| Basic Information | |
|---|---|
| Family ID | F035044 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 173 |
| Average Sequence Length | 40 residues |
| Representative Sequence | GFVVSGGIGATMRLLMRRGREGKTKARFGPFSLVDRD |
| Number of Associated Samples | 154 |
| Number of Associated Scaffolds | 173 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.11 % |
| % of genes from short scaffolds (< 2000 bps) | 94.80 % |
| Associated GOLD sequencing projects | 149 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.439 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (17.919 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.168 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.243 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 24.62% β-sheet: 12.31% Coil/Unstructured: 63.08% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 173 Family Scaffolds |
|---|---|---|
| PF03631 | Virul_fac_BrkB | 39.88 |
| PF00571 | CBS | 7.51 |
| PF00027 | cNMP_binding | 2.89 |
| PF00127 | Copper-bind | 1.73 |
| PF03147 | FDX-ACB | 1.73 |
| PF07098 | DUF1360 | 1.73 |
| PF04055 | Radical_SAM | 1.16 |
| PF12732 | YtxH | 1.16 |
| PF04972 | BON | 1.16 |
| PF03484 | B5 | 1.16 |
| PF13419 | HAD_2 | 0.58 |
| PF01425 | Amidase | 0.58 |
| PF01316 | Arg_repressor | 0.58 |
| PF00437 | T2SSE | 0.58 |
| PF01409 | tRNA-synt_2d | 0.58 |
| PF00230 | MIP | 0.58 |
| PF00676 | E1_dh | 0.58 |
| PF00892 | EamA | 0.58 |
| PF00583 | Acetyltransf_1 | 0.58 |
| PF00072 | Response_reg | 0.58 |
| COG ID | Name | Functional Category | % Frequency in 173 Family Scaffolds |
|---|---|---|---|
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 39.88 |
| COG0072 | Phenylalanyl-tRNA synthetase beta subunit | Translation, ribosomal structure and biogenesis [J] | 2.89 |
| COG0016 | Phenylalanyl-tRNA synthetase alpha subunit | Translation, ribosomal structure and biogenesis [J] | 0.58 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.58 |
| COG0567 | 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes | Energy production and conversion [C] | 0.58 |
| COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 0.58 |
| COG1071 | TPP-dependent pyruvate or acetoin dehydrogenase subunit alpha | Energy production and conversion [C] | 0.58 |
| COG1438 | Arginine repressor | Transcription [K] | 0.58 |
| COG2024 | O-phosphoseryl-tRNA(Cys) synthetase | Translation, ribosomal structure and biogenesis [J] | 0.58 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.44 % |
| Unclassified | root | N/A | 11.56 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000890|JGI11643J12802_10615869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 518 | Open in IMG/M |
| 3300001536|A1565W1_10283972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 753 | Open in IMG/M |
| 3300001686|C688J18823_10425204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 857 | Open in IMG/M |
| 3300003911|JGI25405J52794_10032371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1089 | Open in IMG/M |
| 3300003996|Ga0055467_10001358 | All Organisms → cellular organisms → Bacteria | 3437 | Open in IMG/M |
| 3300004081|Ga0063454_101616445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 560 | Open in IMG/M |
| 3300004153|Ga0063455_100026453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1673 | Open in IMG/M |
| 3300005093|Ga0062594_101676150 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300005176|Ga0066679_10559519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 745 | Open in IMG/M |
| 3300005178|Ga0066688_10923081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 537 | Open in IMG/M |
| 3300005184|Ga0066671_10241002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1109 | Open in IMG/M |
| 3300005328|Ga0070676_11385416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 539 | Open in IMG/M |
| 3300005330|Ga0070690_100707926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 774 | Open in IMG/M |
| 3300005332|Ga0066388_106536762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 588 | Open in IMG/M |
| 3300005437|Ga0070710_10818274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 666 | Open in IMG/M |
| 3300005437|Ga0070710_11196094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 562 | Open in IMG/M |
| 3300005451|Ga0066681_10579432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 692 | Open in IMG/M |
| 3300005454|Ga0066687_10139326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1272 | Open in IMG/M |
| 3300005552|Ga0066701_10306739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 984 | Open in IMG/M |
| 3300005554|Ga0066661_10232501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1142 | Open in IMG/M |
| 3300005554|Ga0066661_10235196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1135 | Open in IMG/M |
