | YkuD | 0.58 |
| PF00664 | ABC_membrane | 0.58 |
| PF06577 | EipA | 0.58 |
| PF01799 | Fer2_2 | 0.58 |
| PF09996 | DUF2237 | 0.58 |
| PF01613 | Flavin_Reduct | 0.58 |
| PF13417 | GST_N_3 | 0.58 |
| PF08241 | Methyltransf_11 | 0.58 |
| PF07883 | Cupin_2 | 0.58 |
| PF08240 | ADH_N | 0.58 |
| PF07690 | MFS_1 | 0.58 |
| PF03928 | HbpS-like | 0.58 |
| PF01068 | DNA_ligase_A_M | 0.58 |
| PF00171 | Aldedh | 0.58 |
| PF01863 | YgjP-like | 0.58 |
| PF01663 | Phosphodiest | 0.58 |
| PF12833 | HTH_18 | 0.58 |
| PF01263 | Aldose_epim | 0.58 |
| PF03435 | Sacchrp_dh_NADP | 0.58 |
| PF00550 | PP-binding | 0.58 |
| PF00106 | adh_short | 0.58 |
| PF06411 | HdeA | 0.58 |
| PF12570 | DUF3750 | 0.58 |
| PF13180 | PDZ_2 | 0.58 |
| PF02371 | Transposase_20 | 0.58 |
| PF00111 | Fer2 | 0.58 |
| PF00389 | 2-Hacid_dh | 0.58 |
| PF00211 | Guanylate_cyc | 0.58 |
| PF00186 | DHFR_1 | 0.58 |
| PF00378 | ECH_1 | 0.58 |
| PF02195 | ParBc | 0.58 |
| PF00589 | Phage_integrase | 0.58 |
| PF00005 | ABC_tran | 0.58 |
| PF13419 | HAD_2 | 0.58 |
| PF06537 | DHOR | 0.58 |
| PF02798 | GST_N | 0.58 |
| PF00248 | Aldo_ket_red | 0.58 |
| COG ID | Name | Functional Category | % Frequency in 171 Family Scaffolds |
|---|---|---|---|
| COG0509 | Glycine cleavage system protein H (lipoate-binding) | Amino acid transport and metabolism [E] | 2.34 |
| COG0567 | 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes | Energy production and conversion [C] | 1.75 |
| COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 1.75 |
| COG1071 | TPP-dependent pyruvate or acetoin dehydrogenase subunit alpha | Energy production and conversion [C] | 1.75 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.75 |
| COG2519 | tRNA A58 N-methylase Trm61 | Translation, ribosomal structure and biogenesis [J] | 1.75 |
| COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 1.75 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 1.75 |
| COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 1.75 |
| COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 1.17 |
| COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 1.17 |
| COG2017 | Galactose mutarotase or related enzyme | Carbohydrate transport and metabolism [G] | 0.58 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.58 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.58 |
| COG3488 | Uncharacterized conserved protein with two CxxC motifs, DUF1111 family | General function prediction only [R] | 0.58 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.58 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.58 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.58 |
| COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 0.58 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.58 |
| COG1451 | UTP pyrophosphatase, metal-dependent hydrolase family | General function prediction only [R] | 0.58 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.58 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.58 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.58 |
| COG0676 | D-hexose-6-phosphate mutarotase | Carbohydrate transport and metabolism [G] | 0.58 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.58 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 66.08 % |
| Unclassified | root | N/A | 33.92 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2070309004|prs_FHA1B5K04YEW5R | Not Available | 530 | Open in IMG/M |
| 2170459019|G14TP7Y01A584P | Not Available | 765 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10060732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 968 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10139690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 586 | Open in IMG/M |
| 3300000692|JGI12380J11932_101482 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 694 | Open in IMG/M |
| 3300000695|JGI12539J11930_101765 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 726 | Open in IMG/M |
| 3300000702|JGI12537J11925_102562 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 716 | Open in IMG/M |
| 3300004092|Ga0062389_104589919 | Not Available | 520 | Open in IMG/M |
| 3300004635|Ga0062388_101563775 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 669 | Open in IMG/M |
| 3300005332|Ga0066388_100929829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1443 | Open in IMG/M |
| 3300005332|Ga0066388_101878390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1068 | Open in IMG/M |
| 3300005457|Ga0070662_100399192 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1134 | Open in IMG/M |
| 3300005713|Ga0066905_102188647 | Not Available | 515 | Open in IMG/M |
| 3300005764|Ga0066903_101807916 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
| 3300005764|Ga0066903_104063397 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 784 | Open in IMG/M |
