Basic Information | |
---|---|
Family ID | F035651 |
Family Type | Metagenome |
Number of Sequences | 171 |
Average Sequence Length | 46 residues |
Representative Sequence | MGHYDGDPWSNHVLNEVKCAECEEYFDDQEGEGNICPACIEKEGESK |
Number of Associated Samples | 93 |
Number of Associated Scaffolds | 170 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 80.70 % |
% of genes near scaffold ends (potentially truncated) | 24.56 % |
% of genes from short scaffolds (< 2000 bps) | 66.08 % |
Associated GOLD sequencing projects | 81 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.49 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (49.123 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (24.561 % of family members) |
Environment Ontology (ENVO) | Unclassified (63.743 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (69.006 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 10.67% β-sheet: 8.00% Coil/Unstructured: 81.33% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 170 Family Scaffolds |
---|---|---|
PF00145 | DNA_methylase | 4.71 |
PF13578 | Methyltransf_24 | 2.94 |
PF07275 | ArdA | 2.35 |
PF02767 | DNA_pol3_beta_2 | 2.35 |
PF04545 | Sigma70_r4 | 1.18 |
PF00565 | SNase | 1.18 |
PF03796 | DnaB_C | 0.59 |
PF01930 | Cas_Cas4 | 0.59 |
PF03237 | Terminase_6N | 0.59 |
PF13252 | DUF4043 | 0.59 |
PF05869 | Dam | 0.59 |
COG ID | Name | Functional Category | % Frequency in 170 Family Scaffolds |
---|---|---|---|
COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 4.71 |
COG0592 | DNA polymerase III sliding clamp (beta) subunit, PCNA homolog | Replication, recombination and repair [L] | 2.35 |
COG4734 | Antirestriction protein ArdA | Defense mechanisms [V] | 2.35 |
COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 0.59 |
COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 0.59 |
COG1468 | CRISPR/Cas system-associated exonuclease Cas4, RecB family | Defense mechanisms [V] | 0.59 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 50.88 % |
Unclassified | root | N/A | 49.12 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002835|B570J40625_100144211 | All Organisms → Viruses → Predicted Viral | 2741 | Open in IMG/M |
3300002930|Water_104498 | All Organisms → cellular organisms → Bacteria | 2170 | Open in IMG/M |
3300004448|Ga0065861_1014353 | Not Available | 3883 | Open in IMG/M |
3300004448|Ga0065861_1030424 | All Organisms → Viruses → Predicted Viral | 2434 | Open in IMG/M |
3300004448|Ga0065861_1030427 | Not Available | 795 | Open in IMG/M |
3300004460|Ga0066222_1015770 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2407 | Open in IMG/M |
3300004460|Ga0066222_1015798 | Not Available | 3431 | Open in IMG/M |
3300004460|Ga0066222_1015800 | Not Available | 789 | Open in IMG/M |
3300004460|Ga0066222_1015801 | All Organisms → Viruses → Predicted Viral | 3031 | Open in IMG/M |
3300004460|Ga0066222_1020599 | Not Available | 4107 | Open in IMG/M |
3300004461|Ga0066223_1040482 | Not Available | 996 | Open in IMG/M |
3300004461|Ga0066223_1070550 | Not Available | 3435 | Open in IMG/M |
3300005517|Ga0070374_10399518 | Not Available | 691 | Open in IMG/M |
3300005582|Ga0049080_10194571 | Not Available | 671 | Open in IMG/M |
3300005662|Ga0078894_10249165 | All Organisms → Viruses → Predicted Viral | 1610 | Open in IMG/M |
3300005832|Ga0074469_10845387 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
3300006863|Ga0075459_1009912 | All Organisms → Viruses → Predicted Viral | 1556 | Open in IMG/M |
3300006875|Ga0075473_10402064 | Not Available | 553 | Open in IMG/M |
3300006920|Ga0070748_1257225 | Not Available | 627 | Open in IMG/M |
3300008107|Ga0114340_1115379 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 1049 | Open in IMG/M |
3300008114|Ga0114347_1017196 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 4269 | Open in IMG/M |
3300008114|Ga0114347_1057184 | All Organisms → Viruses → Predicted Viral | 1637 | Open in IMG/M |
3300008114|Ga0114347_1106517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium | 1074 | Open in IMG/M |
3300008114|Ga0114347_1121535 | Not Available | 977 | Open in IMG/M |
3300008266|Ga0114363_1043775 | All Organisms → Viruses → Predicted Viral | 1816 | Open in IMG/M |
3300008266|Ga0114363_1187220 | Not Available | 650 | Open in IMG/M |
3300008267|Ga0114364_1030985 | Not Available | 2095 | Open in IMG/M |
3300008267|Ga0114364_1132042 | Not Available | 722 | Open in IMG/M |
3300008448|Ga0114876_1023493 | All Organisms → Viruses → Predicted Viral | 3143 | Open in IMG/M |
3300009068|Ga0114973_10047073 | Not Available | 2555 | Open in IMG/M |
3300009068|Ga0114973_10156755 | All Organisms → Viruses → Predicted Viral | 1263 | Open in IMG/M |
