Basic Information | |
---|---|
Family ID | F035372 |
Family Type | Metagenome |
Number of Sequences | 172 |
Average Sequence Length | 43 residues |
Representative Sequence | LEHDDELDAAGFEPSSDLHHFAEARMEPVADAGFSRLFVGTM |
Number of Associated Samples | 142 |
Number of Associated Scaffolds | 172 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 73.96 % |
% of genes near scaffold ends (potentially truncated) | 39.53 % |
% of genes from short scaffolds (< 2000 bps) | 77.33 % |
Associated GOLD sequencing projects | 132 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.20 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (66.279 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (21.512 % of family members) |
Environment Ontology (ENVO) | Unclassified (22.674 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.907 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.20 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 172 Family Scaffolds |
---|---|---|
PF00589 | Phage_integrase | 26.16 |
PF00239 | Resolvase | 20.93 |
PF13408 | Zn_ribbon_recom | 16.28 |
PF13495 | Phage_int_SAM_4 | 8.14 |
PF07508 | Recombinase | 5.81 |
PF11171 | DUF2958 | 0.58 |
PF02554 | CstA | 0.58 |
PF07592 | DDE_Tnp_ISAZ013 | 0.58 |
PF00561 | Abhydrolase_1 | 0.58 |
COG ID | Name | Functional Category | % Frequency in 172 Family Scaffolds |
---|---|---|---|
COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 26.74 |
COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 20.93 |
COG1966 | Carbon starvation protein CstA (peptide/pyruvate transporter) | Energy production and conversion [C] | 0.58 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 66.28 % |
Unclassified | root | N/A | 33.72 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2040502001|FACENC_GAMC6GA01B7QQR | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 502 | Open in IMG/M |
3300000550|F24TB_11219557 | Not Available | 1222 | Open in IMG/M |
3300000955|JGI1027J12803_103404568 | Not Available | 983 | Open in IMG/M |
3300001171|JGI12685J13342_100844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium tianshanense | 734 | Open in IMG/M |
3300001471|JGI12712J15308_10009465 | Not Available | 2647 | Open in IMG/M |
3300003218|JGI26339J46600_10042630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium tianshanense | 1240 | Open in IMG/M |
3300003219|JGI26341J46601_10026902 | All Organisms → cellular organisms → Bacteria | 1877 | Open in IMG/M |
3300003368|JGI26340J50214_10010312 | All Organisms → cellular organisms → Bacteria | 2962 | Open in IMG/M |
3300003505|JGIcombinedJ51221_10027603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium tianshanense | 2044 | Open in IMG/M |
3300003505|JGIcombinedJ51221_10108208 | Not Available | 1109 | Open in IMG/M |
3300003993|Ga0055468_10122682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium tianshanense | 752 | Open in IMG/M |
3300004080|Ga0062385_11200095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium tianshanense | 519 | Open in IMG/M |
3300005356|Ga0070674_100561516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium → unclassified Novosphingobium → Novosphingobium sp. | 959 | Open in IMG/M |
3300005439|Ga0070711_100046872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2948 | Open in IMG/M |
3300006059|Ga0075017_100266616 | All Organisms → cellular organisms → Bacteria | 1256 | Open in IMG/M |
3300006086|Ga0075019_10644502 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 667 | Open in IMG/M |
3300006162|Ga0075030_100136210 | Not Available | 1990 | Open in IMG/M |
3300006176|Ga0070765_101140123 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
3300006797|Ga0066659_10235294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1362 | Open in IMG/M |
3300009094|Ga0111539_10153454 | Not Available | 2695 | Open in IMG/M |
3300009521|Ga0116222_1036325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2170 | Open in IMG/M |
3300009522|Ga0116218_1030555 | Not Available | 2418 | Open in IMG/M |
3300009645|Ga0116106_1076147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium tianshanense | 1097 | Open in IMG/M |
3300009683|Ga0116224_10046236 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2129 | Open in IMG/M |
3300009683|Ga0116224_10565928 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300009698|Ga0116216_10492875 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
3300009700|Ga0116217_10403304 | Not Available | 868 | Open in IMG/M |
3300009821|Ga0105064_1035932 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
3300010341|Ga0074045_10078777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium tianshanense | 2310 | Open in IMG/M |
3300010341|Ga0074045_10995024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 528 | Open in IMG/M |