| 3300005764|Ga0066903_104420935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Polaromonas → unclassified Polaromonas → Polaromonas sp. | 750 | Open in IMG/M |
| 3300005764|Ga0066903_106121768 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 629 | Open in IMG/M |
| 3300005764|Ga0066903_107391510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium muleiense | 567 | Open in IMG/M |
| 3300005764|Ga0066903_108077242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 539 | Open in IMG/M |
| 3300006049|Ga0075417_10004056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4767 | Open in IMG/M |
| 3300006050|Ga0075028_100658906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 627 | Open in IMG/M |
| 3300006059|Ga0075017_100645712 | Not Available | 812 | Open in IMG/M |
| 3300006172|Ga0075018_10706075 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300006852|Ga0075433_10068341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3119 | Open in IMG/M |
| 3300006904|Ga0075424_102292588 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300009100|Ga0075418_13071319 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300009177|Ga0105248_11836485 | Not Available | 687 | Open in IMG/M |
| 3300009522|Ga0116218_1468212 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300009792|Ga0126374_10695296 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 764 | Open in IMG/M |
| 3300009792|Ga0126374_11504663 | Not Available | 552 | Open in IMG/M |
| 3300010046|Ga0126384_10018876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4426 | Open in IMG/M |
| 3300010048|Ga0126373_10761205 | Not Available | 1029 | Open in IMG/M |
| 3300010048|Ga0126373_10806986 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1000 | Open in IMG/M |
| 3300010048|Ga0126373_11226056 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 816 | Open in IMG/M |
| 3300010048|Ga0126373_12342313 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
| 3300010358|Ga0126370_11801935 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300010358|Ga0126370_11955915 | Not Available | 572 | Open in IMG/M |
| 3300010359|Ga0126376_12118423 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 606 | Open in IMG/M |
| 3300010361|Ga0126378_10650621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1167 | Open in IMG/M |
| 3300010376|Ga0126381_101440941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 995 | Open in IMG/M |
| 3300010376|Ga0126381_103322307 | Not Available | 634 | Open in IMG/M |
| 3300010376|Ga0126381_104680967 | Not Available | 527 | Open in IMG/M |
| 3300010379|Ga0136449_102473427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 746 | Open in IMG/M |
| 3300010379|Ga0136449_102531036 | Not Available | 735 | Open in IMG/M |
| 3300010398|Ga0126383_10492411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1283 | Open in IMG/M |
| 3300010398|Ga0126383_12470582 | Not Available | 604 | Open in IMG/M |
| 3300010403|Ga0134123_12392923 | Not Available | 593 | Open in IMG/M |
| 3300012089|Ga0153924_1054772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 779 | Open in IMG/M |
| 3300012948|Ga0126375_11645175 | Not Available | 555 | Open in IMG/M |
| 3300012957|Ga0164303_10069269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1640 | Open in IMG/M |
| 3300012971|Ga0126369_12218477 | Not Available | 636 | Open in IMG/M |
| 3300015371|Ga0132258_13677277 | Not Available | 1047 | Open in IMG/M |
| 3300015373|Ga0132257_100274128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2021 | Open in IMG/M |
| 3300015374|Ga0132255_103145274 | Not Available | 704 | Open in IMG/M |
| 3300016270|Ga0182036_10610668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Agrobacterium | 875 | Open in IMG/M |
| 3300016270|Ga0182036_11067508 | Not Available | 668 | Open in IMG/M |
| 3300016294|Ga0182041_10286318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium oropedii | 1359 | Open in IMG/M |
| 3300016294|Ga0182041_11184045 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300016294|Ga0182041_11192624 | Not Available | 694 | Open in IMG/M |
| 3300016294|Ga0182041_11965773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 544 | Open in IMG/M |
| 3300016319|Ga0182033_10600590 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300016319|Ga0182033_10611452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 947 | Open in IMG/M |
| 3300016319|Ga0182033_11096536 | Not Available | 711 | Open in IMG/M |
| 3300016341|Ga0182035_10167782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1705 | Open in IMG/M |
| 3300016371|Ga0182034_10248940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1401 | Open in IMG/M |
| 3300016387|Ga0182040_11047116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 682 | Open in IMG/M |