3300009081|Ga0105098_10052289 | All Organisms → Viruses → Predicted Viral | 1667 | Open in IMG/M |
3300009151|Ga0114962_10016820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 5237 | Open in IMG/M |
3300009151|Ga0114962_10027591 | Not Available | 3931 | Open in IMG/M |
3300009151|Ga0114962_10072890 | All Organisms → cellular organisms → Bacteria | 2196 | Open in IMG/M |
3300009151|Ga0114962_10089230 | All Organisms → cellular organisms → Bacteria | 1939 | Open in IMG/M |
3300009155|Ga0114968_10016644 | All Organisms → cellular organisms → Bacteria | 5138 | Open in IMG/M |
3300009155|Ga0114968_10137721 | All Organisms → Viruses → Predicted Viral | 1459 | Open in IMG/M |
3300009155|Ga0114968_10295832 | Not Available | 906 | Open in IMG/M |
3300009159|Ga0114978_10027859 | Not Available | 4067 | Open in IMG/M |
3300009159|Ga0114978_10031777 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3764 | Open in IMG/M |
3300009159|Ga0114978_10210840 | All Organisms → Viruses → Predicted Viral | 1223 | Open in IMG/M |
3300009163|Ga0114970_10546371 | Not Available | 628 | Open in IMG/M |
3300009165|Ga0105102_10201606 | Not Available | 994 | Open in IMG/M |
3300009165|Ga0105102_10640123 | Not Available | 591 | Open in IMG/M |
3300009182|Ga0114959_10129063 | Not Available | 1361 | Open in IMG/M |
3300009183|Ga0114974_10329979 | Not Available | 889 | Open in IMG/M |
3300009183|Ga0114974_10493053 | Not Available | 688 | Open in IMG/M |
3300009184|Ga0114976_10022255 | All Organisms → Viruses → Predicted Viral | 3860 | Open in IMG/M |
3300009185|Ga0114971_10802568 | Not Available | 510 | Open in IMG/M |
3300009450|Ga0127391_1004035 | Not Available | 3285 | Open in IMG/M |
3300009684|Ga0114958_10144350 | Not Available | 1207 | Open in IMG/M |
3300010157|Ga0114964_10226795 | Not Available | 893 | Open in IMG/M |
3300010334|Ga0136644_10431317 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
3300010885|Ga0133913_10203340 | Not Available | 5279 | Open in IMG/M |
3300010885|Ga0133913_10761522 | Not Available | 2527 | Open in IMG/M |
3300010885|Ga0133913_11726430 | Not Available | 1572 | Open in IMG/M |
3300010885|Ga0133913_13534649 | Not Available | 1018 | Open in IMG/M |
3300011334|Ga0153697_1235 | Not Available | 18847 | Open in IMG/M |
3300011738|Ga0120086_109082 | Not Available | 558 | Open in IMG/M |
3300011918|Ga0120090_102212 | Not Available | 3026 | Open in IMG/M |
3300011918|Ga0120090_103825 | Not Available | 2147 | Open in IMG/M |
3300011921|Ga0120089_108627 | Not Available | 892 | Open in IMG/M |
3300012665|Ga0157210_1002346 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4972 | Open in IMG/M |
3300012665|Ga0157210_1061151 | Not Available | 570 | Open in IMG/M |
3300012665|Ga0157210_1063348 | Not Available | 559 | Open in IMG/M |
3300013004|Ga0164293_10028115 | All Organisms → Viruses → Predicted Viral | 4671 | Open in IMG/M |
3300013004|Ga0164293_10522685 | Not Available | 780 | Open in IMG/M |
3300013005|Ga0164292_10077041 | All Organisms → Viruses → Predicted Viral | 2557 | Open in IMG/M |
3300013286|Ga0136641_1192328 | Not Available | 541 | Open in IMG/M |
3300017701|Ga0181364_1036272 | Not Available | 792 | Open in IMG/M |
3300017722|Ga0181347_1090587 | Not Available | 881 | Open in IMG/M |
3300017722|Ga0181347_1096998 | Not Available | 844 | Open in IMG/M |
3300017722|Ga0181347_1112053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 770 | Open in IMG/M |
3300017736|Ga0181365_1050703 | Not Available | 1037 | Open in IMG/M |
3300017736|Ga0181365_1050703 | Not Available | 1037 | Open in IMG/M |
3300017754|Ga0181344_1011709 | All Organisms → Viruses → Predicted Viral | 2802 | Open in IMG/M |
3300017761|Ga0181356_1125446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae | 815 | Open in IMG/M |
3300017774|Ga0181358_1079367 | All Organisms → Viruses → Predicted Viral | 1201 | Open in IMG/M |
3300017774|Ga0181358_1111402 | Not Available | 971 | Open in IMG/M |
3300017774|Ga0181358_1207034 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 639 | Open in IMG/M |
3300017777|Ga0181357_1069488 | All Organisms → Viruses → Predicted Viral | 1356 | Open in IMG/M |
3300017777|Ga0181357_1076741 | All Organisms → Viruses → Predicted Viral | 1281 | Open in IMG/M |
3300017777|Ga0181357_1183162 | Not Available | 756 | Open in IMG/M |
3300017778|Ga0181349_1109097 | All Organisms → Viruses → Predicted Viral | 1029 | Open in IMG/M |
3300017778|Ga0181349_1127762 | Not Available | 931 | Open in IMG/M |
3300017778|Ga0181349_1141420 | Not Available | 872 | Open in IMG/M |
3300017784|Ga0181348_1069841 | All Organisms → Viruses → Predicted Viral | 1408 | Open in IMG/M |
3300017784|Ga0181348_1139683 | Not Available | 916 | Open in IMG/M |