3300010343|Ga0074044_10364492 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
3300010343|Ga0074044_10768200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium tianshanense | 629 | Open in IMG/M |
3300010361|Ga0126378_10522392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1302 | Open in IMG/M |
3300011120|Ga0150983_12840275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium tianshanense | 539 | Open in IMG/M |
3300012154|Ga0153953_1013740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium tianshanense | 1944 | Open in IMG/M |
3300012177|Ga0153943_1007609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2926 | Open in IMG/M |
3300012362|Ga0137361_10541173 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
3300012925|Ga0137419_11492032 | Not Available | 572 | Open in IMG/M |
3300012989|Ga0164305_10612627 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
3300014164|Ga0181532_10733561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium tianshanense | 532 | Open in IMG/M |
3300015197|Ga0167638_1046429 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
3300015372|Ga0132256_100090207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2959 | Open in IMG/M |
3300016270|Ga0182036_10072078 | All Organisms → cellular organisms → Bacteria | 2256 | Open in IMG/M |
3300016270|Ga0182036_10403738 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1065 | Open in IMG/M |
3300016341|Ga0182035_10479816 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
3300016422|Ga0182039_10516225 | Not Available | 1034 | Open in IMG/M |
3300017822|Ga0187802_10300767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium → unclassified Novosphingobium → Novosphingobium sp. Rr 2-17 | 625 | Open in IMG/M |
3300017823|Ga0187818_10144123 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
3300017933|Ga0187801_10113817 | Not Available | 1034 | Open in IMG/M |
3300017939|Ga0187775_10128546 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
3300017948|Ga0187847_10900590 | Not Available | 503 | Open in IMG/M |
3300017961|Ga0187778_10931646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium tianshanense | 598 | Open in IMG/M |
3300017966|Ga0187776_10033817 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2853 | Open in IMG/M |
3300017966|Ga0187776_10402412 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
3300017970|Ga0187783_10638035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium tianshanense | 770 | Open in IMG/M |
3300017972|Ga0187781_10671359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium tianshanense | 749 | Open in IMG/M |
3300017972|Ga0187781_10793215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium tianshanense | 687 | Open in IMG/M |
3300017974|Ga0187777_10269884 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
3300017974|Ga0187777_10634899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium tianshanense | 754 | Open in IMG/M |
3300017975|Ga0187782_10974828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium tianshanense | 659 | Open in IMG/M |
3300017999|Ga0187767_10300869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium tianshanense | 547 | Open in IMG/M |
3300018026|Ga0187857_10073967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1693 | Open in IMG/M |
3300018029|Ga0187787_10055279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1182 | Open in IMG/M |
3300018034|Ga0187863_10873229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium tianshanense | 511 | Open in IMG/M |
3300018058|Ga0187766_10057507 | Not Available | 2297 | Open in IMG/M |
3300018058|Ga0187766_10635330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium tianshanense | 732 | Open in IMG/M |
3300018060|Ga0187765_10355324 | Not Available | 893 | Open in IMG/M |
3300018062|Ga0187784_10865900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium tianshanense | 720 | Open in IMG/M |
3300018074|Ga0184640_10229536 | Not Available | 841 | Open in IMG/M |
3300018078|Ga0184612_10034655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 2616 | Open in IMG/M |
3300018085|Ga0187772_10448396 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
3300018086|Ga0187769_10191891 | Not Available | 1509 | Open in IMG/M |
3300018086|Ga0187769_11005133 | Not Available | 631 | Open in IMG/M |
3300018086|Ga0187769_11078930 | Not Available | 608 | Open in IMG/M |
3300018086|Ga0187769_11452986 | Not Available | 519 | Open in IMG/M |
3300018090|Ga0187770_11055405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium tianshanense | 655 | Open in IMG/M |
3300020580|Ga0210403_10259632 | All Organisms → cellular organisms → Bacteria | 1425 | Open in IMG/M |
3300020581|Ga0210399_10100947 | Not Available | 2360 | Open in IMG/M |
3300020581|Ga0210399_10438463 | Not Available | 1088 | Open in IMG/M |
