| Basic Information | |
|---|---|
| Family ID | F035850 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 171 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MPPRKASREEARARTKTDTGGQVENTKVIEITLVKELGKIAP |
| Number of Associated Samples | 159 |
| Number of Associated Scaffolds | 170 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 50.88 % |
| % of genes near scaffold ends (potentially truncated) | 47.95 % |
| % of genes from short scaffolds (< 2000 bps) | 94.74 % |
| Associated GOLD sequencing projects | 155 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.31 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (62.573 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (12.865 % of family members) |
| Environment Ontology (ENVO) | Unclassified (19.883 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.216 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.43% β-sheet: 0.00% Coil/Unstructured: 68.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 170 Family Scaffolds |
|---|---|---|
| PF00961 | LAGLIDADG_1 | 8.82 |
| PF13193 | AMP-binding_C | 0.59 |
| PF01966 | HD | 0.59 |
| PF00085 | Thioredoxin | 0.59 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 74.27 % |
| Unclassified | root | N/A | 25.73 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2067725004|GPKC_F5V46DG02C505I | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 2077657000|ZODLETONE_B1_GLDH0LQ01ARMAB | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 567 | Open in IMG/M |
| 2077657000|ZODLETONE_B1_GLDH0LQ01BNQ8A | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 2077657001|ZODLETONE_B3_GLDH0LQ03GGTJQ | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 567 | Open in IMG/M |
| 2077657001|ZODLETONE_B3_GLDH0LQ03GKXDG | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 2077657001|ZODLETONE_B3_GLDH0LQ03GM67E | Not Available | 553 | Open in IMG/M |
| 2077657002|ZODLETONE_B4_GLDH0LQ04H9ZK8 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces albidoflavus group → Streptomyces albidoflavus | 555 | Open in IMG/M |
| 2124908029|A2_v1_NODE_41304_len_1142_cov_10_591944 | Not Available | 1192 | Open in IMG/M |
| 2170459011|GKWS7RC01DGY68 | Not Available | 516 | Open in IMG/M |
| 2170459018|G1P06HT01AJXRB | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 5G12 | 623 | Open in IMG/M |
| 2170459024|GZRSKLJ01DR9PW | Not Available | 508 | Open in IMG/M |
| 3300001089|JGI12683J13190_1026289 | All Organisms → cellular organisms → Eukaryota | 509 | Open in IMG/M |
| 3300001182|JGI12668J13544_1000953 | All Organisms → cellular organisms → Bacteria | 1604 | Open in IMG/M |
| 3300001661|JGI12053J15887_10276593 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300002347|JGIcombinedJ26865_1069804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Erysipelotrichia → Erysipelotrichales → Erysipelotrichaceae → unclassified Erysipelotrichaceae → Erysipelotrichaceae bacterium 21_3 | 562 | Open in IMG/M |
| 3300003220|JGI26342J46808_1000702 | All Organisms → cellular organisms → Bacteria | 2495 | Open in IMG/M |
| 3300003220|JGI26342J46808_1014358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Erysipelotrichia → Erysipelotrichales → Erysipelotrichaceae → unclassified Erysipelotrichaceae → Erysipelotrichaceae bacterium 21_3 | 745 | Open in IMG/M |
| 3300004605|Ga0068952_1036241 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 5G12 | 507 | Open in IMG/M |
| 3300004614|Ga0068956_1064818 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300005180|Ga0066685_10690834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Erysipelotrichia → Erysipelotrichales → Erysipelotrichaceae → unclassified Erysipelotrichaceae → Erysipelotrichaceae bacterium 21_3 | 700 | Open in IMG/M |
| 3300005186|Ga0066676_10583439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Erysipelotrichia → Erysipelotrichales → Erysipelotrichaceae → unclassified Erysipelotrichaceae → Erysipelotrichaceae bacterium 21_3 | 757 | Open in IMG/M |
| 3300005336|Ga0070680_100681021 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300005366|Ga0070659_100966521 | Not Available | 746 | Open in IMG/M |
| 3300005454|Ga0066687_10922640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Erysipelotrichia → Erysipelotrichales → Erysipelotrichaceae → unclassified Erysipelotrichaceae → Erysipelotrichaceae bacterium 21_3 | 520 | Open in IMG/M |
| 3300005456|Ga0070678_101070205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Citrobacter → Citrobacter freundii complex → Citrobacter freundii | 744 | Open in IMG/M |
| 3300005468|Ga0070707_100800126 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division Kazan-3B-28 → candidate division Kazan bacterium | 907 | Open in IMG/M |
| 3300005541|Ga0070733_10571597 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 5G12 | 757 | Open in IMG/M |
| 3300005552|Ga0066701_10425278 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300005552|Ga0066701_10632804 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300005554|Ga0066661_10884234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 522 | Open in IMG/M |
| 3300005556|Ga0066707_10593351 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300005575|Ga0066702_10254090 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
| 3300005586|Ga0066691_10201704 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
| 3300005618|Ga0068864_100565514 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
| 3300005888|Ga0075289_1093279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Erysipelotrichia → Erysipelotrichales → Erysipelotrichaceae → unclassified Erysipelotrichaceae → Erysipelotrichaceae bacterium 21_3 | 506 | Open in IMG/M |
| 3300005921|Ga0070766_10446250 | All Organisms → cellular organisms → Eukaryota | 853 | Open in IMG/M |
| 3300005949|Ga0066791_10133840 | All Organisms → cellular organisms → Eukaryota | 509 | Open in IMG/M |
| 3300005985|Ga0081539_10222024 | Not Available | 859 | Open in IMG/M |