3300017784|Ga0181348_1183037 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 763 | Open in IMG/M |
3300017784|Ga0181348_1243568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae | 625 | Open in IMG/M |
3300017785|Ga0181355_1209890 | Not Available | 762 | Open in IMG/M |
3300017785|Ga0181355_1225400 | Not Available | 727 | Open in IMG/M |
3300017785|Ga0181355_1303639 | Not Available | 598 | Open in IMG/M |
3300019784|Ga0181359_1020063 | Not Available | 2524 | Open in IMG/M |
3300019784|Ga0181359_1028530 | All Organisms → Viruses → Predicted Viral | 2148 | Open in IMG/M |
3300019784|Ga0181359_1047819 | Not Available | 1652 | Open in IMG/M |
3300019784|Ga0181359_1125512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 912 | Open in IMG/M |
3300019784|Ga0181359_1170818 | Not Available | 727 | Open in IMG/M |
3300019784|Ga0181359_1246534 | Not Available | 545 | Open in IMG/M |
3300020048|Ga0207193_1146052 | All Organisms → Viruses → Predicted Viral | 1999 | Open in IMG/M |
3300020048|Ga0207193_1857487 | Not Available | 529 | Open in IMG/M |
3300020161|Ga0211726_10206505 | Not Available | 723 | Open in IMG/M |
3300020205|Ga0211731_10996265 | Not Available | 1053 | Open in IMG/M |
3300020205|Ga0211731_11525463 | Not Available | 581 | Open in IMG/M |
3300020498|Ga0208050_1003500 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium | 2007 | Open in IMG/M |
3300021438|Ga0213920_1004537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5388 | Open in IMG/M |
3300021438|Ga0213920_1023635 | All Organisms → Viruses → Predicted Viral | 1482 | Open in IMG/M |
3300021956|Ga0213922_1015918 | All Organisms → Viruses → Predicted Viral | 1982 | Open in IMG/M |
3300021962|Ga0222713_10105822 | All Organisms → Viruses → Predicted Viral | 2008 | Open in IMG/M |
3300021963|Ga0222712_10769169 | Not Available | 534 | Open in IMG/M |
3300022200|Ga0196901_1072926 | All Organisms → Viruses → Predicted Viral | 1238 | Open in IMG/M |
3300022752|Ga0214917_10005998 | Not Available | 12775 | Open in IMG/M |
3300022752|Ga0214917_10014019 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7086 | Open in IMG/M |
3300022752|Ga0214917_10111867 | All Organisms → Viruses → Predicted Viral | 1553 | Open in IMG/M |
3300022752|Ga0214917_10194523 | All Organisms → Viruses → Predicted Viral | 1008 | Open in IMG/M |
3300023174|Ga0214921_10013012 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 9840 | Open in IMG/M |
3300023174|Ga0214921_10023505 | Not Available | 6410 | Open in IMG/M |
3300023174|Ga0214921_10055774 | Not Available | 3407 | Open in IMG/M |
3300023174|Ga0214921_10059837 | All Organisms → Viruses → Predicted Viral | 3235 | Open in IMG/M |
3300023174|Ga0214921_10373977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae | 744 | Open in IMG/M |
3300023179|Ga0214923_10151117 | All Organisms → Viruses → Predicted Viral | 1452 | Open in IMG/M |
3300025445|Ga0208424_1024804 | Not Available | 710 | Open in IMG/M |
3300027708|Ga0209188_1010169 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5385 | Open in IMG/M |
3300027708|Ga0209188_1060339 | Not Available | 1644 | Open in IMG/M |
3300027712|Ga0209499_1035386 | Not Available | 2159 | Open in IMG/M |
3300027712|Ga0209499_1108461 | All Organisms → Viruses → Predicted Viral | 1046 | Open in IMG/M |
3300027734|Ga0209087_1072799 | All Organisms → Viruses → Predicted Viral | 1509 | Open in IMG/M |
3300027749|Ga0209084_1009451 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6007 | Open in IMG/M |
3300027749|Ga0209084_1080792 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1472 | Open in IMG/M |
3300027754|Ga0209596_1128630 | Not Available | 1154 | Open in IMG/M |
3300027777|Ga0209829_10001244 | All Organisms → cellular organisms → Bacteria | 21219 | Open in IMG/M |
3300027782|Ga0209500_10072666 | All Organisms → Viruses → Predicted Viral | 1766 | Open in IMG/M |
3300027798|Ga0209353_10367935 | Not Available | 597 | Open in IMG/M |
3300027805|Ga0209229_10062156 | All Organisms → Viruses → Predicted Viral | 1671 | Open in IMG/M |
3300027917|Ga0209536_101911020 | Not Available | 713 | Open in IMG/M |
3300027956|Ga0209820_1093556 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
3300027963|Ga0209400_1005222 | All Organisms → cellular organisms → Bacteria | 8969 | Open in IMG/M |
3300027963|Ga0209400_1008088 | All Organisms → cellular organisms → Bacteria | 6920 | Open in IMG/M |
3300027963|Ga0209400_1099766 | Not Available | 1355 | Open in IMG/M |
3300027971|Ga0209401_1009930 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5330 | Open in IMG/M |
3300027971|Ga0209401_1064237 | All Organisms → Viruses → Predicted Viral | 1613 | Open in IMG/M |