| 3300016404|Ga0182037_10598817 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| 3300016422|Ga0182039_10000476 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 20571 | Open in IMG/M |
| 3300016422|Ga0182039_10211819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1553 | Open in IMG/M |
| 3300016422|Ga0182039_11922267 | Not Available | 543 | Open in IMG/M |
| 3300016445|Ga0182038_10336438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1246 | Open in IMG/M |
| 3300016445|Ga0182038_10384589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1172 | Open in IMG/M |
| 3300016445|Ga0182038_11701169 | Not Available | 568 | Open in IMG/M |
| 3300017823|Ga0187818_10151353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1010 | Open in IMG/M |
| 3300020579|Ga0210407_10054733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2982 | Open in IMG/M |
| 3300020580|Ga0210403_11002172 | Not Available | 654 | Open in IMG/M |
| 3300021170|Ga0210400_11608720 | Not Available | 513 | Open in IMG/M |
| 3300021403|Ga0210397_10414539 | Not Available | 1009 | Open in IMG/M |
| 3300021479|Ga0210410_10835435 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 807 | Open in IMG/M |
| 3300021560|Ga0126371_10522960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1335 | Open in IMG/M |
| 3300025898|Ga0207692_10630047 | Not Available | 691 | Open in IMG/M |
| 3300025916|Ga0207663_10950448 | Not Available | 688 | Open in IMG/M |
| 3300026823|Ga0207759_116728 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300026835|Ga0207782_112100 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300026847|Ga0207802_1009625 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300026876|Ga0207837_1006779 | Not Available | 1045 | Open in IMG/M |
| 3300026889|Ga0207745_1019792 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300027049|Ga0207806_1025158 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300027090|Ga0208604_1013302 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 782 | Open in IMG/M |
| 3300027680|Ga0207826_1052675 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1126 | Open in IMG/M |
| 3300028720|Ga0307317_10209108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. CF079 | 658 | Open in IMG/M |
| 3300031128|Ga0170823_12472814 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 602 | Open in IMG/M |
| 3300031474|Ga0170818_102680090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 535 | Open in IMG/M |
| 3300031543|Ga0318516_10028960 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2906 | Open in IMG/M |
| 3300031545|Ga0318541_10465259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 707 | Open in IMG/M |
| 3300031546|Ga0318538_10306989 | Not Available | 855 | Open in IMG/M |
| 3300031549|Ga0318571_10296394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 607 | Open in IMG/M |
| 3300031573|Ga0310915_10148726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1618 | Open in IMG/M |
| 3300031573|Ga0310915_10482086 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300031668|Ga0318542_10132942 | All Organisms → cellular organisms → Bacteria | 1225 | Open in IMG/M |
| 3300031680|Ga0318574_10899765 | Not Available | 518 | Open in IMG/M |
| 3300031682|Ga0318560_10084402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1624 | Open in IMG/M |
| 3300031719|Ga0306917_10000114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 27199 | Open in IMG/M |
| 3300031736|Ga0318501_10285805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium oropedii | 878 | Open in IMG/M |
| 3300031736|Ga0318501_10458502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 692 | Open in IMG/M |
| 3300031744|Ga0306918_10000177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 26587 | Open in IMG/M |
| 3300031744|Ga0306918_10088079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2178 | Open in IMG/M |
| 3300031744|Ga0306918_10353846 | Not Available | 1140 | Open in IMG/M |
| 3300031744|Ga0306918_10391928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1081 | Open in IMG/M |
| 3300031744|Ga0306918_10529121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 923 | Open in IMG/M |
| 3300031747|Ga0318502_11009597 | Not Available | 507 | Open in IMG/M |
| 3300031748|Ga0318492_10736292 | Not Available | 529 | Open in IMG/M |
| 3300031753|Ga0307477_10223806 | Not Available | 1306 | Open in IMG/M |
| 3300031754|Ga0307475_10453660 | Not Available | 1030 | Open in IMG/M |
| 3300031754|Ga0307475_10982906 | Not Available | 664 | Open in IMG/M |
| 3300031763|Ga0318537_10399659 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300031792|Ga0318529_10297888 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300031793|Ga0318548_10023823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2618 | Open in IMG/M |
