| Basic Information | |
|---|---|
| Family ID | F035517 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 172 |
| Average Sequence Length | 46 residues |
| Representative Sequence | VSALDLAARALRAAEGDEAQALVQSERSGMARFAGSEVHQPTLIEN |
| Number of Associated Samples | 157 |
| Number of Associated Scaffolds | 172 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 67.27 % |
| % of genes near scaffold ends (potentially truncated) | 95.35 % |
| % of genes from short scaffolds (< 2000 bps) | 90.12 % |
| Associated GOLD sequencing projects | 151 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.31 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.767 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (15.116 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.837 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.581 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.54% β-sheet: 0.00% Coil/Unstructured: 59.46% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 172 Family Scaffolds |
|---|---|---|
| PF01523 | PmbA_TldD | 59.88 |
| PF01726 | LexA_DNA_bind | 1.74 |
| PF11361 | DUF3159 | 1.16 |
| PF08241 | Methyltransf_11 | 0.58 |
| PF02782 | FGGY_C | 0.58 |
| PF02467 | Whib | 0.58 |
| PF05103 | DivIVA | 0.58 |
| COG ID | Name | Functional Category | % Frequency in 172 Family Scaffolds |
|---|---|---|---|
| COG0312 | Zn-dependent protease PmbA/TldA or its inactivated homolog | General function prediction only [R] | 59.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.77 % |
| Unclassified | root | N/A | 5.23 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2044078002|MGR_F548DK202IVPQ6 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 504 | Open in IMG/M |
| 2065487018|GPINP_F5MS3JC02FRMSS | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 2170459019|G14TP7Y01EMY65 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 501 | Open in IMG/M |
| 3300000890|JGI11643J12802_11515217 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300003990|Ga0055455_10209206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 612 | Open in IMG/M |
| 3300003998|Ga0055472_10186431 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300004070|Ga0055488_10141070 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300005167|Ga0066672_10656925 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300005172|Ga0066683_10697121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 602 | Open in IMG/M |
| 3300005177|Ga0066690_10544229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 777 | Open in IMG/M |
| 3300005179|Ga0066684_10729890 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300005184|Ga0066671_10224288 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
| 3300005187|Ga0066675_10203599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1392 | Open in IMG/M |
| 3300005187|Ga0066675_10330070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1111 | Open in IMG/M |
| 3300005328|Ga0070676_10654964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 763 | Open in IMG/M |
| 3300005330|Ga0070690_100764003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 747 | Open in IMG/M |
| 3300005341|Ga0070691_10067571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1729 | Open in IMG/M |
| 3300005345|Ga0070692_10687345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 687 | Open in IMG/M |
| 3300005364|Ga0070673_100508322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1090 | Open in IMG/M |
| 3300005466|Ga0070685_10551677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 823 | Open in IMG/M |
| 3300005467|Ga0070706_101007904 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 768 | Open in IMG/M |
| 3300005471|Ga0070698_100814971 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300005540|Ga0066697_10067912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2043 | Open in IMG/M |
| 3300005543|Ga0070672_100067413 | All Organisms → cellular organisms → Bacteria | 2836 | Open in IMG/M |
| 3300005547|Ga0070693_100845745 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300005556|Ga0066707_10712437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 628 | Open in IMG/M |
| 3300005558|Ga0066698_10746821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 640 | Open in IMG/M |
| 3300005578|Ga0068854_100940805 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300005598|Ga0066706_10202309 | All Organisms → cellular organisms → Bacteria | 1526 | Open in IMG/M |
| 3300005719|Ga0068861_102208057 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300005889|Ga0075290_1052076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 566 | Open in IMG/M |
| 3300006032|Ga0066696_10838352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 586 | Open in IMG/M |
| 3300006034|Ga0066656_10915437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 562 | Open in IMG/M |
| 3300006046|Ga0066652_101134221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 741 | Open in IMG/M |
| 3300006058|Ga0075432_10195114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 799 | Open in IMG/M |
| 3300006163|Ga0070715_10188958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1038 | Open in IMG/M |