3300028025|Ga0247723_1020438 | All Organisms → Viruses → Predicted Viral | 2241 | Open in IMG/M |
3300028025|Ga0247723_1021835 | All Organisms → Viruses → Predicted Viral | 2141 | Open in IMG/M |
3300028025|Ga0247723_1023273 | All Organisms → Viruses → Predicted Viral | 2052 | Open in IMG/M |
3300028025|Ga0247723_1122336 | Not Available | 634 | Open in IMG/M |
3300028025|Ga0247723_1132212 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 600 | Open in IMG/M |
3300028392|Ga0304729_1022227 | Not Available | 2686 | Open in IMG/M |
3300028393|Ga0304728_1087410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium | 1214 | Open in IMG/M |
3300031758|Ga0315907_10000950 | Not Available | 39694 | Open in IMG/M |
3300031758|Ga0315907_10198054 | All Organisms → Viruses → Predicted Viral | 1684 | Open in IMG/M |
3300031758|Ga0315907_10404025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium | 1100 | Open in IMG/M |
3300031758|Ga0315907_10467977 | Not Available | 1003 | Open in IMG/M |
3300031758|Ga0315907_10499908 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 962 | Open in IMG/M |
3300031857|Ga0315909_10235484 | All Organisms → Viruses → Predicted Viral | 1418 | Open in IMG/M |
3300031963|Ga0315901_10228952 | All Organisms → Viruses → Predicted Viral | 1587 | Open in IMG/M |
3300031999|Ga0315274_11551214 | Not Available | 626 | Open in IMG/M |
3300032050|Ga0315906_10001071 | Not Available | 41522 | Open in IMG/M |
3300032050|Ga0315906_10884758 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 688 | Open in IMG/M |
3300033993|Ga0334994_0121023 | All Organisms → Viruses → Predicted Viral | 1510 | Open in IMG/M |
3300033996|Ga0334979_0356155 | Not Available | 818 | Open in IMG/M |
3300034012|Ga0334986_0009067 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7249 | Open in IMG/M |
3300034012|Ga0334986_0147933 | All Organisms → Viruses → Predicted Viral | 1358 | Open in IMG/M |
3300034012|Ga0334986_0184927 | Not Available | 1176 | Open in IMG/M |
3300034012|Ga0334986_0306642 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Dolichocephalovirinae | 839 | Open in IMG/M |
3300034061|Ga0334987_0032388 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4539 | Open in IMG/M |
3300034106|Ga0335036_0815657 | Not Available | 538 | Open in IMG/M |
3300034111|Ga0335063_0458576 | Not Available | 630 | Open in IMG/M |
3300034283|Ga0335007_0001141 | All Organisms → cellular organisms → Bacteria | 20569 | Open in IMG/M |
3300034283|Ga0335007_0087437 | All Organisms → Viruses → Predicted Viral | 2332 | Open in IMG/M |
3300034283|Ga0335007_0112783 | All Organisms → Viruses → Predicted Viral | 1994 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 24.56% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 19.30% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 14.62% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 5.26% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 5.26% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 5.85% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.34% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.34% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 2.34% |
Mine Pit Pond | Environmental → Terrestrial → Geologic → Mine → Unclassified → Mine Pit Pond | 2.34% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.92% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 2.92% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 1.75% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.17% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 1.17% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.17% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.58% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.58% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.58% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.58% |
Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.58% |
Estuary Water | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuary Water | 0.58% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.58% |
Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 0.58% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300002930 | Estuary water microbial communities from Pearl Estuary, Zhujiang, China | Environmental | Open in IMG/M |
3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
3300004460 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300005832 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.41_BBB | Environmental | Open in IMG/M |
3300006863 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA | Environmental | Open in IMG/M |
3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