| 3300006028|Ga0070717_11394651 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300006028|Ga0070717_12098961 | All Organisms → cellular organisms → Eukaryota | 508 | Open in IMG/M |
| 3300006032|Ga0066696_10623475 | Not Available | 698 | Open in IMG/M |
| 3300006162|Ga0075030_100561243 | Not Available | 906 | Open in IMG/M |
| 3300006176|Ga0070765_100474796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1173 | Open in IMG/M |
| 3300006419|Ga0075496_1003395 | Not Available | 2307 | Open in IMG/M |
| 3300006797|Ga0066659_10137723 | All Organisms → cellular organisms → Bacteria | 1718 | Open in IMG/M |
| 3300006804|Ga0079221_10963705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Erysipelotrichia → Erysipelotrichales → Erysipelotrichaceae → unclassified Erysipelotrichaceae → Erysipelotrichaceae bacterium 21_3 | 635 | Open in IMG/M |
| 3300006914|Ga0075436_100116719 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Rhabditina → Rhabditomorpha → Rhabditoidea → Rhabditidae → Peloderinae → Caenorhabditis → Caenorhabditis tropicalis | 1865 | Open in IMG/M |
| 3300006934|Ga0080680_1051481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Erysipelotrichia → Erysipelotrichales → Erysipelotrichaceae → unclassified Erysipelotrichaceae → Erysipelotrichaceae bacterium 21_3 | 543 | Open in IMG/M |
| 3300006934|Ga0080680_1084370 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300006935|Ga0081246_1037509 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300006935|Ga0081246_1066769 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300008884|Ga0103746_10005041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1435 | Open in IMG/M |
| 3300009012|Ga0066710_102041406 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300009100|Ga0075418_11913957 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300009199|Ga0103748_10025690 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300009295|Ga0103747_10070471 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 5G12 | 868 | Open in IMG/M |
| 3300009683|Ga0116224_10042068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2237 | Open in IMG/M |
| 3300009804|Ga0105063_1020986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 779 | Open in IMG/M |
| 3300010038|Ga0126315_10159804 | All Organisms → cellular organisms → Eukaryota | 1338 | Open in IMG/M |
| 3300010038|Ga0126315_10959994 | Not Available | 571 | Open in IMG/M |
| 3300010051|Ga0133939_1058119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 8418 | Open in IMG/M |
| 3300010064|Ga0127433_105040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae | 554 | Open in IMG/M |
| 3300010077|Ga0127437_166451 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 5G12 | 612 | Open in IMG/M |
| 3300010082|Ga0127469_122679 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division Kazan-3B-28 → candidate division Kazan bacterium | 1028 | Open in IMG/M |
| 3300010087|Ga0127492_1008420 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 5G12 | 583 | Open in IMG/M |
| 3300010104|Ga0127446_1019573 | Not Available | 529 | Open in IMG/M |
| 3300010105|Ga0127470_1139454 | Not Available | 675 | Open in IMG/M |
| 3300010110|Ga0126316_1069405 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 5G12 | 613 | Open in IMG/M |
| 3300010162|Ga0131853_10458272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. C | 1180 | Open in IMG/M |
| 3300010325|Ga0134064_10211051 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300010335|Ga0134063_10413765 | All Organisms → cellular organisms → Eukaryota | 663 | Open in IMG/M |
| 3300010336|Ga0134071_10425552 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 679 | Open in IMG/M |
| 3300010341|Ga0074045_10810054 | Not Available | 592 | Open in IMG/M |
| 3300010366|Ga0126379_11222356 | Not Available | 858 | Open in IMG/M |
| 3300010375|Ga0105239_11307596 | Not Available | 836 | Open in IMG/M |
| 3300010864|Ga0126357_1213027 | Not Available | 620 | Open in IMG/M |
| 3300010869|Ga0126359_1153214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → marine Actinobacteria clade → environmental samples → uncultured actinobacterium HF0500_35G12 | 702 | Open in IMG/M |
| 3300010874|Ga0136264_10102313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → Veillonella | 867 | Open in IMG/M |
| 3300010878|Ga0136899_10041129 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
| 3300011003|Ga0138514_100020984 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division Kazan-3B-28 → candidate division Kazan bacterium | 1171 | Open in IMG/M |
| 3300011270|Ga0137391_10946334 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300012091|Ga0136625_1234171 | Not Available | 621 | Open in IMG/M |
| 3300012096|Ga0137389_10978649 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division Kazan-3B-28 → candidate division Kazan bacterium | 725 | Open in IMG/M |
| 3300012151|Ga0153938_1054647 | Not Available | 723 | Open in IMG/M |
| 3300012169|Ga0153990_1113371 | All Organisms → cellular organisms → Eukaryota | 605 | Open in IMG/M |
| 3300012176|Ga0153952_1079673 | Not Available | 720 | Open in IMG/M |
| 3300012198|Ga0137364_10572230 | Not Available | 851 | Open in IMG/M |
| 3300012285|Ga0137370_10787990 | Not Available | 590 | Open in IMG/M |
| 3300012359|Ga0137385_11278682 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300012381|Ga0134026_1121059 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 5G12 | 536 | Open in IMG/M |
| 3300012404|Ga0134024_1325065 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 5G12 | 585 | Open in IMG/M |
| 3300012532|Ga0137373_10945485 | Not Available | 628 | Open in IMG/M |
| 3300012918|Ga0137396_10232690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1358 | Open in IMG/M |
| 3300012961|Ga0164302_11679285 | All Organisms → cellular organisms → Eukaryota | 531 | Open in IMG/M |
| 3300012975|Ga0134110_10371538 | All Organisms → cellular organisms → Eukaryota | 630 | Open in IMG/M |