| 3300006237|Ga0097621_100374879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1270 | Open in IMG/M |
| 3300006237|Ga0097621_100994160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 784 | Open in IMG/M |
| 3300006796|Ga0066665_10830249 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 725 | Open in IMG/M |
| 3300006800|Ga0066660_10187183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1567 | Open in IMG/M |
| 3300006804|Ga0079221_10570857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 754 | Open in IMG/M |
| 3300006806|Ga0079220_11401461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 593 | Open in IMG/M |
| 3300006847|Ga0075431_100986877 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 809 | Open in IMG/M |
| 3300006894|Ga0079215_10392441 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300006903|Ga0075426_10716695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 750 | Open in IMG/M |
| 3300006903|Ga0075426_11155676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 587 | Open in IMG/M |
| 3300006904|Ga0075424_101639777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 682 | Open in IMG/M |
| 3300006914|Ga0075436_100661982 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300006953|Ga0074063_13915994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 564 | Open in IMG/M |
| 3300007076|Ga0075435_100948578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 751 | Open in IMG/M |
| 3300009012|Ga0066710_100198546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2853 | Open in IMG/M |
| 3300009012|Ga0066710_103899832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 559 | Open in IMG/M |
| 3300009098|Ga0105245_11311099 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300009100|Ga0075418_11395805 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300009137|Ga0066709_103254428 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300009148|Ga0105243_11034598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 826 | Open in IMG/M |
| 3300009148|Ga0105243_11399808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 720 | Open in IMG/M |
| 3300009156|Ga0111538_10703782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1280 | Open in IMG/M |
| 3300009162|Ga0075423_12936985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 522 | Open in IMG/M |
| 3300009545|Ga0105237_10729508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 997 | Open in IMG/M |
| 3300009792|Ga0126374_10648658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 786 | Open in IMG/M |
| 3300009808|Ga0105071_1028155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 836 | Open in IMG/M |
| 3300009812|Ga0105067_1085876 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300009819|Ga0105087_1096686 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300009840|Ga0126313_10020329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4407 | Open in IMG/M |
| 3300009873|Ga0131077_10475940 | Not Available | 1164 | Open in IMG/M |
| 3300010039|Ga0126309_10108212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1442 | Open in IMG/M |
| 3300010040|Ga0126308_10194723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1300 | Open in IMG/M |
| 3300010044|Ga0126310_11155578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 619 | Open in IMG/M |
| 3300010301|Ga0134070_10366214 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300010321|Ga0134067_10138487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 861 | Open in IMG/M |
| 3300010321|Ga0134067_10430452 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 534 | Open in IMG/M |
| 3300010322|Ga0134084_10109298 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300010322|Ga0134084_10430222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 521 | Open in IMG/M |
| 3300010337|Ga0134062_10198117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 914 | Open in IMG/M |
| 3300010375|Ga0105239_11765584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 716 | Open in IMG/M |
| 3300010375|Ga0105239_12316179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 625 | Open in IMG/M |
| 3300010396|Ga0134126_11171464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 855 | Open in IMG/M |
| 3300010400|Ga0134122_10433506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1171 | Open in IMG/M |
| 3300010868|Ga0124844_1219853 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 686 | Open in IMG/M |
| 3300011398|Ga0137348_1008554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1532 | Open in IMG/M |
| 3300012001|Ga0120167_1027967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1360 | Open in IMG/M |
| 3300012198|Ga0137364_11043817 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300012211|Ga0137377_11819064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 528 | Open in IMG/M |
| 3300012356|Ga0137371_10064031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2847 | Open in IMG/M |
| 3300012356|Ga0137371_10576242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 865 | Open in IMG/M |
| 3300012474|Ga0157356_1007117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 687 | Open in IMG/M |