3300020582|Ga0210395_10957180 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 635 | Open in IMG/M |
3300020583|Ga0210401_10852824 | Not Available | 770 | Open in IMG/M |
3300021088|Ga0210404_10268419 | Not Available | 932 | Open in IMG/M |
3300021088|Ga0210404_10673378 | Not Available | 589 | Open in IMG/M |
3300021180|Ga0210396_10262695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium tianshanense | 1533 | Open in IMG/M |
3300021361|Ga0213872_10034015 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2334 | Open in IMG/M |
3300021372|Ga0213877_10022212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1715 | Open in IMG/M |
3300021372|Ga0213877_10109201 | Not Available | 847 | Open in IMG/M |
3300021372|Ga0213877_10351492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium tianshanense | 508 | Open in IMG/M |
3300021405|Ga0210387_10241437 | Not Available | 1578 | Open in IMG/M |
3300021405|Ga0210387_10906853 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
3300021407|Ga0210383_10593254 | Not Available | 955 | Open in IMG/M |
3300021444|Ga0213878_10030504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2040 | Open in IMG/M |
3300021444|Ga0213878_10057498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1528 | Open in IMG/M |
3300021444|Ga0213878_10170533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium tianshanense | 908 | Open in IMG/M |
3300021444|Ga0213878_10401012 | Not Available | 597 | Open in IMG/M |
3300021474|Ga0210390_10959664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium tianshanense | 701 | Open in IMG/M |
3300021475|Ga0210392_10629021 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
3300021478|Ga0210402_10860752 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
3300021559|Ga0210409_11654319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium tianshanense | 516 | Open in IMG/M |
3300025960|Ga0207651_11274580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 660 | Open in IMG/M |
3300026824|Ga0207723_101949 | Not Available | 1806 | Open in IMG/M |
3300027090|Ga0208604_1019147 | Not Available | 650 | Open in IMG/M |
3300027313|Ga0207780_1083601 | Not Available | 535 | Open in IMG/M |
3300027371|Ga0209418_1001258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2797 | Open in IMG/M |
3300027384|Ga0209854_1106034 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300027583|Ga0209527_1128345 | Not Available | 565 | Open in IMG/M |
3300027635|Ga0209625_1009691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2088 | Open in IMG/M |
3300027696|Ga0208696_1018701 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2642 | Open in IMG/M |
3300027795|Ga0209139_10239524 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300027842|Ga0209580_10027360 | Not Available | 2575 | Open in IMG/M |
3300027842|Ga0209580_10406309 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
3300027889|Ga0209380_10028343 | Not Available | 3158 | Open in IMG/M |
3300027898|Ga0209067_10341955 | Not Available | 829 | Open in IMG/M |
3300027915|Ga0209069_10209722 | Not Available | 997 | Open in IMG/M |
3300028906|Ga0308309_11521201 | Not Available | 571 | Open in IMG/M |
3300030706|Ga0310039_10024649 | Not Available | 2855 | Open in IMG/M |
3300031231|Ga0170824_126145557 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
3300031446|Ga0170820_16314339 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 652 | Open in IMG/M |
3300031474|Ga0170818_111917718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 701 | Open in IMG/M |
3300031544|Ga0318534_10400291 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 788 | Open in IMG/M |
3300031564|Ga0318573_10042244 | Not Available | 2190 | Open in IMG/M |
3300031564|Ga0318573_10558348 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
3300031679|Ga0318561_10172361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium tianshanense | 1168 | Open in IMG/M |
3300031682|Ga0318560_10178602 | Not Available | 1130 | Open in IMG/M |
3300031715|Ga0307476_10199821 | Not Available | 1451 | Open in IMG/M |
3300031715|Ga0307476_10373983 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
3300031719|Ga0306917_11452486 | Not Available | 528 | Open in IMG/M |
3300031740|Ga0307468_100079709 | Not Available | 1860 | Open in IMG/M |
3300031744|Ga0306918_11498162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium tianshanense | 516 | Open in IMG/M |
3300031764|Ga0318535_10139786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium huanghuaihaiense | 1076 | Open in IMG/M |
3300031764|Ga0318535_10572774 | Not Available | 500 | Open in IMG/M |
3300031781|Ga0318547_10425540 | Not Available | 816 | Open in IMG/M |
3300031798|Ga0318523_10642457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium tianshanense | 522 | Open in IMG/M |