3300009450 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 4m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
3300009684 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG | Environmental | Open in IMG/M |
3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011334 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Daesung | Environmental | Open in IMG/M |
3300011738 | Mine pit pond microbial communities from Vermont, USA - 1M | Environmental | Open in IMG/M |
3300011918 | Mine pit pond microbial communities from Vermont, USA - 2S | Environmental | Open in IMG/M |
3300011921 | Mine pit pond microbial communities from Vermont, USA - 2M | Environmental | Open in IMG/M |
3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013286 | Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y | Environmental | Open in IMG/M |
3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021438 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG | Environmental | Open in IMG/M |
3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
3300025445 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027712 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300028392 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300028393 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034111 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186 | Environmental | Open in IMG/M |
3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
B570J40625_1001442114 | 3300002835 | Freshwater | MKEREKMSYDADPWANHVLNEIKCGECEKEYDEQEGEGNICPTCKEKEGK* |
Water_1044985 | 3300002930 | Estuary Water | MSHYDADPWANHELNEVKCAECEEYFDDQEGEGNICPACIKKEGENE* |
Ga0065861_10143538 | 3300004448 | Marine | MSYYDGDAWTNHILNEVKCAECEEYFDDQEGEGNICPACIEKGESE* |
Ga0065861_10304244 | 3300004448 | Marine | MSYYAGDSWTFHQLNEVKCAECEEYFDDQEGEGNICPTCIAKEGEEE* |
Ga0065861_10304272 | 3300004448 | Marine | MSYYDGDAWTYHVLNEVKCAECEEYFDDQEGEGNICPPCIEKGESE* |
Ga0066222_10157704 | 3300004460 | Marine | MSYDGDAWTYHTLNEVKCAECEEYFDDQEGEGNICPSCIEKGENE* |
Ga0066222_10157987 | 3300004460 | Marine | MGYYDGDSWSSHELNEIKCAECGEEFDQQDKEGGNICNSCIEKGEEE* |
Ga0066222_10158001 | 3300004460 | Marine | DAWTYHVLNEVKCAECEEYFDDQEGEGNICPSCIEKGESK* |
Ga0066222_10158017 | 3300004460 | Marine | MSYDGDAWTYHVLNEVKCAECEEYFDDQEGEGNICPSCIEKGESE* |
Ga0066222_10205995 | 3300004460 | Marine | MSYYDGDPFSNHILNEIKCAECGNEFDQQEEEGGNICPSCIEKEGEGE* |
Ga0066223_10404822 | 3300004461 | Marine | MGYYDGDAWSNHELNEIKYAECGDYFDQQDKEGGNICPSCIEKGENE* |
Ga0066223_10705503 | 3300004461 | Marine | MSYYDGDPFSNHILNEIKCAECGDEFDQQEEEGGNICPSCIEKEGEGE* |
Ga0070374_103995181 | 3300005517 | Freshwater Lake | MSHYDGDAWSNHVLNEVKCAECEEHFDDQEGEGNIC |
Ga0049080_101945713 | 3300005582 | Freshwater Lentic | VGYYDGDPWSSHVLNEVKCAECEEHFDDQEGEGNICPPCIAKEGESDE* |
Ga0078894_102491652 | 3300005662 | Freshwater Lake | MSYYEGDAWTYHVLNEVKCAECGEYFDDQEGEGNICPACIDKEGESK* |
Ga0074469_108453871 | 3300005832 | Sediment (Intertidal) | YDGDPWSNHVSNFIECAECGSEFDQQEEEGGNICPACIDKEEEE* |
Ga0075459_10099122 | 3300006863 | Aqueous | MSYYDGDSWSNHELNEIKCAECGEEFDQQEEEGGNICPSCIDKGEGE* |
Ga0075473_104020644 | 3300006875 | Aqueous | DPWANHELNEIKCAECLEYFDQQEEEGGNICPACIEKEGEE* |
Ga0070748_12572252 | 3300006920 | Aqueous | MSYYDGDAWTYHVLNEVKCAECEEYFDDQEGEGNICPPCIVKGYGE* |
Ga0114340_11153792 | 3300008107 | Freshwater, Plankton | MSHYDGDSWSNHQLNEVKCAECSEYFDDQEREGNICPACIEKGESK* |
Ga0114347_10171964 | 3300008114 | Freshwater, Plankton | VSYYDGDPWSNHQLNEIKCGECEREYDEQEGEGNICPACIDKEEEE* |
Ga0114347_10571845 | 3300008114 | Freshwater, Plankton | VSYYDGDPWSNHKLNEIKCGECEREYDEQEGEGNICPACIEKEGESK* |
Ga0114347_11065171 | 3300008114 | Freshwater, Plankton | ADPWANHQLNEIKCGECEREYDEQEGEGNICPACKEKEGENNE* |
Ga0114347_11215351 | 3300008114 | Freshwater, Plankton | ADPWANHQLNEIKCGECEREYDEQEGEGNICPACKEKEGKNE* |
Ga0114363_10437756 | 3300008266 | Freshwater, Plankton | VSYYDADPWANHRLNEIECGECEREYDEQEGEGNICPTCKEKEGEQ* |
Ga0114363_11872202 | 3300008266 | Freshwater, Plankton | VSHYDGDPWSNHQLNEIKCGECGQEYDEQEGEGNICPTCKEKEGEK* |
Ga0114364_10309857 | 3300008267 | Freshwater, Plankton | MSHYDGDAWSNHELNEVKCAECSEYFDDQEGEGNICPACIAKEGEKDNE* |
Ga0114364_11320422 | 3300008267 | Freshwater, Plankton | MSYYAGDSWTFHQLNEVKCAECEDYFDDQEREGNICPACIEKEGENENEYL* |
Ga0114876_10234935 | 3300008448 | Freshwater Lake | MSYYDADPWANHQLNEIKCGECEREYDEQEGEGNICPACKEKEGENNE* |
Ga0114973_100470733 | 3300009068 | Freshwater Lake | MSYYDGDPFSRHELNEVKCAECSEYFDDQEGEGNICPPCIKKKG* |
Ga0114973_101567555 | 3300009068 | Freshwater Lake | MGHYDGDPWSSHELNEVKCAECSEYFDDQEKEGNICPPCVQKGYGEGK* |
Ga0105098_100522892 | 3300009081 | Freshwater Sediment | MGYYDGDPWSNHILNEIKCAECEEYFDDQEGEGNICPTCKVRERAK* |