| 3300012481|Ga0157320_1008977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 746 | Open in IMG/M |
| 3300012512|Ga0157327_1031160 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300012896|Ga0157303_10006115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1687 | Open in IMG/M |
| 3300012899|Ga0157299_10085204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 788 | Open in IMG/M |
| 3300012905|Ga0157296_10265421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 583 | Open in IMG/M |
| 3300012911|Ga0157301_10022595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1406 | Open in IMG/M |
| 3300012915|Ga0157302_10229792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 683 | Open in IMG/M |
| 3300012960|Ga0164301_11211652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 607 | Open in IMG/M |
| 3300012971|Ga0126369_12712210 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300012977|Ga0134087_10159907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 986 | Open in IMG/M |
| 3300013763|Ga0120179_1026165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1409 | Open in IMG/M |
| 3300014031|Ga0120173_1054028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 579 | Open in IMG/M |
| 3300014150|Ga0134081_10040563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1372 | Open in IMG/M |
| 3300014265|Ga0075314_1029403 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300014968|Ga0157379_10431925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1214 | Open in IMG/M |
| 3300015371|Ga0132258_11529310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1685 | Open in IMG/M |
| 3300017695|Ga0180121_10429814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 516 | Open in IMG/M |
| 3300018089|Ga0187774_10373937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 857 | Open in IMG/M |
| 3300018433|Ga0066667_10525938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 978 | Open in IMG/M |
| 3300019255|Ga0184643_1074715 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300020002|Ga0193730_1074084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 966 | Open in IMG/M |
| 3300021344|Ga0193719_10154381 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
| 3300022737|Ga0247747_1037036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 583 | Open in IMG/M |
| 3300022880|Ga0247792_1015910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1210 | Open in IMG/M |
| 3300024179|Ga0247695_1000688 | All Organisms → cellular organisms → Bacteria | 4917 | Open in IMG/M |
| 3300024254|Ga0247661_1038408 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300024283|Ga0247670_1043210 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300024347|Ga0179591_1218725 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2276 | Open in IMG/M |
| 3300025898|Ga0207692_10226073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1111 | Open in IMG/M |
| 3300025905|Ga0207685_10085007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1319 | Open in IMG/M |
| 3300025905|Ga0207685_10196305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 945 | Open in IMG/M |
| 3300025911|Ga0207654_10255924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1175 | Open in IMG/M |
| 3300025914|Ga0207671_10868277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 714 | Open in IMG/M |
| 3300025922|Ga0207646_10234988 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1656 | Open in IMG/M |
| 3300025928|Ga0207700_10652408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 938 | Open in IMG/M |
| 3300026277|Ga0209350_1089860 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300026342|Ga0209057_1017609 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4136 | Open in IMG/M |
| 3300026527|Ga0209059_1335809 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300026550|Ga0209474_10693616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 527 | Open in IMG/M |
| 3300026552|Ga0209577_10864572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 507 | Open in IMG/M |
| 3300027169|Ga0209897_1066864 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300027637|Ga0209818_1144074 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300027775|Ga0209177_10421492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 540 | Open in IMG/M |
| 3300027787|Ga0209074_10395614 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300027909|Ga0209382_11296080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 738 | Open in IMG/M |
| 3300028381|Ga0268264_11267435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 747 | Open in IMG/M |
| 3300028707|Ga0307291_1055630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 957 | Open in IMG/M |
| 3300028710|Ga0307322_10113674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 703 | Open in IMG/M |
| 3300028718|Ga0307307_10283316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 532 | Open in IMG/M |
| 3300028720|Ga0307317_10118208 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300028722|Ga0307319_10264833 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300028807|Ga0307305_10011257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3940 | Open in IMG/M |