| 3300013041|Ga0154017_10581 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 5G12 | 502 | Open in IMG/M |
| 3300013766|Ga0120181_1015692 | Not Available | 2024 | Open in IMG/M |
| 3300013772|Ga0120158_10263810 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300014155|Ga0181524_10318272 | All Organisms → cellular organisms → Eukaryota | 703 | Open in IMG/M |
| 3300014495|Ga0182015_10263962 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
| 3300015356|Ga0134073_10322043 | Not Available | 559 | Open in IMG/M |
| 3300016357|Ga0182032_11773184 | Not Available | 539 | Open in IMG/M |
| 3300016371|Ga0182034_10775484 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300016728|Ga0181500_1424152 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 5G12 | 705 | Open in IMG/M |
| 3300017927|Ga0187824_10137632 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300017943|Ga0187819_10211164 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
| 3300017948|Ga0187847_10393527 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300017955|Ga0187817_10440714 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300017987|Ga0180431_10677760 | Not Available | 699 | Open in IMG/M |
| 3300017993|Ga0187823_10030196 | All Organisms → cellular organisms → Bacteria | 1409 | Open in IMG/M |
| 3300018006|Ga0187804_10147083 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300018009|Ga0187884_10294062 | All Organisms → cellular organisms → Eukaryota | 657 | Open in IMG/M |
| 3300018044|Ga0187890_10111521 | All Organisms → cellular organisms → Bacteria | 1585 | Open in IMG/M |
| 3300018061|Ga0184619_10421284 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300019255|Ga0184643_1495343 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 5G12 | 559 | Open in IMG/M |
| 3300019786|Ga0182025_1160008 | All Organisms → cellular organisms → Bacteria | 3118 | Open in IMG/M |
| 3300021474|Ga0210390_10319715 | All Organisms → cellular organisms → Bacteria | 1314 | Open in IMG/M |
| 3300022500|Ga0242643_119202 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 5G12 | 549 | Open in IMG/M |
| 3300022501|Ga0242645_1027237 | Not Available | 531 | Open in IMG/M |
| 3300022502|Ga0242646_1011038 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 5G12 | 758 | Open in IMG/M |
| 3300022502|Ga0242646_1028615 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300022513|Ga0242667_1019922 | Not Available | 696 | Open in IMG/M |
| 3300026298|Ga0209236_1219272 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300026309|Ga0209055_1093106 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
| 3300026324|Ga0209470_1370287 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300026376|Ga0257167_1060785 | Not Available | 587 | Open in IMG/M |
| 3300026547|Ga0209156_10368173 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300026552|Ga0209577_10178107 | All Organisms → cellular organisms → Bacteria | 1650 | Open in IMG/M |
| 3300027024|Ga0207819_1008335 | All Organisms → cellular organisms → Bacteria | 1569 | Open in IMG/M |
| 3300027521|Ga0209524_1006714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 2229 | Open in IMG/M |
| 3300027860|Ga0209611_10706597 | All Organisms → cellular organisms → Eukaryota | 546 | Open in IMG/M |
| 3300027895|Ga0209624_10029433 | All Organisms → cellular organisms → Bacteria | 3488 | Open in IMG/M |
| 3300028776|Ga0302303_10070441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → marine Actinobacteria clade → environmental samples → uncultured actinobacterium HF0500_35G12 | 1322 | Open in IMG/M |
| 3300028824|Ga0307310_10726643 | Not Available | 510 | Open in IMG/M |
| 3300028872|Ga0307314_10220210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 578 | Open in IMG/M |
| 3300028906|Ga0308309_10199611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Corynebacteriaceae → Corynebacterium → Corynebacterium rouxii | 1647 | Open in IMG/M |
| 3300029984|Ga0311332_10547821 | Not Available | 911 | Open in IMG/M |
| 3300029999|Ga0311339_11294221 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300030057|Ga0302176_10169859 | Not Available | 867 | Open in IMG/M |
| 3300030114|Ga0311333_11672863 | Not Available | 551 | Open in IMG/M |
| 3300030524|Ga0311357_11244796 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300030546|Ga0247646_1040421 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → dalbergioids sensu lato → Dalbergieae → Pterocarpus clade → Arachis → Arachis hypogaea | 912 | Open in IMG/M |
| 3300030610|Ga0247613_10292291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Corynebacteriaceae → Corynebacterium → Corynebacterium rouxii | 612 | Open in IMG/M |
| 3300030617|Ga0311356_10548850 | All Organisms → cellular organisms → Eukaryota | 1123 | Open in IMG/M |
| 3300030617|Ga0311356_11527276 | All Organisms → cellular organisms → Eukaryota | 603 | Open in IMG/M |
| 3300030623|Ga0265392_1227565 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 5G12 | 530 | Open in IMG/M |
| 3300030623|Ga0265392_1227565 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 5G12 | 530 | Open in IMG/M |
| 3300030761|Ga0265722_101987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 752 | Open in IMG/M |
| 3300030854|Ga0075385_10019806 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 5G12 | 572 | Open in IMG/M |
| 3300030876|Ga0265730_103947 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 5G12 | 524 | Open in IMG/M |
| 3300030972|Ga0075400_10056341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 528 | Open in IMG/M |
| 3300031049|Ga0074036_10076598 | Not Available | 551 | Open in IMG/M |
| 3300031089|Ga0102748_10087177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetota incertae sedis → Candidatus Hakubanella → Candidatus Hakubanella thermoalkaliphilus | 527 | Open in IMG/M |