| 3300031793|Ga0318548_10425473 | Not Available | 651 | Open in IMG/M |
| 3300031797|Ga0318550_10376862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 687 | Open in IMG/M |
| 3300031859|Ga0318527_10408506 | Not Available | 579 | Open in IMG/M |
| 3300031879|Ga0306919_11254807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 562 | Open in IMG/M |
| 3300031879|Ga0306919_11422580 | Not Available | 523 | Open in IMG/M |
| 3300031879|Ga0306919_11470237 | Not Available | 513 | Open in IMG/M |
| 3300031890|Ga0306925_10230930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens | 1995 | Open in IMG/M |
| 3300031890|Ga0306925_10239874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1954 | Open in IMG/M |
| 3300031890|Ga0306925_10466839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1347 | Open in IMG/M |
| 3300031890|Ga0306925_10712244 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1049 | Open in IMG/M |
| 3300031894|Ga0318522_10060707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → unclassified Xanthobacteraceae → Xanthobacteraceae bacterium | 1352 | Open in IMG/M |
| 3300031910|Ga0306923_11332715 | Not Available | 760 | Open in IMG/M |
| 3300031910|Ga0306923_12471132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 513 | Open in IMG/M |
| 3300031912|Ga0306921_10093906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3468 | Open in IMG/M |
| 3300031912|Ga0306921_10159880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2637 | Open in IMG/M |
| 3300031941|Ga0310912_10716206 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 775 | Open in IMG/M |
| 3300031945|Ga0310913_10371814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1013 | Open in IMG/M |
| 3300031946|Ga0310910_10002931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 9766 | Open in IMG/M |
| 3300031946|Ga0310910_10079519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens | 2385 | Open in IMG/M |
| 3300031946|Ga0310910_11508550 | Not Available | 515 | Open in IMG/M |
| 3300031947|Ga0310909_10167753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens | 1813 | Open in IMG/M |
| 3300031947|Ga0310909_11643130 | Not Available | 508 | Open in IMG/M |
| 3300031954|Ga0306926_10061564 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4516 | Open in IMG/M |
| 3300031954|Ga0306926_10849496 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1097 | Open in IMG/M |
| 3300031954|Ga0306926_12513559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 564 | Open in IMG/M |
| 3300031962|Ga0307479_11370805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 667 | Open in IMG/M |
| 3300031962|Ga0307479_11384025 | Not Available | 663 | Open in IMG/M |
| 3300031962|Ga0307479_11980921 | Not Available | 532 | Open in IMG/M |
| 3300031981|Ga0318531_10152594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1035 | Open in IMG/M |
| 3300031981|Ga0318531_10490309 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300032001|Ga0306922_10559416 | Not Available | 1215 | Open in IMG/M |
| 3300032035|Ga0310911_10223755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 1074 | Open in IMG/M |
| 3300032035|Ga0310911_10284952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 949 | Open in IMG/M |
| 3300032041|Ga0318549_10433671 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300032043|Ga0318556_10632539 | Not Available | 558 | Open in IMG/M |
| 3300032059|Ga0318533_10703058 | Not Available | 742 | Open in IMG/M |
| 3300032060|Ga0318505_10635089 | Not Available | 501 | Open in IMG/M |
| 3300032063|Ga0318504_10510195 | Not Available | 576 | Open in IMG/M |
| 3300032076|Ga0306924_10372571 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1636 | Open in IMG/M |
| 3300032076|Ga0306924_10419230 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 1531 | Open in IMG/M |
| 3300032076|Ga0306924_10423799 | Not Available | 1522 | Open in IMG/M |
| 3300032076|Ga0306924_10433175 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1503 | Open in IMG/M |
| 3300032076|Ga0306924_11364208 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300032076|Ga0306924_12407547 | Not Available | 531 | Open in IMG/M |
| 3300032090|Ga0318518_10330961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 782 | Open in IMG/M |
| 3300032180|Ga0307471_100400952 | Not Available | 1499 | Open in IMG/M |
| 3300032261|Ga0306920_100629734 | All Organisms → cellular organisms → Bacteria | 1586 | Open in IMG/M |
| 3300032261|Ga0306920_100912200 | Not Available | 1284 | Open in IMG/M |
| 3300032261|Ga0306920_101741436 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300032261|Ga0306920_102431336 | Not Available | 722 | Open in IMG/M |
| 3300032261|Ga0306920_103965062 | Not Available | 538 | Open in IMG/M |