| 3300028819|Ga0307296_10083719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1701 | Open in IMG/M |
| 3300028824|Ga0307310_10630298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 547 | Open in IMG/M |
| 3300028880|Ga0307300_10061745 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
| 3300028880|Ga0307300_10351157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 509 | Open in IMG/M |
| 3300028885|Ga0307304_10128978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1037 | Open in IMG/M |
| 3300030006|Ga0299907_10546216 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
| 3300030619|Ga0268386_10251153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1301 | Open in IMG/M |
| 3300031093|Ga0308197_10277502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 608 | Open in IMG/M |
| 3300031228|Ga0299914_10500888 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
| 3300031229|Ga0299913_10059335 | All Organisms → cellular organisms → Bacteria | 3671 | Open in IMG/M |
| 3300031820|Ga0307473_11503287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 511 | Open in IMG/M |
| 3300031938|Ga0308175_101231154 | Not Available | 833 | Open in IMG/M |
| 3300031938|Ga0308175_102443585 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300031939|Ga0308174_11958782 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300031996|Ga0308176_10975302 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300032003|Ga0310897_10228379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 824 | Open in IMG/M |
| 3300032013|Ga0310906_11134956 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300032080|Ga0326721_11145706 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300032122|Ga0310895_10276597 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300032126|Ga0307415_100875749 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300033233|Ga0334722_10267591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1252 | Open in IMG/M |
| 3300033412|Ga0310810_10306534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1702 | Open in IMG/M |
| 3300033412|Ga0310810_11206226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 612 | Open in IMG/M |
| 3300033551|Ga0247830_10687617 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300033551|Ga0247830_10793563 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300034820|Ga0373959_0146180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 595 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 15.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 12.79% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.56% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.65% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.49% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.33% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.33% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.33% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.91% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.91% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.74% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.74% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.74% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.16% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.16% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.16% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.16% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.16% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.16% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.58% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.58% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.58% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.58% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.58% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.58% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.58% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.58% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.58% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.58% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.58% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.58% |
| Switchgrass, Maize And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass, Maize And Miscanthus Rhizosphere | 0.58% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.58% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.58% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.58% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.58% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.58% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.58% |
| Wastewater | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater | 0.58% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2044078002 | Miscanthus rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL | Host-Associated | Open in IMG/M |
| 2065487018 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2170459019 | Litter degradation MG4 | Engineered | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300003990 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 | Environmental | Open in IMG/M |