| 3300031236|Ga0302324_100749634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus → unclassified Paenibacillus → Paenibacillus sp. P22 | 1368 | Open in IMG/M |
| 3300031366|Ga0307506_10511909 | Not Available | 510 | Open in IMG/M |
| 3300031469|Ga0170819_12042431 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 5G12 | 534 | Open in IMG/M |
| 3300031572|Ga0318515_10384784 | Not Available | 751 | Open in IMG/M |
| 3300031670|Ga0307374_10115630 | Not Available | 2241 | Open in IMG/M |
| 3300031672|Ga0307373_10557048 | All Organisms → cellular organisms → Eukaryota | 601 | Open in IMG/M |
| 3300031715|Ga0307476_10285943 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division Kazan-3B-28 → candidate division Kazan bacterium | 1208 | Open in IMG/M |
| 3300031726|Ga0302321_100779439 | Not Available | 1077 | Open in IMG/M |
| 3300031778|Ga0318498_10342385 | Not Available | 668 | Open in IMG/M |
| 3300031831|Ga0318564_10408762 | Not Available | 593 | Open in IMG/M |
| 3300031902|Ga0302322_102150831 | Not Available | 686 | Open in IMG/M |
| 3300031910|Ga0306923_10844588 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division Kazan-3B-28 → candidate division Kazan bacterium | 1008 | Open in IMG/M |
| 3300031946|Ga0310910_11005755 | All Organisms → cellular organisms → Eukaryota | 651 | Open in IMG/M |
| 3300032039|Ga0318559_10312879 | Not Available | 729 | Open in IMG/M |
| 3300032120|Ga0316053_106083 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Rhabditina → Rhabditomorpha → Rhabditoidea → Rhabditidae → Peloderinae → Caenorhabditis → Caenorhabditis tropicalis | 779 | Open in IMG/M |
| 3300032770|Ga0335085_11882159 | Not Available | 610 | Open in IMG/M |
| 3300032895|Ga0335074_10714206 | Not Available | 961 | Open in IMG/M |
| 3300034677|Ga0314802_001506 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 1680 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.36% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 7.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.09% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.09% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.09% |
| Sulfur Spring Sediment And Crust | Environmental → Aquatic → Thermal Springs → Warm (34-42C) → Sediment → Sulfur Spring Sediment And Crust | 3.51% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.34% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.34% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 2.34% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.92% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.92% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.75% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.75% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.75% |
| Wastewater Sludge | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wastewater Sludge | 1.75% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.17% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.17% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.17% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.17% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.17% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.17% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.17% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 1.17% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.17% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.58% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.58% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.58% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.58% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.58% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.58% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.58% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.58% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.58% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.58% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.58% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.58% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.58% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.58% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.58% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.58% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.58% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.58% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.58% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.58% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.58% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.58% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.58% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.58% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.58% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.58% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.58% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.58% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.58% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.58% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.58% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 0.58% |
| Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Fungus Gardens | 0.58% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.58% |
| Industrial Wastewater | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Industrial Wastewater | 0.58% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2067725004 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 2077657000 | Sulfur spring sediment and crust microbial communities from Zodletone, Oklahoma, USA - B1 | Environmental | Open in IMG/M |
| 2077657001 | Sulfur spring sediment and crust microbial communities from Zodletone, Oklahoma, USA - B3 | Environmental | Open in IMG/M |
| 2077657002 | Sulfur spring sediment and crust microbial communities from Zodletone, Oklahoma, USA - B4 | Environmental | Open in IMG/M |