3300031819|Ga0318568_10353592 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
3300031880|Ga0318544_10019290 | All Organisms → cellular organisms → Bacteria | 2270 | Open in IMG/M |
3300031897|Ga0318520_10344337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium tianshanense | 904 | Open in IMG/M |
3300031910|Ga0306923_10774722 | All Organisms → cellular organisms → Bacteria | 1061 | Open in IMG/M |
3300031912|Ga0306921_10607413 | All Organisms → cellular organisms → Bacteria | 1264 | Open in IMG/M |
3300031954|Ga0306926_10206397 | Not Available | 2438 | Open in IMG/M |
3300031954|Ga0306926_11640803 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 736 | Open in IMG/M |
3300032025|Ga0318507_10016433 | Not Available | 2550 | Open in IMG/M |
3300032025|Ga0318507_10249074 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 771 | Open in IMG/M |
3300032042|Ga0318545_10108588 | Not Available | 975 | Open in IMG/M |
3300032043|Ga0318556_10215463 | Not Available | 1000 | Open in IMG/M |
3300032044|Ga0318558_10034531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium tianshanense | 2156 | Open in IMG/M |
3300032051|Ga0318532_10022256 | Not Available | 2055 | Open in IMG/M |
3300032059|Ga0318533_10424817 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
3300032063|Ga0318504_10178861 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
3300032063|Ga0318504_10334312 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
3300032076|Ga0306924_10156575 | Not Available | 2609 | Open in IMG/M |
3300032091|Ga0318577_10259841 | Not Available | 831 | Open in IMG/M |
3300032160|Ga0311301_12152116 | Not Available | 643 | Open in IMG/M |
3300032205|Ga0307472_101320545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 695 | Open in IMG/M |
3300032261|Ga0306920_100938268 | All Organisms → cellular organisms → Bacteria | 1263 | Open in IMG/M |
3300032770|Ga0335085_10050525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5624 | Open in IMG/M |
3300032770|Ga0335085_10330900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1792 | Open in IMG/M |
3300032783|Ga0335079_10069655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4006 | Open in IMG/M |
3300032828|Ga0335080_11089651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium tianshanense | 809 | Open in IMG/M |
3300032895|Ga0335074_10208665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2366 | Open in IMG/M |
3300032896|Ga0335075_10087404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4144 | Open in IMG/M |
3300032897|Ga0335071_10209636 | All Organisms → cellular organisms → Bacteria | 1902 | Open in IMG/M |
3300032898|Ga0335072_10499480 | All Organisms → cellular organisms → Bacteria | 1261 | Open in IMG/M |
3300032955|Ga0335076_10248494 | Not Available | 1673 | Open in IMG/M |
3300033004|Ga0335084_11631015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium tianshanense | 635 | Open in IMG/M |
3300033004|Ga0335084_11912037 | Not Available | 579 | Open in IMG/M |
3300033134|Ga0335073_10712368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1095 | Open in IMG/M |
3300033805|Ga0314864_0006929 | All Organisms → cellular organisms → Bacteria | 2125 | Open in IMG/M |
3300033808|Ga0314867_063519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium tianshanense | 861 | Open in IMG/M |
3300034090|Ga0326723_0065406 | All Organisms → cellular organisms → Bacteria | 1549 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.51% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 13.37% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.56% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 7.56% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.23% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.23% |
Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 4.07% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.33% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 2.33% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.91% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.91% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.74% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.74% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.74% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.74% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.16% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.16% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.16% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.16% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.16% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.16% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.16% |
Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 1.16% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.58% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.58% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.58% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.58% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.58% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.58% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.58% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.58% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.58% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.58% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.58% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.58% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.58% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.58% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.58% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2040502001 | Soil microbial communities from sample at FACE Site 2 North Carolina CO2+ | Environmental | Open in IMG/M |
3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001171 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 | Environmental | Open in IMG/M |
3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
3300003218 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 | Environmental | Open in IMG/M |
3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
3300003993 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300009821 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300012154 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ037 MetaG | Host-Associated | Open in IMG/M |
3300012177 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ027 MetaG | Host-Associated | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
3300015197 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6B, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Host-Associated | Open in IMG/M |
3300021372 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01 | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026824 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 27 (SPAdes) | Environmental | Open in IMG/M |
3300027090 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF016 (SPAdes) | Environmental | Open in IMG/M |
3300027313 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 45 (SPAdes) | Environmental | Open in IMG/M |
3300027371 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027384 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_30_40 (SPAdes) | Environmental | Open in IMG/M |
3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033805 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10 | Environmental | Open in IMG/M |
3300033808 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_20 | Environmental | Open in IMG/M |
3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FACENCE_3404000 | 2040502001 | Soil | CRQARERAVGLEHNDELHAAAFEPPSYLHHFAEARMIAVGDPGFSWLFVGSMSLF |
F24TB_112195572 | 3300000550 | Soil | AVGLEHDELDAAAFEPQSDLHHFAKARMVTVGDPGFSWLFVGSMSPF* |
JGI1027J12803_1034045683 | 3300000955 | Soil | LEHDYELDAAGFEPSSDLHHFAEARMEPVADAGFGRLFVGIM* |
JGI12685J13342_1008441 | 3300001171 | Forest Soil | LEHDDELDAAGFEPSSDLHHFAKARMEPIADVGISRLFVGTM* |
JGI12712J15308_100094653 | 3300001471 | Forest Soil | LEYDDELDAAGFEPSSDLHHFAEARMEPVADASFGRLFVGTM* |
JGI26339J46600_100426301 | 3300003218 | Bog Forest Soil | LKNDDELDAAAFEPSPDLHHFAEARVEPVADTSFSRLFVGTM* |
JGI26341J46601_100269022 | 3300003219 | Bog Forest Soil | LEHDDELDAAGFEPSSDLHHFAKARMEPVADAGFSRLFVGTM* |
JGI26340J50214_100103123 | 3300003368 | Bog Forest Soil | LEHDDELDAAGFEPSSDLHHFAEARMEPVADAGFSRLFVGTM* |
JGIcombinedJ51221_100276031 | 3300003505 | Forest Soil | LKNDDELDAAAFEPSPDLHHFAKARMEPVADARISRLFVGTM* |
JGIcombinedJ51221_101082083 | 3300003505 | Forest Soil | LEHDDQLDAAGFEPSSDLHHFAKARMEPVADAGFSPLFVGTM* |
Ga0055468_101226822 | 3300003993 | Natural And Restored Wetlands | LVHDNELEATTFEPPSDLHHFAKARMKPVGDTGFSWLFVGSMSPFRAAPG* |
Ga0062385_112000952 | 3300004080 | Bog Forest Soil | LKNDDELDAAAFEPSPDLHHFAEAWVEPVADTSFSRLFVGTM* |
Ga0070674_1005615163 | 3300005356 | Miscanthus Rhizosphere | LEHDDELDAAAFESPSDLHHFAEARMIAVGDPGFSRLFVGSMSLF* |
Ga0070711_1000468725 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | LEQDDEFDAAGFEPASDLHHFAEARMEPVADAGFSRLFVGTM* |
Ga0075017_1002666163 | 3300006059 | Watersheds | LEYDDELDAAAFEPPSDLHHFAKARMEPVADTGFSWLFVGSMSPFRT |
Ga0075019_106445022 | 3300006086 | Watersheds | LEHDDELDAAGFEPSSDLHHFAEARMEPVADAGFGRLFVGTM* |
Ga0075030_1001362102 | 3300006162 | Watersheds | LKNDDELDAAAFEPSPDLHHFAEARVEPVADMSFSRLFVGTM* |
Ga0070765_1011401232 | 3300006176 | Soil | LEHDDELDAAGFEPSSDLHHFAKARMEPVADAGFSPLFVGTM* |
Ga0066659_102352941 | 3300006797 | Soil | LKHDDELDASAFEPPSDLHHSAKARMEPVGDTGFIWLFV |
Ga0111539_101534542 | 3300009094 | Populus Rhizosphere | AAAFEPPSDLHHFAETRMIAVGDPGFSWLFVGSMSPF* |