| 3300003998 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 | Environmental | Open in IMG/M |
| 3300004070 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005889 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_201 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009808 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 | Environmental | Open in IMG/M |
| 3300009812 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_50_60 | Environmental | Open in IMG/M |
| 3300009819 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_40_50 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300009873 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plant | Engineered | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300011398 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT600_2 | Environmental | Open in IMG/M |
| 3300012001 | Permafrost microbial communities from Nunavut, Canada - A24_80cm_12M | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012474 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.3.yng.040610 | Environmental | Open in IMG/M |
| 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Host-Associated | Open in IMG/M |
| 3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
| 3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
| 3300012905 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2 | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013763 | Permafrost microbial communities from Nunavut, Canada - A15_65cm_0M | Environmental | Open in IMG/M |
| 3300013770 | Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M | Environmental | Open in IMG/M |
| 3300014031 | Permafrost microbial communities from Nunavut, Canada - A35_80cm_0.25M | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014265 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D2 | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017695 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ540 (21.06) (version 2) | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019255 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300022737 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S094-311B-5 | Environmental | Open in IMG/M |
| 3300022880 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S106-311C-6 | Environmental | Open in IMG/M |
| 3300024179 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36 | Environmental | Open in IMG/M |
| 3300024254 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02 | Environmental | Open in IMG/M |
| 3300024283 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11 | Environmental | Open in IMG/M |
| 3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027169 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027637 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
| 3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032080 | Soil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016 | Environmental | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| MGR_1200160 | 2044078002 | Switchgrass, Maize And Miscanthus Rhizosphere | MTSAIELAERAVAAADGDGVEAIVQAEHSGFARFA |
| GPINP_01346840 | 2065487018 | Soil | VTSAIDLAERAVAAAEGDGAEAVVQTEHSGFARFAGSEV |
| 4MG_05054380 | 2170459019 | Switchgrass, Maize And Mischanthus Litter | VSALEIALRALDVAGGDTEALVHAERSGMARFAASEVHQPTLIENTIVQLRVASNGN |
| JGI11643J12802_115152171 | 3300000890 | Soil | VTSAIDLAERAVAAAEGDGAEAVVQTEHSGFARFAGSE |
| Ga0055455_102092061 | 3300003990 | Natural And Restored Wetlands | MSALELARRALAAAGEHAEVVVQSERSGLARFAASEVHQPTLIEN |
| Ga0055472_101864311 | 3300003998 | Natural And Restored Wetlands | VREAPEALELAARAVAAAEGDEVDALAHRERSGLARFAASVVHQPTLVEDASVT |
| Ga0055488_101410701 | 3300004070 | Natural And Restored Wetlands | VSRALDLAERAVKAAEGDEADVSVHVERSGFARFAASAVHQPTLISDE |
| Ga0066672_106569252 | 3300005167 | Soil | VTDALDLAQRALRAAEGDEALALANSERSGLARFAGSEVHQPTLIE |
| Ga0066683_106971211 | 3300005172 | Soil | VTSAIDLAERAVAAAEGDGAEAVVQTEHSGFARFAGSEVHQPTLIENVSVF |
| Ga0066690_105442291 | 3300005177 | Soil | VIDALETAERAVAAAEADEAEAVVLAERSGFARFAASEVHQPTLVEDATVCLRV |
| Ga0066684_107298902 | 3300005179 | Soil | LETARRALELAQADEAEAVVMAEHSGFARFAGSEVHQPTLVDNVVVTL |
| Ga0066671_102242881 | 3300005184 | Soil | VTDALETAERAVAAAEADEAEAVVLAERSGFARFAASEVHQPTLVEDATLS |
| Ga0066675_102035991 | 3300005187 | Soil | LETARRALELAQADEAEAVVMAEHSGFARFAGSEVHQPTLIE |
| Ga0066675_103300703 | 3300005187 | Soil | VTDALDLAERALRAAEGDEALALANSERSGLARFAGSEVHQPTLIEN |
| Ga0070676_106549641 | 3300005328 | Miscanthus Rhizosphere | VSALELAGKALQAAEGDEALALVQSERSGMARFAGSEVHQPTLIEN |
| Ga0070690_1007640032 | 3300005330 | Switchgrass Rhizosphere | VTSAIELAERAVAAADGDGVEAIVQAEHSGFARFAGSEVHQPTLIENVSVFVR |
| Ga0070691_100675713 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | VSALELAGKALQAAEGDEALALVQSERSGMARFAGSEVHQPTLIENET |
| Ga0070692_106873451 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | VNALDLAERALRVAEGDEALALVQSERSGMARFAGSEVHQPTLIENCSVVLQ |
| Ga0070673_1005083221 | 3300005364 | Switchgrass Rhizosphere | VSALELAGKALQAAEGDEALALVQSERSGMARFAGSEVHQPTLIENETVE |
| Ga0070685_105516772 | 3300005466 | Switchgrass Rhizosphere | VNALDLAGRALRVAEGDEALALVQSERSGMARFAGSEVHQPTLIENETVE |
| Ga0070706_1010079042 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VSGLDIAARALAAASGDEAEAVVTVERFGFARFAGSEVHQPTLVDNVVVTLRVA |