| 3300033289|Ga0310914_10956089 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 29.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 25.73% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.11% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 11.11% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.09% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.34% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.34% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.75% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.75% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.75% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.17% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.17% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.58% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.58% |
| Green-Waste Compost | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Green-Waste Compost | 0.58% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.58% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.58% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.58% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.58% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.58% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2070309004 | Green-waste compost microbial communities at University of California, Davis, USA, from solid state bioreactor - Luquillo Rain Forest, Puerto Rico | Environmental | Open in IMG/M |
| 2170459019 | Litter degradation MG4 | Engineered | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000692 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 25 | Environmental | Open in IMG/M |
| 3300000695 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 74 | Environmental | Open in IMG/M |
| 3300000702 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 77 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012089 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ008 MetaG | Host-Associated | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026823 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 19 (SPAdes) | Environmental | Open in IMG/M |
| 3300026835 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 60 (SPAdes) | Environmental | Open in IMG/M |
| 3300026847 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 20 (SPAdes) | Environmental | Open in IMG/M |
| 3300026876 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 58 (SPAdes) | Environmental | Open in IMG/M |
| 3300026889 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 57 (SPAdes) | Environmental | Open in IMG/M |
| 3300027049 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 72 (SPAdes) | Environmental | Open in IMG/M |
| 3300027090 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF016 (SPAdes) | Environmental | Open in IMG/M |
| 3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| prs_00764800 | 2070309004 | Green-Waste Compost | LVVVEKDLNGRVITKEIMPVLFSVLEGSDQPAFRAS |
| 4MG_01558700 | 2170459019 | Switchgrass, Maize And Mischanthus Litter | GLPEAQQLVIAQKDLSGRITVKEIMPVQFSLFEETDEPAFRAS |
| AF_2010_repII_A1DRAFT_100607321 | 3300000597 | Forest Soil | GLLGAQQLVVVEKDPNGRVTTKEIMPVLFSVLEGSDQPAFRAS* |
| AF_2010_repII_A1DRAFT_101396901 | 3300000597 | Forest Soil | AQQLVVVEKDPNGRVTTKEIMPVLFSSLEGSDQPAFRAS* |
| JGI12380J11932_1014823 | 3300000692 | Tropical Forest Soil | MVIPVGLPGAQQLVVAEKDLSGRVTTKEIMPVLFSVLEESDXPXFRASXSX* |
| JGI12539J11930_1017651 | 3300000695 | Tropical Forest Soil | VGLPGAQQLVVVEKDLSGRVTTKEIMPVLFSVLEESDQPAFRAS* |
| JGI12537J11925_1025621 | 3300000702 | Tropical Forest Soil | PVGLPGAQQLVVVEKDLSGRVTTKEIMPVLFSVLEESDQPAFRAS* |
| Ga0062389_1045899191 | 3300004092 | Bog Forest Soil | NSDGDQCEKDLSGRVTIREVMPVRFSLFEGNDEPPFRAS* |
| Ga0062388_1015637751 | 3300004635 | Bog Forest Soil | GLPLAQQLVMAEKDLTGRVTTKEFMPVLFSLLEGSDEPAFRAS* |
| Ga0066388_1009298292 | 3300005332 | Tropical Forest Soil | MVIPVGLLVAKQLVVVEKDLNGRVTTKEIMPVLFSVLEGSDQPAFRAS* |
| Ga0066388_1018783901 | 3300005332 | Tropical Forest Soil | PVGLLGAQQLVVVKKDLNGKVTTKEIMPVLFSVLEGSDQPAFRAS* |
| Ga0070662_1003991921 | 3300005457 | Corn Rhizosphere | VGLPDAQKLVVADKDLDGRVGMKEIVRVLFSLLEGSDQPTLRPS* |
| Ga0066905_1021886472 | 3300005713 | Tropical Forest Soil | LVVAEKDLNGRVTTKEIMPVLFSVLEGSDQPAFRAS* |
| Ga0066903_1018079161 | 3300005764 | Tropical Forest Soil | LAEKDVNGRIATKEIMPVLFSLLEGADQPSLRMS* |
| Ga0066903_1040633972 | 3300005764 | Tropical Forest Soil | MVIPVGLAGAQQLAVADKDLSGRVTIKEVMPVLFSKFEETDEPAFRAF* |
| Ga0066903_1044209351 | 3300005764 | Tropical Forest Soil | GLPVAQELVLVEKDLNGKVTTKEIMPVLFSVLEGSDQPTSRAS* |
| Ga0066903_1061217682 | 3300005764 | Tropical Forest Soil | RMVIPVGLLGAQQLVVVEKDLNGRVITKEIMPVLFSALEGSDQPAFRAS* |
| Ga0066903_1073915102 | 3300005764 | Tropical Forest Soil | QKLVVADKDLNGKVETKEIMGVLFSLLEGSDQPMLRPS* |
| Ga0066903_1080772421 | 3300005764 | Tropical Forest Soil | PVGLLGAQQLVVVEKDLNGRVTTKEIMPVLFSVLEGSDQTAFRAS* |