| 2124908029 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active Layer A2 | Environmental | Open in IMG/M |
| 2170459011 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect Gram positive lysis 0-10cm | Environmental | Open in IMG/M |
| 2170459018 | Litter degradation MG2 | Engineered | Open in IMG/M |
| 2170459024 | Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
| 3300001089 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 | Environmental | Open in IMG/M |
| 3300001182 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002347 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-072012 (NGEE Surface samples 415 (1, 2, 3 deep-072012) AP id is 1030520, ASSEMBLY_DATE=20131219) | Environmental | Open in IMG/M |
| 3300003220 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 | Environmental | Open in IMG/M |
| 3300004605 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 40 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004614 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 48 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005888 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005949 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil leachate replicate DNA2013-051 | Environmental | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006419 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006934 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A1 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300006935 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome P72I A10 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300008884 | Microbial communities of wastewater sludge from Singapore - Sludge3_b2_February | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009199 | Microbial communities of wastewater sludge from Singapore - Sludge7_b2_February | Environmental | Open in IMG/M |
| 3300009295 | Microbial communities of wastewater sludge from Singapore - Sludge5_b2_February | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009804 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010051 | Industrial wastewater microbial communities from reactors of effluent treatment plant in South Killingholme, Immingham, England. Combined Assembly of Gp0151195, Gp0151196 | Engineered | Open in IMG/M |
| 3300010064 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010077 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010082 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010087 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010104 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010105 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010110 | Soil microbial communities from Illinois, USA to study soil gas exchange rates - BV-IL-AGR metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010162 | Labiotermes labralis P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010864 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010869 | Boreal forest soil eukaryotic communities from Alaska, USA - W4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010874 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 3A (Eukaryote Community Metatranscriptome) (version 3) | Environmental | Open in IMG/M |
| 3300010878 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 3A (Eukaryote Community Metatranscriptome) (version 7) | Environmental | Open in IMG/M |
| 3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012091 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ483 (23.06) | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012151 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ022 MetaG | Host-Associated | Open in IMG/M |
| 3300012169 | Attine ant fungus gardens microbial communities from North Carolina, USA - TSNC074 MetaG | Host-Associated | Open in IMG/M |
| 3300012176 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ036 MetaG | Host-Associated | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012381 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012404 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300013041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013766 | Permafrost microbial communities from Nunavut, Canada - A26_65cm_6M | Environmental | Open in IMG/M |
| 3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
| 3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016728 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017987 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_MS_1 metaG | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300019255 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300022500 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022501 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022502 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022513 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026376 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-B | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027024 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 42 (SPAdes) | Environmental | Open in IMG/M |
| 3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027860 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028776 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030546 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb11 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030610 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Ab2 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030623 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE043SO (Eukaryote Community Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300030761 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030854 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB2 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030876 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030972 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB4 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031049 | Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Mineral C2 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031089 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 2B (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031670 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-3 | Environmental | Open in IMG/M |