| Ga0070698_1008149712 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VSGLDIAARALAAARGDEAEAVVTVERFGFARFAGSEVHQPTLVDNVVVTLRVSRDGK |
| Ga0066697_100679124 | 3300005540 | Soil | VSALELAAQALRCAEGDEALALVQSERSGMARFAGSEVHQP |
| Ga0070672_1000674131 | 3300005543 | Miscanthus Rhizosphere | VSALELAGKALQAAEGDEALALVQSERSGMARFAGSEVHQPTLIE |
| Ga0070693_1008457452 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | VTSDGRALELAERAWRAAEADEADAVVQVEESGFARFAGSEVHQPTLI |
| Ga0066707_107124371 | 3300005556 | Soil | VKGALELAERAVAAAEGDGVEAVVQAERSGFARFAGSE |
| Ga0066698_107468211 | 3300005558 | Soil | VISAIDLAERAVAAAEGDGIEAVVQAERSGVARFAGSEV |
| Ga0068854_1009408051 | 3300005578 | Corn Rhizosphere | MSDGRALELADRAWRAAEADEADAVVQVEESGFARFAGSEVHQPTLISDESI |
| Ga0066706_102023093 | 3300005598 | Soil | VTDALDLAERALRAAEGDEALTLANSERSGLARFAGS |
| Ga0068861_1022080571 | 3300005719 | Switchgrass Rhizosphere | VTSAIDLAERAVAAAEGDGAEAVVQTEHSGFARFAGS |
| Ga0075290_10520762 | 3300005889 | Rice Paddy Soil | MSALELAERALRVAEGDEAVALVQSERSGMARFAGSEVHQPTL |
| Ga0066696_108383522 | 3300006032 | Soil | LSHVLDLAARALREAEGDEALVLVHGERSGLARFAGSEVHQ |
| Ga0066656_109154371 | 3300006034 | Soil | VISAIDLAERAVAAAEGDGIEAVVQAERSGVARFAGSEVHQPTLIENV |
| Ga0066652_1011342212 | 3300006046 | Soil | LSGALDLAERALKAAEGDEALVLVHSERSGLARFAGSEVHQPTLIENEVVELQV |
| Ga0075432_101951142 | 3300006058 | Populus Rhizosphere | MTSAIELAERAVAAADGDGVEAIVQAEHSGFARFAGSEVHQPTLIENVSVFVRV |
| Ga0070715_101889582 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | VSALDLATRALRAAEGDEAQALVQSERSGMARFAGSEVHQPTLIENEVVE |
| Ga0097621_1003748792 | 3300006237 | Miscanthus Rhizosphere | VTSAIELAERAVAAADGDGVEAVVQAEHSGFARFAGSEVHQPTLIENEVV |
| Ga0097621_1009941602 | 3300006237 | Miscanthus Rhizosphere | VSALDLAARALRAAEGDEAQALVQSERSGMARFAGSEVHQP |
| Ga0066665_108302492 | 3300006796 | Soil | VTSALGLAERAVAAAEGDGVEAVVQTERSGFARFAGSEVHQPTLIENVSISL |
| Ga0066660_101871832 | 3300006800 | Soil | VIDALETAERAVAAAEADEAEAVVLAERSGFARFAA |
| Ga0079221_105708571 | 3300006804 | Agricultural Soil | MSAIDLAERAVAAAEGDGVEAIVQAERSGFARFAGSEVHQPTLIENVSV |
| Ga0079220_114014611 | 3300006806 | Agricultural Soil | VNALELAERALRAAEGDEVQALVQSERSGMARFAGSEVHQPTLIENEVVELQ |
| Ga0075431_1009868772 | 3300006847 | Populus Rhizosphere | VSAHELAEQALRSADGDEALVVVQSERSGLARFAGSEVHQPTLVENDVVEL |
| Ga0079215_103924412 | 3300006894 | Agricultural Soil | VIRGERAQALAERAQRKAQGDEADALVHLEESGFARFAGSEVHQPT |
| Ga0075426_107166952 | 3300006903 | Populus Rhizosphere | VIDALELAETAVAAAEGDAAEAVVQTERSGFARFAGSEVHQPTLIE |
| Ga0075426_111556761 | 3300006903 | Populus Rhizosphere | VSALDLAARALRAAEGDEAQALVQSERSGMARFAGSEVHQPTLIENEVVE |
| Ga0075424_1016397772 | 3300006904 | Populus Rhizosphere | MSESTLELADRALAGAEGDQVEAVVQSERSGFARFADSEVHQPTLIEDAVV |
| Ga0075436_1006619822 | 3300006914 | Populus Rhizosphere | VTEALELAQRALRAAEGDEALVLVNSERSGLARFAGSEVHQPTLIENEVVE |
| Ga0074063_139159941 | 3300006953 | Soil | VSALELAGRALQAVEGDDALALVQTERSGMARFAGSEVHQPTLIE |
| Ga0075435_1009485781 | 3300007076 | Populus Rhizosphere | VSEALELAARLLSAAEGDEALALVHRERSGLARFARSEVHQPTLIEND |
| Ga0066710_1001985461 | 3300009012 | Grasslands Soil | VNGQALDLAERALRSAEGDEAFALVQRERSGMARFAGSEVH |
| Ga0066710_1038998322 | 3300009012 | Grasslands Soil | LSDTLDLAQRALRAAEGDEALALANSERSGLARFAGS |
| Ga0111539_106866712 | 3300009094 | Populus Rhizosphere | MSEALELAQRACGLCEGDQAEAVVQRERSGFARFAASRVHQPTLIDNQLVTLR |
| Ga0105245_113110991 | 3300009098 | Miscanthus Rhizosphere | VTNAIDLAERAVASAEGDGAEAVVQTEHSGFARFAGS |
| Ga0075418_113958051 | 3300009100 | Populus Rhizosphere | VIDALELAETAVAAAEGDAAEAVVQTERSGFARFAGSEVHQPTLIENVTI |
| Ga0066709_1032544282 | 3300009137 | Grasslands Soil | VSRGLELAERAVRAAEGDEAQAIVRRERSGLARYASSEVHQP |
| Ga0105243_110345981 | 3300009148 | Miscanthus Rhizosphere | MRPLELARRALEVAGAHAEVVVNRERWGMARFAASEVHQPTLVEDATLSLRVVRDGKV |
| Ga0105243_113998082 | 3300009148 | Miscanthus Rhizosphere | VTSAIDLAERAVAAAEGDGAEAVVQTEHSGFARFAGSEVHQPTLIENVS |
| Ga0111538_107037821 | 3300009156 | Populus Rhizosphere | VSEALELAGRLLSAAEGDEALALVHRERSGLARFAR |
| Ga0111538_128923051 | 3300009156 | Populus Rhizosphere | MSEALELAQRACGLCEGDQAEAVVQREHSGFARFAASRVHQPTLIDNQLVTLRIVRGDR |
| Ga0075423_129369851 | 3300009162 | Populus Rhizosphere | MSESALELADRALAGAEGDQVEAVVQSERSGFARFADSEVHQPTLIEDAVVQLR |
| Ga0105237_107295081 | 3300009545 | Corn Rhizosphere | VSALELAGKALQAAEGDEALALVQSERSGMARFAGSEVHQPTLIENETVELQVV |
| Ga0126374_106486582 | 3300009792 | Tropical Forest Soil | VSLLELAERALRAAEGDEAQALVQSERSGMARFAGSEVHQPTLIEN |
| Ga0105071_10281552 | 3300009808 | Groundwater Sand | VSEGRALELAERAWRAAEGDAADAFVHVEESGFARFASSEVHQPTLVRDE |
| Ga0105067_10858762 | 3300009812 | Groundwater Sand | VSRALELAERACRAAEGDEADALAHVEESGFARFAGSEVHQPTL |
| Ga0105087_10966861 | 3300009819 | Groundwater Sand | VSRALDLAERAVRTAEGDEADASVHVERSGFARFADSAVHQPTLVR |
| Ga0126313_100203291 | 3300009840 | Serpentine Soil | VSESALELAQRALAAAEGDQSEVVVQSERSGFARFADSEVHQPTLIENAVVQLRV |
| Ga0131077_104759401 | 3300009873 | Wastewater | MNGAGDAALELAEQAWQTADGDAADALVQVERSGLARFAASQVHQ |
| Ga0126309_101082122 | 3300010039 | Serpentine Soil | VSEALELAHRLLGAAEGEQALALVHSERSGMARFARSEVH |