Ga0114962_100168209 | 3300009151 | Freshwater Lake | MGYYDGDSWSNHVANLIDCAECGEEFDDQEREGNICPACVEKEGESE* |
Ga0114962_100275917 | 3300009151 | Freshwater Lake | MSYYDGDAWTYHVLNEVKCAECSEYFDNQEGEGNICPPCIEKGENE* |
Ga0114962_100728908 | 3300009151 | Freshwater Lake | VSYYEGDAWTYHVLNEVKCAECEEYFDDQEGEGNICPACIEKEGENELE* |
Ga0114962_100892307 | 3300009151 | Freshwater Lake | MSYYDGDAWTYHVLNEVKCAECEEYFDDQEGEGNICPACIEKEGESK* |
Ga0114968_100166447 | 3300009155 | Freshwater Lake | MGHYDGDPWSNHVLNEVKCAECEEYFDDQEGEGNICPPCVTKCYGEGEKENG* |
Ga0114968_101377215 | 3300009155 | Freshwater Lake | MSHYDGDSWSNHELNEVKCAECSEYFDDQEREGNICPPCIEKEGESK* |
Ga0114968_102958322 | 3300009155 | Freshwater Lake | VSYYDGDSWSNHELNEIKCAECGEEFDQQEEEGGNICPSCIEKEGEGE* |
Ga0114978_100278596 | 3300009159 | Freshwater Lake | MGHYDGDPFSNHQLNEVKCAECEEYFDDQEGEGNICPACIAKEGENE* |
Ga0114978_100317776 | 3300009159 | Freshwater Lake | MGFYDADPWANHSFNFIECAGCESEFDQQDQEGGNICPTCIDKEEEGK* |
Ga0114978_102108406 | 3300009159 | Freshwater Lake | MSHYDGDAWSNHVLNEAKCAECEEYFDDQEGEGNICPACIEKEGERE* |
Ga0114970_105463711 | 3300009163 | Freshwater Lake | YYDGDPFSRHELNEVKCAECSEYFDDQEGEGNICPPCIKKKG* |
Ga0105102_102016065 | 3300009165 | Freshwater Sediment | MSYYDGDPWSNHVLNEVECAESEEYFDQQDEDGGKICPPCVMRERAKNE* |
Ga0105102_106401234 | 3300009165 | Freshwater Sediment | NHVLNEVECAECGEYFDQQEEEGGKICPPCVMRERAKSEC* |
Ga0114959_101290638 | 3300009182 | Freshwater Lake | YDGDAWTYHVLNEVKCAECSEYFDNQEGEGNICPPCIEKGENE* |
Ga0114974_103299792 | 3300009183 | Freshwater Lake | MSHYDGDAWSNHVLNEAKCAECEEYFDDQEGEGNICPACIEKEGEKENG* |
Ga0114974_104930531 | 3300009183 | Freshwater Lake | MSHYDGDSWSNHELNEVKCAECSEYFDDQEREGNICPPCIEKEGETMKEY |
Ga0114976_100222558 | 3300009184 | Freshwater Lake | MSYYDGDSWSNHELNEIKCAECGEEFDQQEEEGGNICPSCIEKEGERE* |
Ga0114971_108025682 | 3300009185 | Freshwater Lake | MGHYDGDPWSSHELNEIKCAQCGEEFDQQEEGEGNICPACIDKGENEMKAESYQI |
Ga0127391_10040356 | 3300009450 | Meromictic Pond | MSYYDGDAWTYHVLNEVKCAECSEYFDDQEGEGNICPDCIEKEGEKK* |
Ga0114958_101443502 | 3300009684 | Freshwater Lake | MNYEGDAWTYHVLNEVKCAECEEYFDDQEGEGNICPACIEKEEENE* |
Ga0114964_102267952 | 3300010157 | Freshwater Lake | VSYYDGDSWSNHELNEIKCAECGEEFDQQDQDGGNICPACIDKGESE* |
Ga0136644_104313172 | 3300010334 | Freshwater Lake | MSYYDGDAWTYHVLNEVKCAECEEYFDDQEGEGNICPSCIEKGESE* |
Ga0133913_1020334013 | 3300010885 | Freshwater Lake | VSHYDGDPFSNHELNEVKCAECSEYFDDQEGEGNICPACIEKEGESK* |
Ga0133913_107615221 | 3300010885 | Freshwater Lake | MSYYDGDAWTYHVLNEVKCAECSEYFDDQEGEGNICPACIEKEGENELE* |
Ga0133913_117264302 | 3300010885 | Freshwater Lake | MGYYDGDAWTYHVLNEVKCAECSEYFDDQEGEGNICPACIEKGESE* |
Ga0133913_135346494 | 3300010885 | Freshwater Lake | MSYYDGDAWTYHVLNEVKCAECEEYFDDQEGEGNICPTCIEKGESK* |
Ga0153697_123521 | 3300011334 | Freshwater | MSYYDGDPWSNHVLNEIKCAECLEYFDQQEEEGGNVCQPCLDKCYGEGESK* |
Ga0120086_1090822 | 3300011738 | Mine Pit Pond | MGYYDADPWANHSFNFIDCAECESEFDQQDQEGGNICPTCIDKEEESK* |
Ga0120090_1022125 | 3300011918 | Mine Pit Pond | MSYYDADPWANHSFNFIECAECESEFDQQDQEGGNICPTCIDKEEGESK* |
Ga0120090_1038253 | 3300011918 | Mine Pit Pond | MGYYDADPWANHAFNFIDCAECESEFDQQDQEGGNICPTCIDKEEGESK* |
Ga0120089_1086272 | 3300011921 | Mine Pit Pond | VSYYDADSWANHAFNFIDCAECGSEFDQQDQEGGNICPTCIDKEEGENK* |
Ga0157210_10023465 | 3300012665 | Freshwater | VSYYDGDPWSNHELNEIKCAECEEEFDQQEEEGGNICPPCLDKGYGEGK* |
Ga0157210_10611511 | 3300012665 | Freshwater | DGDPWSNHELNEIKCAECGNEFDQQEEEGGNICPSCIEKEGENK* |
Ga0157210_10633482 | 3300012665 | Freshwater | MSYYDGDPWSNHVSNFIECAECESEFDQQEEEGGNICPTCIDKEEEE* |
Ga0164293_100281157 | 3300013004 | Freshwater | MSYYDADPWANHSFNFIDCAECGSEFDQQDQEGGNICPTCIDKEEESK* |
Ga0164293_105226852 | 3300013004 | Freshwater | MGYYDADPWANHSFNFIDCAECESEFDQQEEEGGNICPTCIDKEEGESK* |
Ga0164292_100770419 | 3300013005 | Freshwater | MGYYDGDPWSNHILNEIKCAECEEYFDQQEEEEGNICPPCILKERAKQ* |
Ga0136641_11923282 | 3300013286 | Freshwater | MSYYAGDAWTYHTLNEVKCAECEEYFDDQEGEGNICPACIEKGESE* |
Ga0181364_10362725 | 3300017701 | Freshwater Lake | MGYYDGDPWSNHVLNEVKCAECEEYFDDQEGEGNICPPCVT |
Ga0181347_10905873 | 3300017722 | Freshwater Lake | MGYYDGDPWSNHVLNEVKCAECEEYFDDQEGEGNICPPC |
Ga0181347_10969984 | 3300017722 | Freshwater Lake | MGHYDGDPWSSHVLNEIKCAECGKEYDEQEGEGNICPACIEKEGESK |
Ga0181347_11120531 | 3300017722 | Freshwater Lake | HVLNEVKCAECEEYFDDQEGEGNICPACIEKGESK |
Ga0181365_10507031 | 3300017736 | Freshwater Lake | YDGDPWSNHVLNEVKCAECEEYFDDQEGEGNICPACIKKEGESK |
Ga0181365_10507034 | 3300017736 | Freshwater Lake | MSYYDGDPWSNHVLNEVKCAECEEYFDDQEGEGNICPACIAKEGEKENG |
Ga0181344_10117098 | 3300017754 | Freshwater Lake | MSYYEGDAWTYHVLNEVKCAECGEYFDDQEGEGNICPACIDKEGESK |
Ga0181356_11254462 | 3300017761 | Freshwater Lake | MSYYDGDPWSNHVANLIDCAECGEEFDQQEEGEGNICPACIEKEGENENLQGNS |