| 3300031672 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-2 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032120 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300034677 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPKC_04177590 | 2067725004 | Soil | MPPRKASREDTRARTKTDTGGQVENTKVIEITLVKE |
| ZODLETONE_00259400 | 2077657000 | Sulfur Spring Sediment And Crust | EVTDAMLPRKASRELNGARTQTNTGGQVENTEAIEITLVKELGKLTA |
| ZODLETONE_00234340 | 2077657000 | Sulfur Spring Sediment And Crust | EVTDAMLPRKVSREIVGARTQTNTGGQVENTKAIERIPVKELGKLAA |
| ZODLETONE_01044930 | 2077657001 | Sulfur Spring Sediment And Crust | ELGDPMLPRKASREVLAARTPNRSGGQVENTKAIER |
| ZODLETONE_00018060 | 2077657001 | Sulfur Spring Sediment And Crust | MPPRKASREVGRARTKTDTGGQVEKTKAIGRTLVKELGKMAP |
| ZODLETONE_00676730 | 2077657001 | Sulfur Spring Sediment And Crust | MLEEGDPMLPRKASREVLAARTLTDSGGQVENTKAIEIIVVKELG |
| ZODLETONE_00912930 | 2077657002 | Sulfur Spring Sediment And Crust | G*LGDPMLPRKASREVLAARTLTDSGGQVENTKAIERIVVKELGKI |
| A2_v1_00060320 | 2124908029 | Soil | MPPRKASREVARACTKTDTGGQVENTKVIEITLVKELGKIAP |
| F64_02456510 | 2170459011 | Grass Soil | VLCQLALSRRVPHAIPPRKASREEARARTKTDTGGQVENTKVIEITLVKELGKIAP |
| 2MG_00410230 | 2170459018 | Switchgrass, Maize And Mischanthus Litter | MPPRKASREVGRARTKTDTGGQVENTKAIGRTLEKELGKMAP |
| FD1_07454740 | 2170459024 | Grass Soil | VPDALPPRKASREEARARTKTDTGGQVEHTKVIEITLVKELGKIAP |
| JGI12683J13190_10262891 | 3300001089 | Forest Soil | PCQMXELHNLRCDASWRYSRRVPDAIPPRKSSREEARARTKTDTGGQVENTKVIEITLVKELGKIAP* |
| JGI12668J13544_10009534 | 3300001182 | Forest Soil | MPPRKASREKARACTKTDTGGQVEXTKVIEITLVKELGKIAP* |
| JGI12053J15887_102765932 | 3300001661 | Forest Soil | MPPRKTSREDARARTKTDTGGQVENTKVIEITLVKELGKIAP* |
| JGIcombinedJ26865_10698041 | 3300002347 | Arctic Peat Soil | VRCELALSRRLPDAIPPRKASREEARARTKTDTGGQVENTKVIEITLVKELGKIAP* |
| JGI26342J46808_10007024 | 3300003220 | Bog Forest Soil | MPPRKSSREEARARTKTDTGGQVENTKVIEITLVKELGKIAP* |
| JGI26342J46808_10143581 | 3300003220 | Bog Forest Soil | VRCQLALSRRVPDAIPPRKSSREEARARTKTDTGGQVENTKVIEITLVKELGKIAP* |
| Ga0068952_10362412 | 3300004605 | Peatlands Soil | VRCQLALSRRVPEAKPPRKASREKARARTKTDTGGQVENTKVIEITLVKELGKIA |
| Ga0068956_10648182 | 3300004614 | Peatlands Soil | MPPRKAPREDARARTKTDTGGQVENTKVIEITIVKELGKIAP* |
| Ga0066685_106908341 | 3300005180 | Soil | VRCQLAFSRRVPDARPPRKSSREEARARTKTDTGGQVENTKVIEITLVKELGKIAP* |
| Ga0066676_105834391 | 3300005186 | Soil | VRCQLAVSRRVPDARPPRKSSREDARARTKTDTGGQVENTKVIEITLVKELGKIAP* |
| Ga0070680_1006810212 | 3300005336 | Corn Rhizosphere | PDAIPPRKASREEARARTKTDTGGQVENTKVIEITIVKELGKIAP* |
| Ga0070659_1009665211 | 3300005366 | Corn Rhizosphere | MPPGKTSREDARARTKTDTGGQAENAKVIEITLVKELGKIAP* |
| Ga0066687_109226401 | 3300005454 | Soil | IPPRKSSREEARARTKTDTGGQVENTKVIEITLVKELGKIAP* |
| Ga0070678_1010702051 | 3300005456 | Miscanthus Rhizosphere | MLPRKSSRESARASTKTDTGGQVENTKVIEITIVKELGKIVP* |
| Ga0070707_1008001262 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MPPRKTSRKGVRARTKTDTGGQAENAKVIEITLVKELGKLAP* |
| Ga0070733_105715971 | 3300005541 | Surface Soil | MPPRKAPREDSRARTKTDTGGQVENTKVIEITIVKELGKMAP* |
| Ga0066701_104252782 | 3300005552 | Soil | MPSSARSEVPEAMPPRKASREVGRARTKTDTGGQVENTKAIGRTLEKELGKMAP* |
| Ga0066701_106328042 | 3300005552 | Soil | MPPRKASREEARACTKTDTGGQVEHTKVIEITLVKELGKIAP* |
| Ga0066661_108842341 | 3300005554 | Soil | SREEARARTKTDTGGQVENTKVIEITLVKELGKIAP* |
| Ga0066707_105933512 | 3300005556 | Soil | MPPRKTSRKGVRARTKTDTGGQAENAKAIEITLVKELGKLAP* |
| Ga0066702_102540902 | 3300005575 | Soil | MPPRKTSREEARARTKTDTGGQVENTKVIEITLVKELGKIAP* |
| Ga0066691_102017041 | 3300005586 | Soil | VRCQLALGRRVPEAMPPRKSSRQDTRARTKTDTGGQVENTKVIEITLVKELGKIAP* |
| Ga0068864_1005655143 | 3300005618 | Switchgrass Rhizosphere | MPPRKASRQWTRARTKTDTGGQVENTKVIEITLVKELGKIAP* |
| Ga0075289_10932791 | 3300005888 | Rice Paddy Soil | RKASRESARARTKTDTGGQVENTKVIEITLVKELGKIAP* |
| Ga0070766_104462501 | 3300005921 | Soil | PPRKSSREEARARTKTDTGGQVENTKVIEITLVKELGKIAP* |
| Ga0066791_101338402 | 3300005949 | Soil | CQLALSRRVPEAMPPRKSSREVTRACTKTDTGGQVENTKVIEITLVKELGKIAP* |
| Ga0081539_102220243 | 3300005985 | Tabebuia Heterophylla Rhizosphere | VPEPMPPRKTSREDVRARTKTDTGGQVENTEVIEITLVKELGKLAP* |
| Ga0070717_113946512 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | SSREDARARTKTDTGGQVENTKVIEITLVKELGKIAP* |
| Ga0070717_120989611 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VRCQLALSRRVPDAIPPRKASREEARARTKTDTGGQVENTKVIEITIVKELGKIAP* |
| Ga0066696_106234751 | 3300006032 | Soil | MPPRKASREGARARTKTDTGGQVENTKVIEITLVKELGKIAP* |
| Ga0075030_1005612432 | 3300006162 | Watersheds | MPPRKASREEARACTKTDTGGQVENTKVIEITLVKELGKIAP* |
| Ga0070765_1004747961 | 3300006176 | Soil | VSWRTSRRLPDAIPPRKASREEARARTKTDTGGQVENTKVIEITLVKELGKIAP* |
| Ga0075496_10033952 | 3300006419 | Aqueous | MNNKIRTKTNTSGLVEHTKVIKINFLKELGKLTP* |
| Ga0066659_101377232 | 3300006797 | Soil | VRCQLALGRRVPDAMPPRKSSRQDTRARTKTDTGGQVENTKVIEITLVKELGKIAP* |
| Ga0079221_109637051 | 3300006804 | Agricultural Soil | MPPRKASREGVRARTKTDTGGQAENAKVIEITIVKELGKIAP* |
| Ga0075436_1001167193 | 3300006914 | Populus Rhizosphere | VSDARRDASWAQARPVSEPMPPRKASREGVRARTKTDTGGQAENAKVIEITIVKELGKIAP* |
| Ga0080680_10514811 | 3300006934 | Tropical Rainforest Soil | VAVDARCDASWPNGRRVPNAIPPGKASRQESRARTKTDTGGQVENTKVIEITLVKELGKIAP* |
| Ga0080680_10843701 | 3300006934 | Tropical Rainforest Soil | MPPRKASREEARACTKTDTGGQVEYTKVIEITLVKELGKIAP* |
| Ga0081246_10375092 | 3300006935 | Tropical Rainforest Soil | MPPRKASRQGSRARTKTDTGAQVENTKVIEITIVKELGKIVP* |
| Ga0081246_10667691 | 3300006935 | Tropical Rainforest Soil | MPPRKASRETTRARTKTDTGGQVENTKVIEITLVKELGKIAP* |