| Ga0126308_101947232 | 3300010040 | Serpentine Soil | VSESALELAQRALAAADGDQAEVVVQSERSGFARFADSEVHQPTLIENAVVQLR |
| Ga0126310_111555782 | 3300010044 | Serpentine Soil | MSALELAERALAAARGDAIEVVVQTERSGFARFAGSEVHQPTLVENESVSVRVVRDR |
| Ga0134070_103662142 | 3300010301 | Grasslands Soil | LSHVLDLAERALKAAEGDEALVLAHSERSGLARFAGSEVHQPTLIEN |
| Ga0134067_101384871 | 3300010321 | Grasslands Soil | VSRGLELAERAVRAAEGDEAQAIVRRERSGLARYASSEVHQPTLVENEVVEL |
| Ga0134067_104304522 | 3300010321 | Grasslands Soil | VKGALELAERAVAAAEGDGVEAVVQAERSGFARFAGSEVHQPTLIE |
| Ga0134084_101092982 | 3300010322 | Grasslands Soil | VSRGLELAERAVRAAEGDEAQAIVRRERSGLARYASSE |
| Ga0134084_104302221 | 3300010322 | Grasslands Soil | VTRALEIAERAVAAADGDGVEAVVQAERSGFARFAGSEVHQPTLIENSSVFLRVI |
| Ga0134062_101981172 | 3300010337 | Grasslands Soil | VTNALELAERAVAAAKGDGVEAVVQAERSGFARFAGSEVHQPTLIENVSVFLR |
| Ga0126377_111295571 | 3300010362 | Tropical Forest Soil | VSETLELAQRACGLCEGDQAEAVVQRERSGFARFAASRVHQPTLIDNQLVTLRIVRGD |
| Ga0105239_117655841 | 3300010375 | Corn Rhizosphere | VSALELAGKALQAAEGDEALALVQSERSGMARFAGSEV |
| Ga0105239_123161791 | 3300010375 | Corn Rhizosphere | VKALDLAGRALRVAEGDEALALVQSERSGMARFAGSE |
| Ga0134126_111714641 | 3300010396 | Terrestrial Soil | VSEALELAGRLLRAAEGDEAFALVQSERSGLARFARSEVHQPTLIENDVLELQ |
| Ga0134122_104335061 | 3300010400 | Terrestrial Soil | VTRALELAEQAIAAVEGDAADAVIQTERSGFARFAGSEVHQPTLIENESISLRV |
| Ga0124844_12198532 | 3300010868 | Tropical Forest Soil | VSHAVELAERALRAVDGDEAEAVVHADRSGLARAASSEVHQPTLIENTTVTV |
| Ga0137348_10085542 | 3300011398 | Soil | LTRAIDLAERAVKAAEGDEADASVHVESSGFARFA |
| Ga0120167_10279673 | 3300012001 | Permafrost | VSLELARRALEAAGGDAEAVVQSERSGFARFADSEVHQPTLVANTVVQLR |
| Ga0137364_110438172 | 3300012198 | Vadose Zone Soil | LSSALDLAERALKAVEGDEALVLVHSERSGLARFAGSEVHQPTLI |
| Ga0137377_118190641 | 3300012211 | Vadose Zone Soil | LSEALELAERALRAAEGDEALAFVSSERSGLARFAGSEVHQPTLIENEVVE |
| Ga0137371_100640311 | 3300012356 | Vadose Zone Soil | LSAAELAQRALQAAEGDEALALVQGERSGMARFAGSEVHQPTLIENEVV |
| Ga0137371_105762422 | 3300012356 | Vadose Zone Soil | VTSAIDLAERAVAAAEGDGAEAVVQTEHSGFARFAGSEVHQPTLIENVSVFLRVIR |
| Ga0157356_10071172 | 3300012474 | Unplanted Soil | VSTLELAQRALRAAEGDEALALVQSERSGMARFAGSEVHQPTLIDN |
| Ga0157320_10089771 | 3300012481 | Arabidopsis Rhizosphere | VSALDLAARALRAAEGDEAQALVQSERSGMARFAGSEVHQPTLIENEVVELQVV |
| Ga0157327_10311601 | 3300012512 | Arabidopsis Rhizosphere | VSALELAERALRAAEGDEALALVQSERSGMARFARSEVHQPTLIENDV |
| Ga0157303_100061151 | 3300012896 | Soil | VSALDLAEQALRSADGDEALVVVQSERSGLARFAGSEVHQPTLVENDV |
| Ga0157299_100852042 | 3300012899 | Soil | VSALDLAEQALRSADGDEALVVVQSERSGLARFAGSE |
| Ga0157296_102654211 | 3300012905 | Soil | VSALELAERALRAAEGDEALALVQSERSGMARFAGSEVHQP |
| Ga0157301_100225952 | 3300012911 | Soil | VSALDLAEQALRSADGDEALVVVQSERSGLARFAGSEVHQP |
| Ga0157302_102297922 | 3300012915 | Soil | VTSALDLAERAVAAAEGDGVDAIVQAERSGFARFAGS |
| Ga0164303_113553992 | 3300012957 | Soil | VKALDLAERALRVAEGDEALALVQSERSGMASFAGSAVHQPTLIETEVVELQVV |
| Ga0164301_112116522 | 3300012960 | Soil | VTSAIDLAERAVARAEGDGAEAVVQTEHSGFARFAGSEVHQPTLIENV |
| Ga0126369_127122101 | 3300012971 | Tropical Forest Soil | VSALELAERALRAAEGDEAQALVQSERSGMARFAGSEVHQPTLIENEVVE |
| Ga0134087_101599071 | 3300012977 | Grasslands Soil | MDALELAQRAVRAAEGDEALALVNRERSGQARFAGSEVHQPTLIENEVIELQ |
| Ga0120179_10261651 | 3300013763 | Permafrost | VSLELARRALEAAGGDAEAVVQSERSGFARFADSEVHQPTLVANT |
| Ga0120123_10199381 | 3300013770 | Permafrost | MSALELAERALEFGRRGDGVEAVVHRELSGLARFAGAE |
| Ga0120173_10540281 | 3300014031 | Permafrost | VSLELARRALEAAGGDAEAVVQSERSGFARFADSEVHQPTLVANTVVQLRI |
| Ga0134081_100405631 | 3300014150 | Grasslands Soil | VTSVLELAERAVAAAEGDGVEAVVQAERSGFARFVG |
| Ga0075314_10294032 | 3300014265 | Natural And Restored Wetlands | VREAPEALELAARAVAAAEGDEVDALAHRERSGLARFAASVV |
| Ga0157379_104319252 | 3300014968 | Switchgrass Rhizosphere | VSALELAGKALQAAEGDEALALVQSERSGMARFAGSEVHQPTLIENETVELQVVR |
| Ga0132258_115293102 | 3300015371 | Arabidopsis Rhizosphere | VSALDLAARALRAAEGDEAQALVQSERSGMARFAGSEVHQPTLIEN |
| Ga0180121_104298142 | 3300017695 | Polar Desert Sand | VSDDAREIASRALRAVDGGDAEAHVLSERSGLARFASSEVHQPTLIENCVV |
| Ga0187774_103739372 | 3300018089 | Tropical Peatland | LSRALELAERALRAAEGDEALALVQREVSGLARFAGSEVHQ |
| Ga0066667_105259382 | 3300018433 | Grasslands Soil | VINALELAERAVAAAEGDGLEAVVQAERSGFARFAGSEVHQPTLIENVSV |
| Ga0184643_10747151 | 3300019255 | Groundwater Sediment | VSESSRALELAERACRATEGDEADALVHAQRSGFARFADSVVHQP |
| Ga0193730_10740841 | 3300020002 | Soil | VTSALELAERAVAAAEGDGVEAVVQAERSGFARFAGSEVHQPTLIE |
| Ga0193719_101543812 | 3300021344 | Soil | VSALELAGKALQAVEGDEALALVQSERSGMARFARSEVHQPTLIENETVELQ |
| Ga0247747_10370362 | 3300022737 | Soil | VSALDLAEQALRSADGDEALVVVQSERSGLARFAGSEVHQPT |
| Ga0247792_10159102 | 3300022880 | Soil | VSALDLAEQALRSADGDEALVVVQSERSGLARFAG |
| Ga0247695_10006881 | 3300024179 | Soil | VSALDLAARALRAVEGDEAQALVQSERSGMARFAGSE |
| Ga0247661_10384081 | 3300024254 | Soil | VSALDLAARALRAAESDEAQALVQSERSGMARFAGSEVH |
| Ga0247670_10432101 | 3300024283 | Soil | VSALDLAARALRAAEGDEAQALVQSERSGMARFAGSEVHQPT |
| Ga0179591_12187254 | 3300024347 | Vadose Zone Soil | VTRALELAERAVAAAEGDAVEAVVQAERSGFARFAGSEVHQPT |