Ga0116222_10363254 | 3300009521 | Peatlands Soil | LEHDDKLDAAGFEPSSDLHHFATARMEPVADAGFSPLFVGTM* |
Ga0116218_10305552 | 3300009522 | Peatlands Soil | LEHDDKLDAAGFEPSSDLHHFAEARMEPVADAGFGRLFVGTM* |
Ga0116106_10761471 | 3300009645 | Peatland | LKNDDEPDAAAFEPSPDLHHFAEARVEPVADKSFGRLFVGTM* |
Ga0116224_100462361 | 3300009683 | Peatlands Soil | LKNDDELDAAAFEPSPDLHHFAEARVEPVADTSFSRLF |
Ga0116224_105659282 | 3300009683 | Peatlands Soil | LEHDDELDAAGFEPSADLHHFAKARMEPVADAGFSRLFVGTM* |
Ga0116216_104928751 | 3300009698 | Peatlands Soil | LEYDDELEAAAFEPPSDLHHFAKARMEPVGDTGFSSLF |
Ga0116217_104033041 | 3300009700 | Peatlands Soil | LEHDDELDAGGFEPSPDLHHFAEARMEPVADAGFGRLFVGTM* |
Ga0105064_10359321 | 3300009821 | Groundwater Sand | FEPPSDLHHFAEARMIAVGDPSFSRLFVGSMSVF* |
Ga0074045_100787774 | 3300010341 | Bog Forest Soil | LKNDHALDAAAFEPSPDLHHFAEARVESVADAGFGRLFVGTM* |
Ga0074045_109950241 | 3300010341 | Bog Forest Soil | AGECTVGLEQNDELNAAPFEPSPDLHHFAEARMEPVADASLSRLFVGSI* |
Ga0074044_103644921 | 3300010343 | Bog Forest Soil | LEHDDELDAAGFEPSSDLHHFAEARMEPVADTGLRRLFVGTM* |
Ga0074044_107682002 | 3300010343 | Bog Forest Soil | LKNDDELDAAAFEPSPDLHHFAEARVESVADAGFGRLFVGTM* |
Ga0126378_105223922 | 3300010361 | Tropical Forest Soil | LEHDDELDAAGAETAPDLHHFAETRMEPVADTGLSRLFVGTM* |
Ga0150983_128402754 | 3300011120 | Forest Soil | LKNDDELDAAAFEPSPDLHHFAEARVEPVADTSFSRLFV |
Ga0153953_10137403 | 3300012154 | Attine Ant Fungus Gardens | LEHDDELDAAGFEPSSDLHHFAKARMESIADVGISRLFVGTM* |
Ga0153943_10076094 | 3300012177 | Attine Ant Fungus Gardens | LEHDDELDAAGFEPSSDLHHFAKARMESIADVGISWLFVGTM* |
Ga0137361_105411731 | 3300012362 | Vadose Zone Soil | LDQDDEFAAAAFEPPSDLHQFAKARMEPVGDMSFFWLFAGSMSPFC* |
Ga0137419_114920321 | 3300012925 | Vadose Zone Soil | LEHHDKLEAAAFEPASDLHHFAKARMEPVADTGFNWLFVGSMS |
Ga0164305_106126271 | 3300012989 | Soil | LEHDDKLEAAAFEPPSDLHHFAKARMESVGDTCLSWLFVGSMSP |
Ga0181532_107335613 | 3300014164 | Bog | LKNDDELDAAVFEPSPDLHHFAEARVEPVADTSLSRLFVGTM* |
Ga0167638_10464291 | 3300015197 | Glacier Forefield Soil | LEHDDELEAAAFEPPSDLHHFAKARMEPVGDTGFSWLFVGSMSPFRANLESL* |
Ga0132256_1000902072 | 3300015372 | Arabidopsis Rhizosphere | LEHDDELEAAAFEPPSDLHHFAKARMEPVGDTGFS* |
Ga0182036_100720782 | 3300016270 | Soil | LEHDDELHAAGFEPSSNLHHFAEARMEPVADAGISRPFVGTM |
Ga0182036_104037382 | 3300016270 | Soil | LEHDDELEAAASEPPSDLHHFAKARMKPVGDTGFGSLFVGSMSPFRAVTGL |
Ga0182035_104798163 | 3300016341 | Soil | LKYDDELDAAAFEPPSDLYHFAKARMESVTDTGFSWLFVGSMSPFREAPG |
Ga0182032_108713361 | 3300016357 | Soil | LKHDDERDASAFEPPSDLHHFAKARMEPVRDTGFSWLFVGSMSPFRAGLGSREYQC |
Ga0182039_105162252 | 3300016422 | Soil | HAAGFEPSSDLHNFAEARMEPVADAGISRPFVGTM |
Ga0187802_103007673 | 3300017822 | Freshwater Sediment | LEYDNELDAAAFEPPSDLHHFAKARVISIGDPGFSWLFVGSMSPFRAKAGPL |
Ga0187818_101441231 | 3300017823 | Freshwater Sediment | LEHDDELDAAGFEPSSDLHHFAKARMEPVADAGFSRLFVGTM |
Ga0187801_101138171 | 3300017933 | Freshwater Sediment | LEHDDEPDAAGFEPSSDLHHFAEARVEPVADTSFSRLFVGTM |
Ga0187775_101285462 | 3300017939 | Tropical Peatland | LEHDDELDAAGFEPSSDLHHFAEARMEPVADAGISRLFVGTM |
Ga0187847_109005902 | 3300017948 | Peatland | LKNDDELDAAGFEPSPDLHHFAEARMEPVDDTSFSRLFVGTM |
Ga0187778_109316462 | 3300017961 | Tropical Peatland | LEHDDKLDAAGFEPSPDLHHFAEARMEPVADTSFSRLFVGTM |
Ga0187776_100338172 | 3300017966 | Tropical Peatland | LEHDDELEAAAFEPPSDLDHFAEARMEPVADTGFSRLFVGTM |
Ga0187776_104024121 | 3300017966 | Tropical Peatland | LEDDDELDAAAFEPPSDLHNFAKARMVTVGDPAFSRLFV |
Ga0187776_110570651 | 3300017966 | Tropical Peatland | LEYDNELDASAGEPPSDLHNFAKAGMKTVGDPGFSRLFAGSMSQLRAKLESPGYRYP |
Ga0187783_106380352 | 3300017970 | Tropical Peatland | LKHDDKLDAAAFKPSPDLHHFAEARVEPVADTSFSRLFVGIM |
Ga0187781_106713593 | 3300017972 | Tropical Peatland | LEHDDELDAAAFEPPPDLHHFAEARMEPVADLSFSRLFVGSI |
Ga0187781_107932152 | 3300017972 | Tropical Peatland | LEHDDELDAAAFQPPPDLRHFAEARMERIADASFSRLFVGAM |
Ga0187777_102698842 | 3300017974 | Tropical Peatland | LEHDDVLNAAGFEPSSDLHHFAEARMEPVADAGISRLFVGIM |
Ga0187777_106348992 | 3300017974 | Tropical Peatland | LEHDDELDAAAFEPSSDLHHFAEARMEPVADTSFSRLFVGTM |
Ga0187782_109748283 | 3300017975 | Tropical Peatland | LEQDDKLDAAALEPSPDLHHFAEARMEPVADAGLSRLFVGTM |
Ga0187767_103008692 | 3300017999 | Tropical Peatland | LEHDDKLDAAGFEPSPDLHHFAEARMEPVADAGISRLFVGTM |
Ga0187857_100739674 | 3300018026 | Peatland | LKNDDEPDAAAFEPSPDLHHFAEARVEPVADTSFSRLFVGTM |
Ga0187787_100552793 | 3300018029 | Tropical Peatland | LEDDNELDAAAFEPPSDLHNFAKARMVTVGDPAFSRLFVGSMSPFREEAGPL |
Ga0187863_108732292 | 3300018034 | Peatland | LKNDDEPDAAAFEPSPDLHHFAEARVEPVADKSFGRLFVGTM |
Ga0187766_100575072 | 3300018058 | Tropical Peatland | LEHDDQLDAAGFEPSSDLHHFAKARMEPVADTSFSRLFVGIM |
Ga0187766_106353303 | 3300018058 | Tropical Peatland | LEHDDELDAAAFEPSSDLHHFTKARMEPVADTGFSRLFVGTM |