| Ga0103746_100050411 | 3300008884 | Wastewater Sludge | MSSVERRGVVDSMPPRKASRERERTRTKTDTGGLVEHTEVIERTLVKELGKIVP* |
| Ga0066710_1020414061 | 3300009012 | Grasslands Soil | MPPRKTSREGVRARTKTDTGGQAENAKVIEITLVKELGKFAP |
| Ga0075418_119139572 | 3300009100 | Populus Rhizosphere | KTSREDVRARTKTDTGGQAENAKVIEITLVKELGKIAP* |
| Ga0103748_100256902 | 3300009199 | Wastewater Sludge | MPPRKASREEARARTKTDTGGQVENTKVIEITLVKELGKIAP* |
| Ga0103747_100704713 | 3300009295 | Wastewater Sludge | MRGCINLRCDASWLTSRRVPEAMPPRKSSKEGARARTKTDTGGQVENTKVIEIILVKELGKIAP* |
| Ga0116224_100420682 | 3300009683 | Peatlands Soil | MQLALSRRVPEALPPRKASREKARARTKTDTGGQVENTKVIEITLVKELGKIAP* |
| Ga0105063_10209861 | 3300009804 | Groundwater Sand | MPPRKASRESARARTKTDTGGQVENTEVIEITIVKELGKIAP* |
| Ga0126315_101598041 | 3300010038 | Serpentine Soil | RVPEAMPPRKSSRQDVRARTKTDTGGQVENTEVIEITLVKELGKLAP* |
| Ga0126315_109599942 | 3300010038 | Serpentine Soil | LGKDTRARTKTDTGGQVENTKVIEITLVKELGKFAP* |
| Ga0133939_10581191 | 3300010051 | Industrial Wastewater | MSRRVPDAKPPRKASREIPRARTKTDTGGQVENTKVIEITLVKELGKIAP* |
| Ga0127433_1050401 | 3300010064 | Grasslands Soil | ASREIPRARTKTDTGGQVENTKVIEITLVKELGKIAP* |
| Ga0127437_1664511 | 3300010077 | Grasslands Soil | RVSDAKPPRKASREIPRARTKTDTGGQVENTKVIEITLVKELGKIAP* |
| Ga0127469_1226791 | 3300010082 | Grasslands Soil | RKASREEARARTKTDTGGQVENTKVIEITLLKELGKIVP* |
| Ga0127492_10084201 | 3300010087 | Grasslands Soil | RKASREIPRARTKTDTGGQVENTKVIEITLVKELGKIAP* |
| Ga0127446_10195732 | 3300010104 | Grasslands Soil | MSRRVSDAKPPRKASRENSRARTKTDTGGQVENTKVIEITIVKELGKIVP* |
| Ga0127470_11394541 | 3300010105 | Grasslands Soil | MSEVPETMPPRKAPREVPRARTKTDTGGQVENTKVIEKTFVKELG |
| Ga0126316_10694051 | 3300010110 | Soil | VAARPRVPQAMPPRKASREVARARTKTDTGGQVENTRAIGRTLVKELG |
| Ga0131853_104582721 | 3300010162 | Termite Gut | MLPRKASREVARACTKTDTGGQVEYTKVIEITLVKELGKIAP* |
| Ga0134064_102110511 | 3300010325 | Grasslands Soil | REGARARTKTDTGGQVENTKVIEITIVKELGKIAP* |
| Ga0134063_104137652 | 3300010335 | Grasslands Soil | EVRCQLALSRRVPDAMPPRKSSREEARARTKTDTGGQVEHTKVIEITLVKELGKIAP* |
| Ga0134071_104255521 | 3300010336 | Grasslands Soil | MPPRKTSRKGVRARTKTDTGGQAENAKVIEITLVKELGKIAP* |
| Ga0074045_108100541 | 3300010341 | Bog Forest Soil | DAIPPRKSSREEARARTKTDTGGQVENTKVIEITLVKELGKIAP* |
| Ga0126379_112223561 | 3300010366 | Tropical Forest Soil | LAQSRRVPDAIPPRKSSREEVRARTKTDTGGQVENTEVIEITLVKELGKIAP* |
| Ga0105239_113075961 | 3300010375 | Corn Rhizosphere | SREDVRARTKTDTGGQAENAKVIEITLVKELGKIAP* |
| Ga0126357_12130272 | 3300010864 | Boreal Forest Soil | MPPRKASREEARARTKTDTGGQVENTKVIEITIVKELGKIAP* |
| Ga0126359_11532141 | 3300010869 | Boreal Forest Soil | MPPRKASRENSRACTKTDTGVQVENTKVIEITLVKELGKIV |
| Ga0136264_101023132 | 3300010874 | Soil | MPPRKASREVARARTKTDTGGQVENTKVIEITLVKELGKIAP* |
| Ga0136899_100411291 | 3300010878 | Soil | MPPRKSSREVARARTKTDTGGQVENTKVIEITLVKELGKIAP* |
| Ga0138514_1000209842 | 3300011003 | Soil | EPMPPRKTSREGVRARTKTDTGGQAENAKVIEITLVKELGKIAP* |
| Ga0137391_109463342 | 3300011270 | Vadose Zone Soil | RDGERVQREVALSMPPRKASREVGRARTKTDTGGQVENTKAIGRTLEKELGKMAP* |
| Ga0136625_12341712 | 3300012091 | Polar Desert Sand | PRKAPREEARARTKTDTGGQVENTKVIEITLVKELGKIAP* |
| Ga0137389_109786491 | 3300012096 | Vadose Zone Soil | REEARARTKTDTGGQVENTKVIEITLVKELGKIAP* |
| Ga0153938_10546472 | 3300012151 | Fungus Gardens | MPPRKASREKARARTKTDTGGQVENTKVIEITLVKELGKIAP* |
| Ga0153990_11133712 | 3300012169 | Attine Ant Fungus Gardens | SREEARARTKTDTGGQVEHTKVIEITLVKELGKIAP* |
| Ga0153952_10796731 | 3300012176 | Attine Ant Fungus Gardens | MQLALSRRVPEALPPRKASREEARARTKTDTGGQVENTKVIEITLVKELGKIAP* |
| Ga0137364_105722301 | 3300012198 | Vadose Zone Soil | RKSSREEARARTKTDTGGQVENTKVIEITLVKELGKIAP* |
| Ga0137370_107879901 | 3300012285 | Vadose Zone Soil | AMPPRKSSREEARARTKTDTGGQVENTKVIEITLVKELGKIAP* |
| Ga0137385_112786822 | 3300012359 | Vadose Zone Soil | RCQLAVSRRVPDAMPPRKASREEARACTKTDTGGQVENTKVIEITLVKELGKIAP* |
| Ga0134026_11210591 | 3300012381 | Grasslands Soil | RCQLALSRRVPDAMPPRKASRESARARTKTDTGGQVENTKVIEITIVKELGKIAP* |
| Ga0134024_13250651 | 3300012404 | Grasslands Soil | MPSAFEREVPEAMPPRKASREVGRARTKTDTGGQVENTKAIGRTLVKELGK |
| Ga0137373_109454851 | 3300012532 | Vadose Zone Soil | MPPRKASREGVRARTKTDTGGQAENAKVIEITLVKELGKIAP* |
| Ga0137396_102326901 | 3300012918 | Vadose Zone Soil | MPPRKASREGVRARTKTDTGGQVENTEVIEITLVKELGKFAP* |
| Ga0164302_116792851 | 3300012961 | Soil | DATLPRKSSREDARASTKTDTGGQVENTKVIEITIVKELGKIAP* |
| Ga0134110_103715381 | 3300012975 | Grasslands Soil | PRKSSREEARARTKTDTGGQVENTKVIEITLVKELGKIAP* |
| Ga0154017_105811 | 3300013041 | Corn, Switchgrass And Miscanthus Rhizosphere | MSVGVSRQVVEPMPPRKASREWERARTKTDTGGQVEHTEVIEITLVKELGKIVP* |
| Ga0120181_10156921 | 3300013766 | Permafrost | MPRRASAEVPEALPPRKASREVGRARTKTDTGRQVENTKAIGRTLVKE |
| Ga0120158_102638101 | 3300013772 | Permafrost | MPPRKASREVERARTKTDTGGQVENTKAIGRTLVKE |
| Ga0181524_103182721 | 3300014155 | Bog | RCELALSRRLPNAIPPRKSSREEARARTKTDTGGQVENTKVIEITLVKELGKIAP* |
| Ga0182015_102639622 | 3300014495 | Palsa | SRRVPDAIPPRKSSREEARARTKTDTGGQVENTKVIEITLVKELGKIAP* |
| Ga0134073_103220431 | 3300015356 | Grasslands Soil | RVPDAVPPRKASREEARARTKTDTGGQVEHTKVIEITLVKELGKIAP* |
| Ga0182032_117731842 | 3300016357 | Soil | SREVGRARTKTDTGGQVENTKAIGRTLEKELGKMAP |
| Ga0182034_107754842 | 3300016371 | Soil | MPPRKASREEARARTKTDTGGQVENTKVIEITLVKELGKIAP |
| Ga0181500_14241522 | 3300016728 | Peatland | MPPRKASRENSRACTKTDTGVQVENTKVIEITLVKELGKIVP |
| Ga0187824_101376322 | 3300017927 | Freshwater Sediment | MRGCIQPEVRCQLALSRRVPDAMPPRKSSREVARARTKTDTGGQVENTKVIEITLVKELGKIAP |
| Ga0187819_102111641 | 3300017943 | Freshwater Sediment | PPRKSSREEARARTKTDTGGQVENTKVIEITLVKELGKIAP |
| Ga0187847_103935272 | 3300017948 | Peatland | EAMPPRKASREVGRARTKTDTGGQVENTKAIGRTLEKELGKMAP |
| Ga0187817_104407142 | 3300017955 | Freshwater Sediment | CQLALSRRVPEAMPPRKAPRKDARARTETDTGGQVENTKVIEITIVKELGKIAP |