Ga0181358_10793675 | 3300017774 | Freshwater Lake | MSYYDGDPWSNHVLNEIKCAECGEEFDQQEEEGGNICPPCTEKEGESE |
Ga0181358_11114021 | 3300017774 | Freshwater Lake | VGFYDGDPWSNHVLNEIKCAECGEEFDQQEEGEGNICPTCKEKEGEK |
Ga0181358_12070341 | 3300017774 | Freshwater Lake | MGHYDGDPWSNHVLNEVKCAECEEYFDDQEGEGNICPACIEKEGESK |
Ga0181357_10694884 | 3300017777 | Freshwater Lake | MGHYDGDPWSNHVLNEVKCAECEEYFDDQEGEGNICPPCVTKSYGEGESK |
Ga0181357_10767417 | 3300017777 | Freshwater Lake | MGYYDGDPFSNHQLNEVKCAECEEYFDDQEGEGNICPACIEKGESK |
Ga0181357_11831621 | 3300017777 | Freshwater Lake | VSYYDGDAWSNHQLNEVKCAECEEYFDDQEGEGNICPACIEKEGESK |
Ga0181349_11090971 | 3300017778 | Freshwater Lake | MSYYDGDPWSNHVLNEIKCAECGEEFDQQEEGEGNICPACIAKEGESK |
Ga0181349_11277621 | 3300017778 | Freshwater Lake | MGYYDGDPWSNHVLNEVKCAECEEYFDDQEGEGNICPACIKKEGEK |
Ga0181349_11414201 | 3300017778 | Freshwater Lake | MIVSFYDGDAWSNHVLNEVKCAECEEYFDDQEGEGNICPACIEKG |
Ga0181348_10698411 | 3300017784 | Freshwater Lake | VSYYDGDPWSNHVLNEVKCAECEEYFDDQEGEGNICPPCVTPF |
Ga0181348_11396833 | 3300017784 | Freshwater Lake | VSYYDGDAWSNHQLNEVKCAECEEYFDDQEGEGNICPACIAKEGESE |
Ga0181348_11830374 | 3300017784 | Freshwater Lake | YYDGDPWSNHVLNEIKCAECGEEFDQQEEEGGNICPPCTEKEGESK |
Ga0181348_12435681 | 3300017784 | Freshwater Lake | MSYYDGDPWSNHVLNEIKCAECGEEFDQQEEGEGNICPP |
Ga0181355_12098901 | 3300017785 | Freshwater Lake | VGFYDGDPWSNHVLNEIKCAECGEEFDQQEEGEGNICPACIAKEGESK |
Ga0181355_12254004 | 3300017785 | Freshwater Lake | DGDPWSNHVLNEIKCAECGEEFDQQEEEGGNICPPCTEKEGESK |
Ga0181355_13036393 | 3300017785 | Freshwater Lake | VSYYDGDAWSNHQLNEVKCAECEEYFDDQEGEGNICPPCVT |
Ga0181359_10200631 | 3300019784 | Freshwater Lake | MSYYDGDPWSNHVLNEVKCAECEEHFDDQEGEGNICPPCV |
Ga0181359_10285307 | 3300019784 | Freshwater Lake | MIVSFYDGDAWSNHVLNEVKCAECEEYFDDQEGEGNICPACIEKGESK |
Ga0181359_10478191 | 3300019784 | Freshwater Lake | MSHYDGDAWSNHVLNEVKCAECEEHFDDQEGEGNICPACIKKEGENE |
Ga0181359_11255122 | 3300019784 | Freshwater Lake | MSYYDGDPWSNHVLNEIKCAECGEEYDEQEGEGNICPACTEKEGESE |
Ga0181359_11708182 | 3300019784 | Freshwater Lake | MGYYDGDPWSNHVLNEVKCAECEEYFDDQEGEGNICPACIKKEGESK |
Ga0181359_12465343 | 3300019784 | Freshwater Lake | YYDGDPWSNHVANLIDCAECGEEFDQQEEEGGNICPPCTEKEGESK |
Ga0207193_11460527 | 3300020048 | Freshwater Lake Sediment | MGYYDGDPWSNHVSNFIECAECESEFDQQEEEGGNICPACIDKEEGES |
Ga0207193_18574872 | 3300020048 | Freshwater Lake Sediment | MGYYDGDPWSNHVLNEIKCAECEEYFDDQEGEGNICPTCKEKERAK |
Ga0211726_102065051 | 3300020161 | Freshwater | VSYYEGDSWTYHQLNEIKCGECGQEYDEQEGEGNICPTCKEKEGESK |
Ga0211731_109962651 | 3300020205 | Freshwater | MSHYDGDPFSNHVLNEVKCAECEEYFDDQEGEGNICPAC |
Ga0211731_115254631 | 3300020205 | Freshwater | VSYYEGDPWSNHVANLIECGECEQEYDEQESEGNICPTCKEK |
Ga0208050_10035007 | 3300020498 | Freshwater | MKEREKMSYDADPWANHVLNEIKCGECEKEYDEQEGEGNICPTCKEKEGK |
Ga0213920_10045377 | 3300021438 | Freshwater | MGYYDGDPWSNHELNELKCAECGDYFDQQDKEGGNICPVCIDEGEGE |
Ga0213920_10236355 | 3300021438 | Freshwater | MGYYDGDSWANHIANWTDCAECGEEFDDQEREGNICPDCIKEEEE |
Ga0213922_10159184 | 3300021956 | Freshwater | VSYYDGDPWSNHELNEIKCAECLEYFDQQDKEGGNICPVCIDKEEGESK |
Ga0222713_101058224 | 3300021962 | Estuarine Water | VSYYDADPWANHSFNFIDCAECGSEFDQQDQEGGNICPTCIDKEEGESK |
Ga0222712_107691692 | 3300021963 | Estuarine Water | VGYYDGDPWSNHQLNEIECAECLKHFDQQEEEGGNICQPCLNKGYGEGEK |
Ga0196901_10729263 | 3300022200 | Aqueous | MGYYDGDPWSNHVLNEIKCAECEEYFDDQEGEGNICPTCKLRERAKNE |
Ga0214917_1000599825 | 3300022752 | Freshwater | MSYYDGDPWSNHELNELKCAECGDYFDQQDKEGGNICPVCIDKGEGESE |
Ga0214917_1001401914 | 3300022752 | Freshwater | VSYYAGDAWTYHVLNEVKCAECGEYFDDQEGEGNICPSCIEKGESK |
Ga0214917_101118674 | 3300022752 | Freshwater | MGFYDGDPWSNHELNEIKCAECEEYFDNQEGEGNICPACIDKEEGESE |
Ga0214917_101945232 | 3300022752 | Freshwater | MSYYAGDAWTYHVLNEVKCAECEEYFDNQEGEGNICPACIDKEEGESE |
Ga0214921_1001301215 | 3300023174 | Freshwater | MSHYDGDSWSNHVLNEVKCAECEEYFDDQEGEGNICPACIEKGESK |
Ga0214921_100235054 | 3300023174 | Freshwater | MSYYDGDAWTYHVLNEVKCAECSEYFDDQEGEGNICPSCIAKEG |
Ga0214921_100557741 | 3300023174 | Freshwater | VSYYDGDPWSNHVLNEVKCAECEEYFDDQEGEGNICPACIDKEEGESE |
Ga0214921_100598375 | 3300023174 | Freshwater | MSYYAGDSWTFHQLNEVKCAECEEYFDDQEGEGNICPPCIEKGESK |
Ga0214921_103739771 | 3300023174 | Freshwater | MGYYDGDSWSNHELNEIKCAECGDEFDQQDQDEGNICPSCIEKGESE |
Ga0214923_101511175 | 3300023179 | Freshwater | MGYYDGDPFSNHVLNEVKCAECKEYFDDQEGEGNICPSCIAKEG |
Ga0208424_10248042 | 3300025445 | Aqueous | MSYYDGDSWSNHELNEIKCAECGEEFDQQEEEGGNICPSCIDKGEGE |
Ga0209188_101016913 | 3300027708 | Freshwater Lake | MGYYDGDSWSNHVANLIDCAECGEEFDDQEREGNICPACVEKEGESE |
Ga0209188_10603398 | 3300027708 | Freshwater Lake | AWTYHVLNEVKCAECSEYFDNQEGEGNICPPCIEKGENE |