Ga0187765_103553243 | 3300018060 | Tropical Peatland | LEHDDELDAADLEPSSDLHHFAEARMEPVADTGFSRLFVGTM |
Ga0187784_108659002 | 3300018062 | Tropical Peatland | LEHDDELDAAAFQPPPDLRHFAEARMERIADASFSRLFVGTM |
Ga0184640_102295361 | 3300018074 | Groundwater Sediment | LEHDDKLQAAAFEPPSDLYYFAKARMEPVGDTGFSWLFVGSMSPFRAKLE |
Ga0184612_100346553 | 3300018078 | Groundwater Sediment | LEHDDELEAAAFAPPSDLHHFAKARMVTVGDPGFSWLFVG |
Ga0187772_104483962 | 3300018085 | Tropical Peatland | LEHDDELDAAAFEPPPDLHHFAEARMEPVADAGLSRLFVGTM |
Ga0187769_101918912 | 3300018086 | Tropical Peatland | ELDAAAFEPPSDLHNFAKARMVTVGDPAFSRLFVGSMSPFRTKAGPL |
Ga0187769_110051332 | 3300018086 | Tropical Peatland | DELDAAGFEPSSDPHHFAEALMEPVADAGISRLFVGTM |
Ga0187769_110789301 | 3300018086 | Tropical Peatland | VGLEHDDKLEAAGFEPSPDLHHFAEARMEPVADTSFSRLFVGTM |
Ga0187769_114529862 | 3300018086 | Tropical Peatland | DELDAAGFEPSSDPHHFADARMEPVADAGISRLFVGTT |
Ga0187770_110554053 | 3300018090 | Tropical Peatland | LEQDDELDTAGLKPSSNLHHFAEARMEPVADASFSRMFVGTMW |
Ga0210403_102596323 | 3300020580 | Soil | LKHDDELDAAGFEPSSDLHHFAEARMEPVADAGFGRLFVGTM |
Ga0210399_101009474 | 3300020581 | Soil | LKNDDELDAAAFEPSPDLHHFAEARVEPVADTSFSRLFVGTM |
Ga0210399_104384631 | 3300020581 | Soil | LKHDDELDAAAFEPPSDLYHFAKARMESVTDTGFSWL |
Ga0210395_109571803 | 3300020582 | Soil | LEHNDELNAAAFEPPSNLHYFTKARMEPVGDTGFSWLFVGGMSPFRTVSA |
Ga0210401_108528242 | 3300020583 | Soil | DELDAAAFEPSPDLHHFAEARVEPVADTSFSRLFVGTM |
Ga0210404_102684192 | 3300021088 | Soil | ELDAAAFEPSPDLHHFAEARVEPVADTSFSRLFVGTM |
Ga0210404_106733783 | 3300021088 | Soil | LKHDDELDAAAFEPPSDLYHFAKARMESVTDTGFSWLFVGSMSPFREAPG |
Ga0210396_102626954 | 3300021180 | Soil | LKNDDELDAAAFEPSPDLHHFAKARMEPVADARISRLFVGTM |
Ga0213872_100340153 | 3300021361 | Rhizosphere | LEHDDELDAAPFEPSPDLHHFAEAGMEPVADTSLSRLFVGTM |
Ga0213877_100222122 | 3300021372 | Bulk Soil | LQQDDELDAAGLKPSSDLHHFAEARMEPVADASFSRLFVGTM |
Ga0213877_101092012 | 3300021372 | Bulk Soil | LEHDDKLDAASFEPSPDLHQFAEAWMEPVADMSFSRLFVGTM |
Ga0213877_103514921 | 3300021372 | Bulk Soil | LEHDDELDATAVEPSSDLHHFAEARMEPVADTGFSRLFVGTM |
Ga0210387_102414373 | 3300021405 | Soil | LEHDDKLEAAAFEPPSDLHHFAKARMKPVGDTGFSWLFVGSMSPFRAAA |
Ga0210387_109068532 | 3300021405 | Soil | EHDDKLDAAAFEPSSDLHHFAEARMEPVAETGFSRLFVGTM |
Ga0210383_105932542 | 3300021407 | Soil | LEHDDELAAGGFEPSPDLHHFAEARMEPVADAGFGRLFVGTM |
Ga0213878_100305042 | 3300021444 | Bulk Soil | LGHDDELDAAPFEPSPDLHHFAEAGMEPVADTSFSRLFVGTM |
Ga0213878_100574981 | 3300021444 | Bulk Soil | LEDHNELDAAASEPPSDLHNFAKARMVTVGDPAFSRLFVGSMSPFRAKLESRVY |
Ga0213878_101705331 | 3300021444 | Bulk Soil | LEHDDKLDAAGFEPSSDLHHFAEARMEPVPDAGFSRLFVGTM |
Ga0213878_104010121 | 3300021444 | Bulk Soil | KLDAAGFEPSSDLHHFAEARMEPVPDAGFSRLFVGTM |
Ga0210390_109596642 | 3300021474 | Soil | LEHDDQLDAAGFEPSSDLHHFAKARMEPVADAGFSPLFVGTM |
Ga0210392_106290213 | 3300021475 | Soil | LEHDDELDAGGFEPSPDLHHRAEARMEPVADAGFGRLFVGTM |
Ga0210402_108607523 | 3300021478 | Soil | LEHNDELNAAAFEPPSNLHYFTKARMEPVGDTGFSWLFVGSMSPFRK |
Ga0210409_116543191 | 3300021559 | Soil | LKNDDELDAAVFEPSPDLHHFAEARVEPVADTSFSRLFVGTM |
Ga0207651_112745801 | 3300025960 | Switchgrass Rhizosphere | AAAFESPSDLHHFAEARMIAVGDPGFSRLFVGSMSLF |
Ga0207723_1019491 | 3300026824 | Tropical Forest Soil | LEHDDELEAAASEPPSDLHHFAKARMKPVGDTGFGSLFVGS |
Ga0208604_10191472 | 3300027090 | Forest Soil | LEHDDQLDAAAFEPSSDLHHFAKARMEPVADAGFSPLFVGTM |
Ga0207780_10836011 | 3300027313 | Tropical Forest Soil | LEHDDELDAAGFEPSSDLHHFAKARMEPVADAGISRLFVGTM |
Ga0209418_10012584 | 3300027371 | Forest Soil | LEHDDELDAAGFEPSSDLHHFAKARMEPIADVGISRLFVGTM |
Ga0209854_11060341 | 3300027384 | Groundwater Sand | GLEHDDELDAAAFEPPSDLHHFAKARMIAVGDPSFSRLFVGSMSPF |
Ga0209527_11283453 | 3300027583 | Forest Soil | LEYDDELDAAGFEPSSDLHHFAEARMEPVADASFGRLFVG |
Ga0209625_10096913 | 3300027635 | Forest Soil | LEYDDELDAAGFEPSSDLHHFAEARMEPVADASFGRLFVGTM |
Ga0208696_10187012 | 3300027696 | Peatlands Soil | LEHDDKLDAAGFEPSSDLHHFATARMEPVADAGFSPLFVGTM |
Ga0209139_102395243 | 3300027795 | Bog Forest Soil | LEHDDELDAAAFEPPSDLHHFAKARMEPVGDTGFSWLFVGSMSPFRTRPGSPE |
Ga0209580_100273601 | 3300027842 | Surface Soil | LEHDDELDAAAFEPPSNLYHFAKARMEAVGDTRFSWLFVGSMSPFRK |
Ga0209580_104063094 | 3300027842 | Surface Soil | ELDAAAFEPPSNLYHFAKARMEAVGDTRFSWLFVGSMSPFRKDTS |
Ga0209380_100283432 | 3300027889 | Soil | LKNDDELDAAAFEPSPDLHHFAKARMEPVTDARISRLFVGTM |
Ga0209067_103419552 | 3300027898 | Watersheds | ELDAAGFEPSSDLHHFAKARMEPVADAGFSRLFVGTM |
Ga0209069_102097221 | 3300027915 | Watersheds | LEHDDQLDAAGFEPSSDLHHFAKARMEPVADAGFSPLLLGSMS |
Ga0308309_115212011 | 3300028906 | Soil | DELDAAAFEPSPDLHHFAKARMEPVTDARISRLFVGTM |
Ga0310039_100246494 | 3300030706 | Peatlands Soil | LEHDDKLDAAGFEPSSDLHHFAEARMEPVADAGISRLFVGTM |
Ga0170824_1261455572 | 3300031231 | Forest Soil | LEHDDELDAAGFEPSSDLHHFAEARMEPVADAGFGRLFVGIM |