| Ga0075417_100040567 | 3300006049 | Populus Rhizosphere | LVVAEKDLNGRVTTREIMPVLFSVLEGSDQPTFRAS* |
| Ga0075028_1006589062 | 3300006050 | Watersheds | DAQQLVLAEKDINGRVTTKEIMPVRFSLLEEPDQPAFRPS* |
| Ga0075017_1006457122 | 3300006059 | Watersheds | VLAEKDINGRVTTKEIMPVRFSLLEEPDQPAFRPS* |
| Ga0075018_107060751 | 3300006172 | Watersheds | MVIPVGLPEAQQLVVAERDLRGRFTMKEIMPVLFSKFEGNDEPAFRAS* |
| Ga0075433_100683411 | 3300006852 | Populus Rhizosphere | VGLPGAQQLVVAEKDLNGRVTTKEIMPVLFSVLEESDQAAFRAS* |
| Ga0075424_1022925882 | 3300006904 | Populus Rhizosphere | MVMPVGLPEDQQLVLAEKDLAGKFTMKEIMPVLFSRLEEPDQAVLRAS* |
| Ga0075418_130713191 | 3300009100 | Populus Rhizosphere | AQHLVVAEKDLNGRVTTREIMPVLFSVLEGSDQPAFRAS* |
| Ga0105248_118364852 | 3300009177 | Switchgrass Rhizosphere | AQQLVVAEKSLDGKVKTKEFMQVLFSMLEGSFDPPAFRPS* |
| Ga0116218_14682121 | 3300009522 | Peatlands Soil | KLVVADKDLNGRVGTKEIMPVLLSLLEGSDQQTLRLS* |
| Ga0126374_106952963 | 3300009792 | Tropical Forest Soil | VGLPRAQQLLVAEKDRNGKVTTKEIMPVLFSLLEGSEQPAFRAS* |
| Ga0126374_115046631 | 3300009792 | Tropical Forest Soil | AQQLVVVEKDLNGRVTTKEIMPVLFSVVEGSDQTAFRAS* |
| Ga0126384_100188761 | 3300010046 | Tropical Forest Soil | MVIPVGLPRAQQLLMAEKDRNGKIATKEIMPVLFSVLEGSDESAFRAS* |
| Ga0126373_107612054 | 3300010048 | Tropical Forest Soil | VVVEKDLNGRVTTKEIMPVLFSVLEGSDQPAFRAS* |
| Ga0126373_108069862 | 3300010048 | Tropical Forest Soil | QQLVVVEKDVNGKVTTKEIMPVLFSVLEGSDQPAFRAS* |
| Ga0126373_112260562 | 3300010048 | Tropical Forest Soil | LLVAEKDRNGKIATKEIMPVLFSLLEGSEQPAFRAS* |
| Ga0126373_123423132 | 3300010048 | Tropical Forest Soil | LVLVEKDLNGKVTTKEIMPVLFSLLEGSDQPAFRAS* |
| Ga0126370_118019351 | 3300010358 | Tropical Forest Soil | VVDKDLNGKVATSQMMPVLFSVLEGSDQPAFRAS* |
| Ga0126370_119559152 | 3300010358 | Tropical Forest Soil | LLGAQQLVVVEKDPNGRVTTKEIMPVLFSVLEGSDQPAFRAS* |
| Ga0126376_121184233 | 3300010359 | Tropical Forest Soil | IPVGLPQQLLVAEKDQNGKVTTKEIMPVLFSLLEGSEQPAFRAS* |
| Ga0126378_106506211 | 3300010361 | Tropical Forest Soil | IPVGLPGAQQLVVAEKDPNGRVKTKEIMPVLFSELEGSDQPTFRAS* |
| Ga0126381_1014409411 | 3300010376 | Tropical Forest Soil | PVGLPGAQQLVVAEKDPNGRVKTKEIMPVLFSELEGSDQPAFRAS* |
| Ga0126381_1033223071 | 3300010376 | Tropical Forest Soil | PVGLLGAQQLVVVEKDPNGRVTTKEIMPVLFSLLEGSDQPAFRAS* |
| Ga0126381_1046809672 | 3300010376 | Tropical Forest Soil | LPDAQKLVVADKDLNGKVETKEIMGVLFSLLEGSDQPTLRPS* |
| Ga0136449_1024734271 | 3300010379 | Peatlands Soil | LPEAQQLVVAEKDLNGRVTTKEIMPVLFSVLEGSDEPALRPS* |
| Ga0136449_1025310361 | 3300010379 | Peatlands Soil | LPEAQQLVVAEKDLNGRVTTKEIMPVLFSVLEGSDEPALRLS* |
| Ga0126383_104924113 | 3300010398 | Tropical Forest Soil | PVGLPGAQQLVVAEKDPNGRVKTKEIMPVLFSELEGSDQPTFRAS* |
| Ga0126383_124705822 | 3300010398 | Tropical Forest Soil | VIPVGLPDAQQLLLAEKDLNGRIATKEIMPVLFSLLGGADQPSLRMS* |
| Ga0134123_123929231 | 3300010403 | Terrestrial Soil | VVAERDLDGKVKTKEIMQVLFSMLEGSFDPRAFRPS* |
| Ga0153924_10547721 | 3300012089 | Attine Ant Fungus Gardens | MVIPVGLPEAQQLVVAQKELSGRITVREIMPVRFSPFEATEEPAFRAS* |
| Ga0126375_116451751 | 3300012948 | Tropical Forest Soil | VIPVGLPGAQQLVVAEKDLNGRVTTKEIMPVLFSVLEGSDQPTFRAS* |
| Ga0164303_100692691 | 3300012957 | Soil | PVGLPGAQQLVVAEKDLNSRVTTREIMPVLFSVLEGSDQPAFRAS* |
| Ga0126369_122184772 | 3300012971 | Tropical Forest Soil | VGLLGAQQLVVVEKDSNGKVTTKEIMPVLFSVLEGSDQPAFRAS* |
| Ga0132258_136772772 | 3300015371 | Arabidopsis Rhizosphere | LVVVDKDLNGRVTTKEIMQGLFSLLDGSDQPAFRPS* |
| Ga0132257_1002741281 | 3300015373 | Arabidopsis Rhizosphere | RMVIPVGLPGAQQLVVAEKDLNGRGTTKEIMPVLFSVLEGSAQPAFRAS* |
| Ga0132255_1031452741 | 3300015374 | Arabidopsis Rhizosphere | KLVVADKDLNGKVGTKEIMRVLFSLLEGSDQPSARPS* |
| Ga0182036_106106681 | 3300016270 | Soil | QLVVVDKDLNGRVTTKEIMPVLFSVLEGSDESAFRAS |
| Ga0182036_110675081 | 3300016270 | Soil | LVVVEKDLNGRVTTKEIMPVLFSVLEGSDQPAFRAS |
| Ga0182041_102863182 | 3300016294 | Soil | LPVAQQLVVVDKDLNGRVATKEIMPVLCSVLEGSDESAFRAS |
| Ga0182041_111840452 | 3300016294 | Soil | PVGLLGTQQLAVVEKDLNGKVTTKEIMPVLFSVLEGSDQPAFRAS |
| Ga0182041_111926242 | 3300016294 | Soil | IPVGLLGAQQLVVVEKDLNGRVTTKEIMPVLFSVLEGSDQPAFRAS |
| Ga0182041_119657732 | 3300016294 | Soil | VVANKDLNGKVGTKEIMRVLFSLLEESYQPTSRPS |
| Ga0182033_106005901 | 3300016319 | Soil | GAQQLVVAEKDLNGRVTTKEIMPVLFSVLEGSDQTAFRAS |
| Ga0182033_106114521 | 3300016319 | Soil | PVGLLGAQQLVVVEKDLNGRVTTKEIMPVLFSVLEGSDQTAFRAS |
| Ga0182033_110965361 | 3300016319 | Soil | QLLLAEKGLNGRIATKEIMPVLFSLLEGAFQPSFRMS |
| Ga0182035_101677822 | 3300016341 | Soil | GLLGNQQLVVVEKDLNGRVTTKEIMPVLFSVLEGSDQPAFRAS |
| Ga0182034_102489402 | 3300016371 | Soil | MVIPVGLLGAQQLVVVEKDLNGRVTTKEIMPVLFSVLEGSDQTAFRAS |
| Ga0182040_110471161 | 3300016387 | Soil | GAQQLVVVEKDLNGKVITKEIMPVLFSVLEGSDQPAFRAS |
| Ga0182037_105988173 | 3300016404 | Soil | IPVGLLGAQQLVVVEKDLNGRVATKEIMPVLFSVLEESDQPAFRAS |