Ga0209499_10353867 | 3300027712 | Freshwater Lake | MSYYDGDAWTYHVLNEVKCAECSEYFDNQEGEGNICPPCIEKGENE |
Ga0209499_11084612 | 3300027712 | Freshwater Lake | MNYEGDAWTYHVLNEVKCAECEEYFDDQEGEGNICPACIEKEEENE |
Ga0209087_10727998 | 3300027734 | Freshwater Lake | MSHYDGDAWSNHVLNEAKCAECEEYFDDQEGEGNICPACIEKEGERE |
Ga0209084_10094515 | 3300027749 | Freshwater Lake | MNYDGDPFSNHELNEIKCAECLEYFDQQEEEGGNICPPCLDKGYGEGESNE |
Ga0209084_10807923 | 3300027749 | Freshwater Lake | MSYYDGDAWTYHVLNEVKCAECEEYFDDQEGEGNICPACIEKEGESK |
Ga0209596_11286304 | 3300027754 | Freshwater Lake | MSHYDGDPFSNHELNEVKCAECSEYFDDQEREGNICPPCIEKEGESK |
Ga0209829_1000124418 | 3300027777 | Freshwater Lake | MSYYDGDAWTYHELNEIKCAECGDEFDQQDREGGNICPACIDKEGESK |
Ga0209500_100726662 | 3300027782 | Freshwater Lake | MGHYDGDPFSNHQLNEVKCAECEEYFDDQEGEGNICPACIAKEGENE |
Ga0209353_103679351 | 3300027798 | Freshwater Lake | VSYYDGDPWSNHVLNEVKCAECEEYFDDQEGEGNIC |
Ga0209229_100621565 | 3300027805 | Freshwater And Sediment | MGYYDGDPWSNHVLNEIKCAECEDYFDQQEEEGGNICPPCVIKCYGEGK |
Ga0209536_1019110201 | 3300027917 | Marine Sediment | MSYYDGDAWTYHVLNEVKCAECGDYFDQQDKEGGNICPVCIDKGEGE |
Ga0209820_10935566 | 3300027956 | Freshwater Sediment | ISGRTRMGYYDGDPWSNHILNEIKCAECEEYFDDQEGEGNICPTCKVRERAK |
Ga0209400_10052227 | 3300027963 | Freshwater Lake | MGHYDGDPWSNHVLNEVKCAECEEYFDDQEGEGNICPPCVTKCYGEGEKENG |
Ga0209400_100808810 | 3300027963 | Freshwater Lake | VSHYDGDPFSNHELNEVKCAECSEYFDDQEGEGNICPACIEKEGESK |
Ga0209400_10997664 | 3300027963 | Freshwater Lake | MSHYDGDSWSNHELNEVKCAECSEYFDDQEREGNICPPCIEKEGESK |
Ga0209401_10099302 | 3300027971 | Freshwater Lake | MGHYDGDPWSSHELNEVKCAECSEYFDDQEKEGNICPPCVQKGYGEGK |
Ga0209401_10642376 | 3300027971 | Freshwater Lake | MSYYDGDPFSRHELNEVKCAECSEYFDDQEGEGNICPPCIKKKG |
Ga0247723_10204385 | 3300028025 | Deep Subsurface Sediment | MGYYDGDPWSNHVLNEIKCAECGDEFDQQEEEGGNICPACIDKEEEE |
Ga0247723_10218358 | 3300028025 | Deep Subsurface Sediment | IPEYRGERGVSYYEGDPWSNHQLNEIECAECGEEYDEQEGEGNICPTCKEKEAE |
Ga0247723_10232739 | 3300028025 | Deep Subsurface Sediment | GDPWSNHVLNEIKCAECGDEFDQQDEEGGNICPACIDKEEGKSK |
Ga0247723_11223363 | 3300028025 | Deep Subsurface Sediment | MSYYDGDPWSNHVSNFIECAECGSEFDQQEEEGGNICPACIDKEEESK |
Ga0247723_11322124 | 3300028025 | Deep Subsurface Sediment | MGYYDGDPWSNHVLMEIKCAECEEYFDQQEEEGGNICPPCVIKEREGE |
Ga0304729_10222277 | 3300028392 | Freshwater Lake | MSYYDGDAWTYHVLNEVKCAECSEYFDDQEGEGNICPACIEKEGENELE |
Ga0304728_10874102 | 3300028393 | Freshwater Lake | MGHYDGDPWSKHELNEVKCAECEEYFDNQEGEGNICPACIEKGEKE |
Ga0315907_100009501 | 3300031758 | Freshwater | MSYYDADPWANHQLNEIKCGECEREYDEQEGEGNICPACKEK |
Ga0315907_101980546 | 3300031758 | Freshwater | VSYYDGDPWSNHKLNEIKCGECEREYDEQEGEGNICPACIEKEGESK |
Ga0315907_104040254 | 3300031758 | Freshwater | SYYDADPWANHQLNEIKCGECEREYDEQEGEGNICPACKEKEGENNE |
Ga0315907_104679771 | 3300031758 | Freshwater | SYYDADPWANHQLNEIKCGECEREYDEQEGEGNICPACKEKEGKNE |
Ga0315907_104999086 | 3300031758 | Freshwater | ANHRLNEIECGECEREYDEQEGEGNICPTCKEKEGEQ |
Ga0315909_102354844 | 3300031857 | Freshwater | VSHYDGDPWSNHQLNEIKCGECGQEYDEQEGEGNICPTCKEKEGEK |
Ga0315901_102289525 | 3300031963 | Freshwater | MSYYDADPWANHQLNEIKCGECEREYDEQEGEGNICPACKEKEGKNE |
Ga0315274_115512141 | 3300031999 | Sediment | KMSYYDGDTWSNHVLNEVKCAECEEYFDDQEGEGNICPACIEKGEE |
Ga0315906_1000107167 | 3300032050 | Freshwater | WANHQLNEIKCGECEREYDEQEGEGNICPACKEKEGKNE |
Ga0315906_108847581 | 3300032050 | Freshwater | VSYYDGDPWSNHKLNEIKCGECEREYDEQEGEGNICPACIEKEGE |
Ga0334994_0121023_327_464 | 3300033993 | Freshwater | MSYYDGDAWANHVLNEIKCAECEKEYDEQEGEGNICPTCKEKEGE |
Ga0334979_0356155_646_792 | 3300033996 | Freshwater | MSYYDADPWANHSFNFIDCAECGSEFDQQDQEGGNICPTCIDKEEESK |
Ga0334986_0009067_4453_4596 | 3300034012 | Freshwater | VGHYDGDPWSNHKLNEIKCGECGQEYDEQEGEGNICPTCKEKEGENE |
Ga0334986_0147933_921_1070 | 3300034012 | Freshwater | MSYYDADPWANHSFNFIECAECESEFDQQDQEGGNICPTCIDKEEGESK |
Ga0334986_0184927_435_581 | 3300034012 | Freshwater | MGYYDGDPWSNHILNEIKCAECEEYFDDQEGEGNICPPCILKERAKNE |
Ga0334986_0306642_397_540 | 3300034012 | Freshwater | MSYYEADPWANHQLNEIKCGECEREYDEQEGEGNICPTCKEKEGEQC |
Ga0334987_0032388_1193_1333 | 3300034061 | Freshwater | MSYYDADPWANHQLNEIKCGECEREYDEQEGEGNICPTCKEKEGEQ |
Ga0335036_0815657_150_308 | 3300034106 | Freshwater | MRGAIVSYYDGDPWSSHVLNEVKCAKCEEYFDDQEGEGNICPACIAKESESK |
Ga0335063_0458576_109_252 | 3300034111 | Freshwater | MSYYDGDPWANHVLNEIACGECEREYDEQEGEGNICPACKEQEGESE |
Ga0335007_0001141_7804_7947 | 3300034283 | Freshwater | MSYYDGDPWSSHVLNEVKCAECEEKFDDQEGEGNICPACIEKEGERE |
Ga0335007_0087437_3_116 | 3300034283 | Freshwater | ANHQLNEIKCGECGREYDEQEGEGNICPTCKEKEGEQ |
Ga0335007_0112783_1690_1830 | 3300034283 | Freshwater | VGYYDGDPWSNHQLNEIKCGECGKEYDEQEGEGNICPACKEKEGEQ |
⦗Top⦘ |