Ga0170820_163143392 | 3300031446 | Forest Soil | LKHDDELDAAGFEPSSDLHHFAEARMEPVADAGFGRLFVGIM |
Ga0170818_1119177182 | 3300031474 | Forest Soil | LEHDDELDAAGFEPSSDLHHFAEARMEPVADAGFGRLFVGTM |
Ga0318534_104002913 | 3300031544 | Soil | LEHDDELHAAGFEPSSDLHNFAEARMEPVADAGISRPFVGTM |
Ga0318573_100422441 | 3300031564 | Soil | LEHDDELHAAGFEPSSNLHHFAEARMEPVADAGISLPFVGTM |
Ga0318573_105583481 | 3300031564 | Soil | HAAGFEPSSNLHHFAEARMEPVADAGISLPFVGTM |
Ga0318561_101723612 | 3300031679 | Soil | LEHDDELDASGAEPSPDLHHFAEARMEPVADTGLSQLFVGTM |
Ga0318560_101786022 | 3300031682 | Soil | LEHDDELHAAGFEPSSGLHHFAEARMEPVADAGISRPFVGTM |
Ga0307476_101998212 | 3300031715 | Hardwood Forest Soil | LEQDDELDAPGLEPSSDLHHFAEARMEPVADAGFSRLFVGTM |
Ga0307476_103739832 | 3300031715 | Hardwood Forest Soil | LEHDDELDAAGFEPSSDLHHFAKARMESIADVGISRLFVGTM |
Ga0306917_114524862 | 3300031719 | Soil | LEHDDELDAAAFEPPSDLYHFAKARMESVTDTGFSWMFVGSMSPFR |
Ga0307468_1000797091 | 3300031740 | Hardwood Forest Soil | LEHDDEFDTAAFEPPSDPHHFAKARMKPVGDAGFSWLFVGSMSPFRASPGSR |
Ga0306918_114981621 | 3300031744 | Soil | LEHDDELDAASVEPSPDLHHFAEARMEPVADTGLSRLFVGTM |
Ga0318535_101397862 | 3300031764 | Soil | LNAAGFEPSSDLHHFAEARMEPVADAGISRLFVGTM |
Ga0318535_105727742 | 3300031764 | Soil | LEHDDELEAAASEPPSDLHHFAKARMKPVGDTGFGSLFVGSMSPFREALG |
Ga0318547_104255403 | 3300031781 | Soil | LKYDDELDAAAFEPPSDLYHFAKARMESVTDTGFSWLFVGSMSP |
Ga0318523_106424572 | 3300031798 | Soil | LEHDDELDAASVEPSPDLHHFAEARMKPVADPGLNRL |
Ga0318568_103535923 | 3300031819 | Soil | LKYDDELDAAAFEPPSDLYHFAKARMESVTDTGFSWLFVGSMSPFREALGSY |
Ga0318544_100192903 | 3300031880 | Soil | LEHDDELHAAGFEPSSNLHNFAEARMEPVADAGISRPFVGTM |
Ga0318520_103443371 | 3300031897 | Soil | LEHDDELDAASVEPSPDLHHFAEARMEPVADTGFSRLFVGTM |
Ga0306923_107747223 | 3300031910 | Soil | LKYDDELDAAAFEPPSDLYHFAKARMESVTDTGFSWL |
Ga0306921_106074133 | 3300031912 | Soil | LKHDDERDASAFEPPSDLHHFAKARMEPVGDTGFSWLFVGSM |
Ga0306926_102063973 | 3300031954 | Soil | LKHDDERDASAFEPPSDLHHFAKARMEPVRDTGFSWLFVGS |
Ga0306926_116408031 | 3300031954 | Soil | LEHDDELDAAGAETAPDLHHFAETRMEPVADTGLSRLFVGTM |
Ga0318507_100164333 | 3300032025 | Soil | LKYDDELDAAAFEPPSDLYHFAKARMESVTDTGFSWLFVGSMSPFRAKP |
Ga0318507_102490742 | 3300032025 | Soil | LEHDDELHAAGFEPSSGLHHFAEARMEPVADAGISLPFVGTM |
Ga0318545_101085882 | 3300032042 | Soil | AVGLEHDDELHAAGFEPSSGLHHFAEARMEPVADAGISRPFVGTM |
Ga0318556_102154631 | 3300032043 | Soil | ELHAAGFEPSSDLHNFAEARMEPVADAGISRPFVGTM |
Ga0318558_100345313 | 3300032044 | Soil | LEHDDELNAAGFEPSSDLHHFAEARMEPVADAGISRLFLGSM |
Ga0318532_100222561 | 3300032051 | Soil | LEHDDELEAAASEPPSDLHHFAKARMKPVGDTGFGSLFVGSMSPFRAGPES |
Ga0318533_104248173 | 3300032059 | Soil | LKYDDELDAAAFEPPSDLYHFAKARMESVTDTGFSWLFVGRRTRVIM |
Ga0318504_101788611 | 3300032063 | Soil | LKYDDELDAAAFEPPSDLYHFAKARMESVTDTGFSWLFVGSMS |
Ga0318504_103343121 | 3300032063 | Soil | HDDELHAAGFEPSSDLHHFAEARMEPVADAGISRPFVGTM |
Ga0306924_101565753 | 3300032076 | Soil | LEHDDELEAAASEPPSDLHHFAKARMKPVGDTGFGSLFVGSMSPFREA |
Ga0318577_102598412 | 3300032091 | Soil | DDELHAAGFEPSSDLHNFAEARMEPVADAGISRPFVGTM |
Ga0311301_121521162 | 3300032160 | Peatlands Soil | GLEHDDELEAAAFEPPSDLHHFAKARMEPVRDTGFSWLFVGSMSPFRAGPESP |
Ga0307472_1013205452 | 3300032205 | Hardwood Forest Soil | KAAAFEPPSDLHHFAKARMEPVGDTGFSRLFVGSMSPFRAVLG |
Ga0306920_1009382683 | 3300032261 | Soil | LEHDDELDAAAFESPSNLYHFAKARMEAVGDTRFSWLFVGSMSPFRAGVAPLEDCRCGDKSA |
Ga0335085_100505255 | 3300032770 | Soil | LEHDDELEAAAFEPPSDLDHFAEARMEPVADTGFSRIFV |
Ga0335085_103309001 | 3300032770 | Soil | LEHDDELEAAAFEPPSDLDHFAEARMEPVADTGFSRMFVGTM |
Ga0335079_100696552 | 3300032783 | Soil | LEHDDELDAAGFEPSSDLHHLAETRMEPVADAGFSRLFVGTM |
Ga0335080_110896512 | 3300032828 | Soil | LEHDDELDAAAFEPPSDLDHFAEARMEPVADTGFSRLFVGTM |
Ga0335081_101756571 | 3300032892 | Soil | LKHDDELDAAAFEPPADLYHFAKARMESVTDTGFSWLFVGSMSPFRAAAEWSGRRCQTRA |
Ga0335074_102086653 | 3300032895 | Soil | LEHDDELDAAGFEPPPDLHHFAEARMEWVADPSLRRLFVGTM |
Ga0335075_100874046 | 3300032896 | Soil | LEHDDELEAAGFEPSSDLHHFAEARMEPVADAGFSRPFVGTM |
Ga0335071_102096362 | 3300032897 | Soil | LEHDDELEAAAFEPPSDLDHFAEARMEPVADTSFSRLFVGTM |
Ga0335072_104994801 | 3300032898 | Soil | LEHDDELNAAGFEPSSDLHHFAEARMEPVADAGFSRLFVGNM |
Ga0335076_102484943 | 3300032955 | Soil | LEHDDELDAAGFEPSSDLHHFAEARMEPVADAGFSRLFVGTM |
Ga0335084_116310153 | 3300033004 | Soil | LEHDDKLDAAGFEPSPDLHHFAEARMETVADTSFSRLFV |
Ga0335084_119120371 | 3300033004 | Soil | LKHDDELDAAAFEPPADLYHFAKARMESVTDTGFSWLFVRSMSPFLAAPESPAHLYRSP |
Ga0335073_107123681 | 3300033134 | Soil | LNAAGFEPSSDLHHFAEARMEPVADAGFSRLFVGNM |
Ga0314864_0006929_194_322 | 3300033805 | Peatland | LEHDDELDAAGFEASPDLHDFAEARMEPVADPSFSRLFVGTM |
Ga0314867_063519_741_860 | 3300033808 | Peatland | LEQDDKLDAAALEPSPDLHHFAEARMEPVADAGLSRLFVG |
Ga0326723_0065406_1300_1458 | 3300034090 | Peat Soil | LEYDDELDAAAFEPPSDLHHFAKARMITVGDPGLSRLFVGSMSPFRARLGSF |
⦗Top⦘ |