| Ga0182039_1000047622 | 3300016422 | Soil | VGLPGDQQLVVAEKDLNGRVTTREIMPVLFSVLEGSDQPAFRAS |
| Ga0182039_102118191 | 3300016422 | Soil | LVLVEKDLNGKVTTKEIMPVLFSVLEELDQPTFRAS |
| Ga0182039_119222671 | 3300016422 | Soil | LVVVEKDLNGRVITKEIMPVLFSVLEGSDQPTFRAS |
| Ga0182038_103364382 | 3300016445 | Soil | LGAQQLVVVEKDLNGRVTTKEIMPVLFSVLEGSDKTAFRAS |
| Ga0182038_103845891 | 3300016445 | Soil | LVVVEKDLNGRVITKEIMPVLFSVLEGYDQPAFRAS |
| Ga0182038_117011692 | 3300016445 | Soil | QQLVVAEKDPNGRVKTKEIMPVLFSELEGSDQPAFRAS |
| Ga0187818_101513532 | 3300017823 | Freshwater Sediment | IPVGLPGAQQLVVVEKDLNGKVTTKEIMPVLFSLLEGSEQPVFRAS |
| Ga0210407_100547336 | 3300020579 | Soil | QQLVLAEEDLSGKFTMKEIMPVLFSRLEEPDQAAFRAS |
| Ga0210403_110021722 | 3300020580 | Soil | VVAERDLLGRFTMKEIMPVLFSKFEGNDEPAFRAS |
| Ga0210400_116087202 | 3300021170 | Soil | PVGLPDAQKLVVAAKDLNGRVGTKEIMQVLFSLLEGSDQPTLRPS |
| Ga0210405_106228532 | 3300021171 | Soil | LPDAQKLVVAAKDLNGKVGTKEIMQVLFSLLEGSDQPTLRPS |
| Ga0210397_104145391 | 3300021403 | Soil | NAQQLVVAEKDLNGRVTTKEIMGVLFSLLEEPDQPAMRAS |
| Ga0210410_108354353 | 3300021479 | Soil | AQKLVVAAKDLNGKVGTKEIMRVLFSLLEGSDQPTLRPS |
| Ga0126371_105229601 | 3300021560 | Tropical Forest Soil | RMVIPVGLLGAQQLVVVEKDLAGKVTTSQMMPVLFSVLEGSDQPAFRAS |
| Ga0207692_106300472 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | EAQQLVVAEKDLNGRVTTKEITRVLFSLLEGSDQPAFRAS |
| Ga0207663_109504482 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | GLLGAQQLVVVEKDLNGKVTTKEIMPVLFSVLEESDESAIRAS |
| Ga0207759_1167282 | 3300026823 | Tropical Forest Soil | IPVGLLGAQQLVVVKKDLNGKVTTKEIMPVLFSVLEGSDQPAFRAS |
| Ga0207782_1121001 | 3300026835 | Tropical Forest Soil | AQQLVVVEKDLNGRVITKEIMPVLFSVLEGSDQAAFRAS |
| Ga0207802_10096253 | 3300026847 | Tropical Forest Soil | LGAQQLVVVEKDLNGRVTTKEIMPVLFSVLEGSDQPAFRAS |
| Ga0207837_10067791 | 3300026876 | Tropical Forest Soil | VVVEKDLNGRVTTKEIMPVLFSVLEGSDQPASRAS |
| Ga0207745_10197923 | 3300026889 | Tropical Forest Soil | QQLVVVEKDLNGRVTTKEIMPVLFSVLEGSDQPAFRAS |
| Ga0207806_10251581 | 3300027049 | Tropical Forest Soil | AQQLVVVEKDLNGRVTTKEIMPVLFSVLEGSDQPAFRAS |
| Ga0208604_10133022 | 3300027090 | Forest Soil | LVLVEKDLNGKVTTKEIMPVLFSVLEGSDQPTFRAS |
| Ga0207826_10526751 | 3300027680 | Tropical Forest Soil | VVVKKDLNGKVTTKEIMPVLFSVLEGSDQPAFRAS |
| Ga0307317_102091081 | 3300028720 | Soil | GLPSAQQLVVAEKDLNGRVTTKEIMPVLFSVLEESDQPAFRAS |
| Ga0170823_124728142 | 3300031128 | Forest Soil | MVIPVGLSGAQQPVVAEKDLNGRVTTKEIMPVLFSVLEESDQPAFRAS |
| Ga0170818_1026800902 | 3300031474 | Forest Soil | PDAQQLVLADKDVNGRVTTKEIMPVRFSLLEEPDQPAFRPS |
| Ga0318516_100289602 | 3300031543 | Soil | MVIPVGLLHAQQLVVVDKDLNGKITTKEIMPVLFSVLEESDEPEFRAS |
| Ga0318541_104652592 | 3300031545 | Soil | LGAQQLVVVEKDLNGRVTTKEIMPVLFSVLEGSDQLAFRAS |
| Ga0318538_103069891 | 3300031546 | Soil | GLLSAQQLVVVEKDLNGRITTKEIMPVLFSVLEGSDQPAFRAS |
| Ga0318571_102963941 | 3300031549 | Soil | VVAEKDIDGRVTTKEIMPVLFSLLEGSEQPSFRAS |
| Ga0310915_101487263 | 3300031573 | Soil | MVIPVGLPGAQQLVVAEKDPNGRVKTKEIMPVLFSELEGSDQPAFRAS |
| Ga0310915_104820863 | 3300031573 | Soil | VIPVGLLGAQQLVVVEKDLNGRVTTKEIMPVLFSVLEGSDQPASWAS |
| Ga0318542_101329421 | 3300031668 | Soil | QLVVAEKNRNGRVTTKEIMPVLFSVLEGSDQAAFRAS |
| Ga0318574_108997651 | 3300031680 | Soil | VGLFGAQQLVVVKKDLNGRVTTKEIMPVLFSVLEGSDQPAFRAS |
| Ga0318560_100844021 | 3300031682 | Soil | GLLGAQQLVVVEKDLNGRVTTKEIMPVLFSVLEGSDQTAFRAS |
| Ga0306917_1000011429 | 3300031719 | Soil | AQQLVVVDKDLNGRVTTKEIMPVLFSVLEGSDESAFRAS |
| Ga0318501_102858051 | 3300031736 | Soil | QQLVVVDKDLNGRVTTKEIMPVLFSVLEGSDESAFRAS |
| Ga0318501_104585023 | 3300031736 | Soil | GLPSAQQLVVVEKDLNGRVTTKEIMPVLFSVLEGSDQPAFRAS |
| Ga0306918_1000017729 | 3300031744 | Soil | LVVVDKDLNGRVTTKEIMPVLFSVLEGSDESAFRAS |
| Ga0306918_100880794 | 3300031744 | Soil | VGLLGAQQLVVVEKDLNGRVTTKEIMPVLFSVLEGSDQPAFRAS |
| Ga0306918_103538464 | 3300031744 | Soil | QQLVLAEKDLNGRIATKEIMPVLFSLLEGADQPSFRMS |
| Ga0306918_103919281 | 3300031744 | Soil | RMVIPVGLLGAQQLVVVEKDLNGRVTTKEIMPVLFSVLEGSDQAAFRAS |
| Ga0306918_105291211 | 3300031744 | Soil | PVGLLGAQQLVVVEKDLNGRVTTKEIMPVLFSVLEGSDQPAFRAS |
| Ga0318502_110095972 | 3300031747 | Soil | AQQLVVVQKDLNGRVITKEIMPVLFSVLEGSDQPTFRAS |
| Ga0318492_107362922 | 3300031748 | Soil | MVIPVGLFGAQQLVVVEKDLNGRVTTKEIMPVLFSVLEGSDQPAFRAS |
| Ga0307477_102238061 | 3300031753 | Hardwood Forest Soil | HAQQLVVVDKDLNGKVTTKEIMPVLFSVLEESDESAFRAS |
| Ga0307475_104536601 | 3300031754 | Hardwood Forest Soil | IPVGLLHAQQLVVVDKDLNGKVTTKEIMPVLFSVLEESDESAIRAS |
| Ga0307475_109829061 | 3300031754 | Hardwood Forest Soil | QLVLAQKDLNGRVATKEIIPVLFSLLEGSEQPAFRAS |
| Ga0318537_103996592 | 3300031763 | Soil | LGAQQLVVAEKNRNGRVTTKEIMPVLFSVLEGSDQAAFRAS |
| Ga0318529_102978881 | 3300031792 | Soil | VVAEKNRNGRVTTKEIMPVLFSVLEGSDQAAFRAS |