| Ga0180431_106777601 | 3300017987 | Hypersaline Lake Sediment | MSAGFGRQVAHSMPPRKSSRELERARTKTDTGGQVEHTEEIERTLVKELGKMAP |
| Ga0187823_100301962 | 3300017993 | Freshwater Sediment | MQLALSRRVPEALPPRKASREKARARTKTDTGGQVENTKVIEITLVKELGKIAP |
| Ga0187804_101470832 | 3300018006 | Freshwater Sediment | AMPPRKAPREDSRARTKTDTGGQVENTKVIEITIVKELGKMAP |
| Ga0187884_102940621 | 3300018009 | Peatland | PEARCQLAVSRRVPDAMPPRKAPREDMRARTKTDTGGQVENTKVIEITIVKELGKIAP |
| Ga0187890_101115212 | 3300018044 | Peatland | MPPRKASREEARACTKTDTGGQVEYTKVIEITLVKELGKIAP |
| Ga0184619_104212842 | 3300018061 | Groundwater Sediment | APREDARARTKTDTGGQVENTKVIEITLVKELGKIAP |
| Ga0184643_14953431 | 3300019255 | Groundwater Sediment | MPPRKSSREDVRARTKTDTGGQAENAKVIEITIVKELGKFAP |
| Ga0182025_11600084 | 3300019786 | Permafrost | MPPRKAPREDSRARTKTDTGGQVENTKVIEITIVKELGKMAP |
| Ga0210390_103197151 | 3300021474 | Soil | LALSRRVPDAIPPRKSSREEARARTKTDTGGQVENTKVIEITIVKELGKIAP |
| Ga0242643_1192021 | 3300022500 | Soil | EVRCQLAYSRRVPNAMPPRKSSREEARARTKTDTRGQVENTKVIEITLVKELVKIAP |
| Ga0242645_10272371 | 3300022501 | Soil | QLAISRRVPYAEPSRKASREIPRARTKTDTGGQVENTKVIEITLVKELGKIAP |
| Ga0242646_10110381 | 3300022502 | Soil | LTEVRCQLALSRRVPDAIPPRKSSREEARARTKTDTGGQVENTKVIEITLVKEL |
| Ga0242646_10286151 | 3300022502 | Soil | RKAPREDSRARTKTDTGGQVENTKVIEITIVKELGVNAILARK |
| Ga0242667_10199221 | 3300022513 | Soil | MQLALSRRVPEALPPRKASREKARARTKTDTGGQVENTKVIEITLVKELGKIAS |
| Ga0209236_12192722 | 3300026298 | Grasslands Soil | KSSRQDTRARTKTDTGGQVENTKVIEITLVKELGKIAP |
| Ga0209055_10931062 | 3300026309 | Soil | CQLALGRRVPDAMPPRKSSRQDTRARTKTDTGGQVENTKVIEITLVKELGKIAP |
| Ga0209470_13702871 | 3300026324 | Soil | PEALPPRKASREEARARTKTDTGGQVENTKVIEITLVKELGKIAP |
| Ga0257167_10607851 | 3300026376 | Soil | RPPRKSSREEARARTKTDTGGQVENTKVIEITLVKELGKIAP |
| Ga0209156_103681731 | 3300026547 | Soil | MPPRKASRKEARACTKTDTGGQVEHTKVIEITLVKELGKIAP |
| Ga0209577_101781072 | 3300026552 | Soil | MPPRKSSREEARARTKTDTGGQVENTKVIEITLVKELGKIAP |
| Ga0207819_10083352 | 3300027024 | Tropical Forest Soil | MPPRKASREEARACTKTDTGGQVEHTKVIEITLVKELGKIAP |
| Ga0209524_10067141 | 3300027521 | Forest Soil | MPPRKASREEARACTKTDTGGQVENTKVIEITLVKELGKIAP |
| Ga0209611_107065971 | 3300027860 | Host-Associated | PRKASRENTRACTKTDTGGQVENTKVIEITLVKELGKIAP |
| Ga0209624_100294332 | 3300027895 | Forest Soil | MQLALSRRVPEAIPPRKASREEARARTKTDTGGQVENTKVIEITLVKELGKIAP |
| Ga0302303_100704411 | 3300028776 | Palsa | MPPRKASREEARACTKTDTGGQVEYTKVIEITLVKELGKIDP |
| Ga0307310_107266431 | 3300028824 | Soil | ASREVGRARTKTDTGGQVENTKVIGRTLEKELGKMAP |
| Ga0307314_102202101 | 3300028872 | Soil | MPPRKSSRQDVRARTKTDTGGQVENTEVIEITLVKELGKFAP |
| Ga0308309_101996111 | 3300028906 | Soil | MQLALSRRVPEALPPRKASREEARARTKTDTGGQVENTKVIEITLVKELGKIAP |
| Ga0311332_105478211 | 3300029984 | Fen | MLPRKSSRESARASTKTDTGGQVENTEVIEITIVKELGKIVP |
| Ga0311339_112942211 | 3300029999 | Palsa | VPEAMPPRKAPREETRARTKTDTGGQVENTKVIEITIVKELGKIAP |
| Ga0302176_101698591 | 3300030057 | Palsa | AMPSRKSSREVARACTKTDTGGQVEYTKVIEITLVKELGKIDP |
| Ga0311333_116728631 | 3300030114 | Fen | NPALLNPRCDASWLYCRRVSDATLPRKSSREDARASTKTDTGGQVENTKVIEITIVKELGKIVP |
| Ga0311357_112447961 | 3300030524 | Palsa | RKSSREEARARTKTDTGGQVENTKVIEITLVKELGKIDP |
| Ga0247646_10404211 | 3300030546 | Soil | MGEVPESMPPRKASREVGRARTKTDTGGQVENTKAIGGTVVKELGKMQKDKYE |
| Ga0247613_102922911 | 3300030610 | Soil | MPPRKASREVERARTKTDTGRQVENTKEIGRTLVKELGKGK |
| Ga0311356_105488502 | 3300030617 | Palsa | MPSRKSSREVARACTKTDTGGQVEYTKVIEITLVKELGKIAP |
| Ga0311356_115272761 | 3300030617 | Palsa | VRCELASSRRLPDAMPPRKSSREEARARTKTDTGGQVENTKVIEITLVKELGKIAP |
| Ga0265392_12275651 | 3300030623 | Soil | SREEARARTKTDTGGQVENTKVIEITLVKELGKIDP |
| Ga0265392_12275652 | 3300030623 | Soil | MPPRKASREEARARTKTDTGGQVENTKVIEITLVKELGKIAKKKKQKIKEKV |
| Ga0265722_1019872 | 3300030761 | Soil | MPSRKASREEARACTKTDTGGQVEYTKVIEITLVKDLGKIAP |
| Ga0075385_100198061 | 3300030854 | Soil | EVGRARTKTDTGRQVENTKAIGRTLEKELGKMARI |
| Ga0265730_1039472 | 3300030876 | Soil | MPPRKASREVARACTKTDTGGQVENTKVIEITIVKELGKIAP |
| Ga0075400_100563412 | 3300030972 | Soil | SREEARARTKTDTGGQVENTKVIEITLVKELGKIAP |
| Ga0074036_100765982 | 3300031049 | Soil | PRKSSREEARARTKTDTGGQVENTKVIEITLVKELGKIAP |
| Ga0102748_100871771 | 3300031089 | Soil | MPPRKASREVARACTKTDTGGQVEHTKVIEITLVKELGKIAP |
| Ga0302324_1007496342 | 3300031236 | Palsa | MPPRKASREVTRACTKTDTGGQVEYTKVIEITLVKELGKIAP |
| Ga0307506_105119091 | 3300031366 | Soil | CDASWLMSRRVPDAIPPRKASREEARARTKTDTGGQVENTKVIEITIVKELGKIAP |
| Ga0170819_120424311 | 3300031469 | Forest Soil | MPPRKASRQDSRARTKTDTGGQVENTKVIEITLVKELGKIAKAKGQEIRED |
| Ga0318515_103847841 | 3300031572 | Soil | MQLALSRRVPDALPPRKASREEARARTKTDTGGQVEHTKVIEITLVKELGKIAP |
| Ga0307374_101156302 | 3300031670 | Soil | MPPRKAPRENARACTKTDTGGQVENTKVIEITLVKELGKIAP |
| Ga0307373_105570481 | 3300031672 | Soil | RENARACTKTDTGGQVENTKVIEITLVKELGKIAP |
| Ga0307476_102859432 | 3300031715 | Hardwood Forest Soil | MPPRKASREKARARTKTDTGGQVENTKVIEITLVKELGKIAP |
| Ga0302321_1007794391 | 3300031726 | Fen | MLPRKSSREGVRASTKTDTGGQVENTEVIEITIVKELGKIVP |
| Ga0318498_103423852 | 3300031778 | Soil | MQLALSRRVPEALPPRKASREKARARTKTDTGGQVEHTKVIEITLVKELGKIAP |
| Ga0318564_104087622 | 3300031831 | Soil | LALSRRVPEALPPRKASREKARARTKTDTGGQVENTKVIEITLVKELGKIAP |
| Ga0302322_1021508311 | 3300031902 | Fen | MLPRKSSREGVRASTKTDTGGQVENTKVIEITIVKELGKIVP |
| Ga0306923_108445881 | 3300031910 | Soil | RKASREEARARTKTDTGGQVENTKVIEITLVKELGKIAP |
| Ga0310910_110057552 | 3300031946 | Soil | RKASREKARARTKTDTGGQVEHTKVIEITLVKELGKIAP |
| Ga0318559_103128791 | 3300032039 | Soil | MQLALSRRVPEALPPRKASREVARACTKTDTGGQVEHTKVIEITLVKELGKIAP |
| Ga0316053_1060831 | 3300032120 | Soil | MPPRKASRENARACTKTDTGGQVEYTKVIEITLVKELGKI |
| Ga0335085_118821591 | 3300032770 | Soil | PPRKSSREDARARTKTDTGGQVENTKVIEITLVKELGKIAP |
| Ga0335074_107142061 | 3300032895 | Soil | MPPRKASREEARACTKTDTGGQVENTKVIEITLVKELGKIDP |
| Ga0314802_001506_2_115 | 3300034677 | Soil | MPPGKTSREDVRARTKTDTGGQAENAKVIEITLVKELG |
| ⦗Top⦘ |