| Ga0207692_102260731 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | VSALDLATRALRAAEGDEAQALVQSERSGMARFAGSEVHQ |
| Ga0207685_100850071 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | VSALDLAARALRAAEGDEAQALVQSERSGMARFAGSEVHQPTLIENEVVELQVVR |
| Ga0207685_101963051 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | VTRALELAERAVAAAEGDAVEAVVQAERSGFARFAGSEVHQPTLIENESV |
| Ga0207654_102559241 | 3300025911 | Corn Rhizosphere | VTSAIELAERAVAAADGDDVEAVVQAEHSGFARFAGSEVHQPTLIENVSV |
| Ga0207671_108682772 | 3300025914 | Corn Rhizosphere | VSALELAGKALQAAEGDEALALVQSERSGMARFAGSEVHQPTLIENETV |
| Ga0207646_102349882 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VTRALELAERAVAAAEGDAVEAVVQAERSGFARFAGSEVHQPTLIENESVFIRVI |
| Ga0207700_106524081 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VSALDLAARALRAAEGDEAQALVQSERSGMARFAGSEVHQPTLIENEVVEL |
| Ga0209350_10898601 | 3300026277 | Grasslands Soil | LSQALDLAERALAAAEGDEAMVLVHSERSGLARFAG |
| Ga0209057_10176093 | 3300026342 | Soil | VTNALELAERAVAAAKGDGVEAVVQAERSGFARFAGSTNRR |
| Ga0209059_13358092 | 3300026527 | Soil | VIDALETAERAVAAAEADEAEAVVLAERSGFARFAGSEVHQPTLVE |
| Ga0209474_106936161 | 3300026550 | Soil | VTDALELAAEAVAAAEGDVAEALVQTERSGFARFAGSEVHQP |
| Ga0209577_108645721 | 3300026552 | Soil | VIDALETAERAVAAAEADEAEAVVLAERSGFARFAGSEVHQPTLVEDVSVSLRLVV |
| Ga0209897_10668642 | 3300027169 | Groundwater Sand | VSRALELAERACRAAEGDEADALAHVEESGFARFAGSEVHQPTLI |
| Ga0209818_11440741 | 3300027637 | Agricultural Soil | VSRALELAERAVRAAEGDEADASVHVERSGFARFADSAVHQPTLIRDES |
| Ga0209177_104214922 | 3300027775 | Agricultural Soil | VSALDLAARALRATEGDEAQALVQSERSGMARFAGSEVHQPTLIENE |
| Ga0209074_103956142 | 3300027787 | Agricultural Soil | VNALDLAERALGVAEGDEALALVQSERSGMARFAGSEVHQPTLIENETVEL |
| Ga0209382_112960801 | 3300027909 | Populus Rhizosphere | MSESALELADRALAGAEGDQVEAVVQSERSGFARFADSEVHQPTLIED |
| Ga0268264_112674352 | 3300028381 | Switchgrass Rhizosphere | VTSAIDLAERAVAAAEGDGAEAVVQTEHSGFARFAGSEVHQPTLIENVSVFLRVI |
| Ga0247822_108818782 | 3300028592 | Soil | VSDALELAQRACGLCEGDQAEAVVQRERSGFARFAASRVHQPTLIDNQLVTLRIVRGDRHGSA |
| Ga0307291_10556301 | 3300028707 | Soil | VTSAIDLAERAVAAAEGDGAEAVVQTEHSGFARFAGSEVHQPTLIENVSVFLRV |
| Ga0307322_101136741 | 3300028710 | Soil | MSERLELAKRALRAAEGDETLALVHHERSGMARFASSEVHQPTLIENDVV |
| Ga0307307_102833161 | 3300028718 | Soil | VTSALELAERAVAAAEGDGVEAVVQAERSGFARFAGSEVHQPTLIENESVFLRVIR |
| Ga0307317_101182081 | 3300028720 | Soil | VSEALELAGRLLRAAEGDEALALVQSERSGLARFAR |
| Ga0307319_102648331 | 3300028722 | Soil | MSELLELAQRALRAAEGDETLALVHHERSGMARFASSEVHQPTLI |
| Ga0307305_100112571 | 3300028807 | Soil | VTSAIDLAERAVAAAEGDGAEAVVQTEHSGFARFAGSEVHQ |
| Ga0307296_100837192 | 3300028819 | Soil | MSEALDLAHHVLGAAEGEQALALVHSERSGMARFARSEVHQPTLIENDVL |
| Ga0307310_106302981 | 3300028824 | Soil | VTSALELAERAVAAAEGDGVEAVVQAERSGFARFAG |
| Ga0307300_100617451 | 3300028880 | Soil | MSEALDLAHHVLGAAEGEQALALVHSERSGMARFARSEVHQ |
| Ga0307300_103511571 | 3300028880 | Soil | VSALELAGKALQAVEGDEALALVQSERSGMARFAGSEVHQPTLIENEVVELQI |
| Ga0307304_101289782 | 3300028885 | Soil | VSETLELAHRLLGAAEGEQALALVHSERSGMARFACSE |
| Ga0299907_105462161 | 3300030006 | Soil | VREAPEALELAARAVRAAEGDGVDALVHRERSGLARFAASVVHQPT |
| Ga0268386_102511532 | 3300030619 | Soil | VREAPEALELATRAVAAAEGDEVDALVHRERSGLARFAASVVHQP |
| Ga0308197_102775022 | 3300031093 | Soil | VTRALELAEQAIAAAEGDAAEAVIQTERSGFARFAGSEVHQPTLIEN |
| Ga0299914_105008881 | 3300031228 | Soil | VREAPEALELAARAVRAAEGDEVDALVHRERSGLARFAASVV |
| Ga0299913_100593353 | 3300031229 | Soil | VREAPEALELAARAVAAAEGDEVDALAHRERSGLARFAASVVHQ |
| Ga0307473_115032872 | 3300031820 | Hardwood Forest Soil | VSEGLELAERAVRAAEGDEAQAIVRRERSGLARYAASEVHQPT |
| Ga0308175_1012311541 | 3300031938 | Soil | MTSLDLAAEALRFAEADEADVFVHRERSGLARFATSVQHQPTLIENQVVTLRV |
| Ga0308175_1024435852 | 3300031938 | Soil | VTRALELAERAVAAADGDGVEAVVQAEHSGFARFAGSEVHQPTLI |
| Ga0308174_119587822 | 3300031939 | Soil | VSEALELAGRLLGAAEGEEALAIVHSERSGLARFARSEV |
| Ga0308176_109753021 | 3300031996 | Soil | VSEGLELAQRALAALDGDEADVLVEAERSGLARFASSRVHQPTLIENAVVTVR |
| Ga0310897_102283791 | 3300032003 | Soil | VTSAIELAERAVAAADGDGVEAVVQAEHSGFARFAGSEV |
| Ga0310906_111349561 | 3300032013 | Soil | VTSDGRALELADRAWRAAEADEADAVVQVEESGFARFAGSEVHQPTLIS |
| Ga0326721_111457061 | 3300032080 | Soil | VTSDGRALELAERAWRAAEADEADAVAQLEESGFARFAASEVHQPTLI |
| Ga0310895_102765972 | 3300032122 | Soil | VSRALDLAERAVRASEGDEADASVHVERSGFARFAASAVHQPTLIRDESVT |
| Ga0307415_1008757491 | 3300032126 | Rhizosphere | VSALDLAERALRAAEGDEAVALVQSERSGMARFARSEVHQPSLIET |
| Ga0334722_102675911 | 3300033233 | Sediment | MSRALELAEQALKLAEGDESDAVARTERSGLARFAGSEVHQPTLIADEGVT |
| Ga0310810_103065343 | 3300033412 | Soil | VSALDLAEQALGSADGDEALVVVQSERSGLARFAGSE |
| Ga0310810_112062262 | 3300033412 | Soil | MDALELAQRAVSVAEADETLALVNRERSGQARFAGSEVHQPTL |
| Ga0247830_106876171 | 3300033551 | Soil | VSDALELAQRACGLCEGDQAEAVVQRERSGFARFAASRVHQPT |
| Ga0247830_107935631 | 3300033551 | Soil | VSEALELAGRLLRVTEGDGALALVLSERSGLARFARSEVHQPTLIEHV |
| Ga0326723_0145401_876_1040 | 3300034090 | Peat Soil | LSAVLELAERALRAAEGDEALAIVQRELSGMARYACSEVHQPTLIENEVVELQVV |
| Ga0373959_0146180_449_595 | 3300034820 | Rhizosphere Soil | MSDGRALELADRAWRAAEADEADAVVQVEESGFARFAGSEVHQPTLISD |
| ⦗Top⦘ |