| Ga0318548_100238231 | 3300031793 | Soil | VIPVGLLGAQQLVVVEKDLNGRVTTKEIMPVLFSVLEGSDQPAFRAS |
| Ga0318548_104254732 | 3300031793 | Soil | VVVEKDLNGKVTTKEIMPVLFSVLEGSDQPAFRAS |
| Ga0318550_103768622 | 3300031797 | Soil | VGLLGAQQLVVVEKDLNGRVTTKEIMPVLFSVLEGSDQTAFRAS |
| Ga0318527_104085061 | 3300031859 | Soil | QQLVLVEKDWNGRVTTKEIMPVLFSVLEGSDQPAFRAS |
| Ga0306919_112548071 | 3300031879 | Soil | VVAEKDPNGRVKTKEIMPVLFSELEGSDQPAFRAS |
| Ga0306919_114225801 | 3300031879 | Soil | QQLVMVEKDLNGRVTTKEIMPVAFSVLEGSDQPAFRAS |
| Ga0306919_114702372 | 3300031879 | Soil | QQLVVVEKDLNGKVTTKEIMPVLFSVLEGSDQPAFRAS |
| Ga0306925_102309301 | 3300031890 | Soil | RMVIPVGLLGAQQLVVVEKDLNGRVITKEIMPVLFSVLEGSEQPAFRAS |
| Ga0306925_102398741 | 3300031890 | Soil | VTPVGLLGAQQLGMVEKDLNGRVTTKEIMPVLFSVLGGSDQPAFRAS |
| Ga0306925_104668394 | 3300031890 | Soil | STNSRLTEGPVGLLGAQQLVVVEKDSNGKVTTKEIMPVLFSVLEGSDQPAFRTS |
| Ga0306925_107122442 | 3300031890 | Soil | PRKNGDPGLPIAQQLVLVEKDLNGKVTTKEIMPVLFSVLEGSDQPTFRAS |
| Ga0318522_100607071 | 3300031894 | Soil | QLVVVEKDLNGRVTTKEIMPVLFSVLEGSDQPAFRAS |
| Ga0306923_113327151 | 3300031910 | Soil | QQLVLTEKDVNGRIATKEIMPVLFSLLEGADQPSLRMS |
| Ga0306923_124711321 | 3300031910 | Soil | VGLPSAQQLVVVEKDLNGRVTTKEIMPVLFSVLEGSDQPAFRAS |
| Ga0306921_100939061 | 3300031912 | Soil | GAQQLVVVEKDVNGKVTTKEIMPVLFSVLEGSDQPAFRAS |
| Ga0306921_101598802 | 3300031912 | Soil | MGRSGQQLVLAEKNLNGRVTTNEIMPVLFSVLEGPDESAFRAS |
| Ga0310912_107162062 | 3300031941 | Soil | MVIPVGLLGAQQLVVVEKDLNGRVITKEIMPVLFSVLEGSDQPAFRAS |
| Ga0310913_103718142 | 3300031945 | Soil | GLLGAQQLVVVEKDLNGRVTTKEIMPVLFSVLEGSDQLAFRAS |
| Ga0310910_1000293115 | 3300031946 | Soil | VVVDKDLNGRVTTKEIMPVLFSVLEGSDESAFRAS |
| Ga0310910_100795194 | 3300031946 | Soil | VIPVGLLGAQQLVVVEKDLNGRVITKEIMPVLFSVLEGYDQPAFRAS |
| Ga0310910_115085502 | 3300031946 | Soil | GAQQLVVAEKDPNGRVKTKEIMPVLFSELEGSDQPAFRAS |
| Ga0310909_101677533 | 3300031947 | Soil | RMVIPVGLLGAQQLVVVEKDLNGRVITKEIMPVLFSVLEGSDQPTFRAS |
| Ga0310909_116431301 | 3300031947 | Soil | LPSAQQLVVVEKDLNGRVTTKEIMPVLFSVLEGSDQPAFRAS |
| Ga0306926_100615641 | 3300031954 | Soil | VGLLGAQQLVVVEKDLNGKVTTKEIMPVLFSVLEGSDQPAFRAS |
| Ga0306926_108494962 | 3300031954 | Soil | MVIPVGLLGAQQLVVVEKDLNGKVTTKEIMPVLFSVLEGSDQPAFRAS |
| Ga0306926_125135592 | 3300031954 | Soil | VIPVGLPVAQQLVVVDKDLNGRVATKEIMPVLFSVLEGSDESAFRAS |
| Ga0307479_113708052 | 3300031962 | Hardwood Forest Soil | VIPVGLLGAQQLVVVDKDLNGKVTTKEIMPVLFSVLEGSDQPTFRAS |
| Ga0307479_113840252 | 3300031962 | Hardwood Forest Soil | GLLHAQQLVVVDKDLNGKVTTKEIIPVLFSVLEESDESAFRAS |
| Ga0307479_119809211 | 3300031962 | Hardwood Forest Soil | AQQLLLAEKDLNGRIATKEIMPVLFSLLEGADQPSFRIS |
| Ga0318531_101525943 | 3300031981 | Soil | RMVIPVGLLGAQQLVVVEKDLNGRVTTKEIMPVLFSVLEGSDQLAFRAS |
| Ga0318531_104903091 | 3300031981 | Soil | AQQLVVAEKNRNGRVTTKEIMPVLFSVLEGSDQAAFRAS |
| Ga0306922_105594163 | 3300032001 | Soil | LLGAQQLVVVGKDLNGWVTTKEIMPVMFSVLEGSDRPAFRAS |
| Ga0310911_102237551 | 3300032035 | Soil | LPSAQQLVVAEKDIDGRVTTKEIMPVLFSLLEGSEQPSFRAS |
| Ga0310911_102849522 | 3300032035 | Soil | VGLLGAQQLVVVEKDPNGRVTTKEIMPVLFSVLEGSDQPAFRAS |
| Ga0318549_104336712 | 3300032041 | Soil | VIPVGLLGAQQLVVAEKNRNGRVTTKEIMPVLFSVLEGSDQAAFRAS |
| Ga0318556_106325391 | 3300032043 | Soil | GAQQLVVAEKDPNGRVTTKEIMPVLFSVLEESDQPAFRAS |
| Ga0318533_107030582 | 3300032059 | Soil | LLAEKDLNGRIATKEIMPVLFSLLEGADQPSFRMS |
| Ga0318505_106350892 | 3300032060 | Soil | PFGAQQLVVVEKDLNGRVTTKEIMPVLFSVLEGSDQPAFRAS |
| Ga0318504_105101951 | 3300032063 | Soil | GLLRAQQLVVVQKDLNGRVITKEIMPVLFSVLEGSDQPTFRAS |
| Ga0306924_103725711 | 3300032076 | Soil | VGLPDAQQLVLAEKDVNGRIATKEIMPVLFSLLEGADQPSLRMS |
| Ga0306924_104192302 | 3300032076 | Soil | QLVLVEKDLNGKVTTKQIMSVLFSVLEELDQPTFRAS |
| Ga0306924_104237991 | 3300032076 | Soil | GLLGTQQLVVVEKDLNGRVTTKEIMPVLFSVLEGSDQPAFRAS |
| Ga0306924_104331753 | 3300032076 | Soil | LLGAQQLVVVEKDLNGRVITKEIMPVLFSVLEGSEQPAFRAS |
| Ga0306924_113642081 | 3300032076 | Soil | LPGAQQLVVVEKDVNGRVTTREIMPVLFSVLEGSDQPAFRAS |
| Ga0306924_124075472 | 3300032076 | Soil | GLPDAQQLVLAEKDVNGRIATKEIMPVLFSLLEGSDQPTLRPS |
| Ga0318518_103309611 | 3300032090 | Soil | VIPVGLPGAQQLVVAEKDPNGRVKTKEIMPVLFSELEGSDQPAFRAS |
| Ga0307471_1004009521 | 3300032180 | Hardwood Forest Soil | QLVVVEKDLNGKVTTKEIMPVLFSVLEESDESAIRAS |
| Ga0306920_1006297342 | 3300032261 | Soil | QQLVVAEKDLNGRVTTKEIMPVLFSLLEGVEQPSFRAS |
| Ga0306920_1009122003 | 3300032261 | Soil | LGAQQLVVVEKDSNGKVTTKEIMPVLFSVLEESDQPAFRAS |
| Ga0306920_1017414362 | 3300032261 | Soil | VLVEKDLNGKVTTKEIMPVLFSVLEELDQPTFRAS |
| Ga0306920_1024313361 | 3300032261 | Soil | LVVVEKDLNGKVTTKEIMPVLFSVLEGSDQPAFRAS |
| Ga0306920_1039650621 | 3300032261 | Soil | PVGLLGAQQLVVAEKDRNGRVTTKKIMPVLFSVLEGSDQAAFRAS |
| Ga0310914_109560892 | 3300033289 | Soil | MVIPVGLLGAQQLVVVEKDLNGRVTTKEIMPVLFSVLEGSDQPASWAS |
| ⦗Top⦘ |