| 3300005566|Ga0066693_10197813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 778 | Open in IMG/M |
| 3300005566|Ga0066693_10376205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 575 | Open in IMG/M |
| 3300005569|Ga0066705_10277511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1063 | Open in IMG/M |
| 3300005575|Ga0066702_10082024 | All Organisms → cellular organisms → Bacteria | 1806 | Open in IMG/M |
| 3300005576|Ga0066708_10556799 | Not Available | 738 | Open in IMG/M |
| 3300005576|Ga0066708_10915056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 547 | Open in IMG/M |
| 3300005576|Ga0066708_11017467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 514 | Open in IMG/M |
| 3300005577|Ga0068857_100297308 | All Organisms → cellular organisms → Bacteria | 1488 | Open in IMG/M |
| 3300005598|Ga0066706_11461377 | Not Available | 515 | Open in IMG/M |
| 3300005616|Ga0068852_101708934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 652 | Open in IMG/M |
| 3300005764|Ga0066903_107960414 | Not Available | 544 | Open in IMG/M |
| 3300005841|Ga0068863_102315464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 547 | Open in IMG/M |
| 3300005842|Ga0068858_101927805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 584 | Open in IMG/M |
| 3300005874|Ga0075288_1058964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 604 | Open in IMG/M |
| 3300006028|Ga0070717_10719382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 907 | Open in IMG/M |
| 3300006034|Ga0066656_10194327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1289 | Open in IMG/M |
| 3300006173|Ga0070716_100737422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 756 | Open in IMG/M |
| 3300006576|Ga0074047_11877432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 838 | Open in IMG/M |
| 3300006791|Ga0066653_10369159 | Not Available | 730 | Open in IMG/M |
| 3300006847|Ga0075431_101416885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 654 | Open in IMG/M |
| 3300006854|Ga0075425_100049999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4682 | Open in IMG/M |
| 3300006871|Ga0075434_101920852 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 598 | Open in IMG/M |
| 3300006871|Ga0075434_102110847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 568 | Open in IMG/M |
| 3300006881|Ga0068865_101252717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 658 | Open in IMG/M |
| 3300006953|Ga0074063_11670574 | Not Available | 562 | Open in IMG/M |
| 3300009012|Ga0066710_102505304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 746 | Open in IMG/M |
| 3300009092|Ga0105250_10350213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 647 | Open in IMG/M |
| 3300009092|Ga0105250_10395001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 612 | Open in IMG/M |
| 3300009137|Ga0066709_100222275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2502 | Open in IMG/M |
| 3300009137|Ga0066709_103102757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 608 | Open in IMG/M |
| 3300009137|Ga0066709_103614512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 561 | Open in IMG/M |
| 3300009156|Ga0111538_14067232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 505 | Open in IMG/M |
| 3300009176|Ga0105242_10047762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3476 | Open in IMG/M |
| 3300009553|Ga0105249_10237115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1802 | Open in IMG/M |
| 3300009818|Ga0105072_1101280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 578 | Open in IMG/M |
| 3300009822|Ga0105066_1118167 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300009823|Ga0105078_1007977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1096 | Open in IMG/M |
| 3300009840|Ga0126313_10366301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1138 | Open in IMG/M |
| 3300010036|Ga0126305_11177830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 529 | Open in IMG/M |
| 3300010041|Ga0126312_11155348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 570 | Open in IMG/M |
| 3300010139|Ga0127464_1121451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 840 | Open in IMG/M |
| 3300010364|Ga0134066_10233655 | Not Available | 628 | Open in IMG/M |
| 3300010371|Ga0134125_13076993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 505 | Open in IMG/M |
| 3300010373|Ga0134128_12538720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 565 | Open in IMG/M |
| 3300010397|Ga0134124_13106964 | Not Available | 508 | Open in IMG/M |
| 3300010399|Ga0134127_12107630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 642 | Open in IMG/M |
| 3300010401|Ga0134121_11782878 | Not Available | 641 | Open in IMG/M |
| 3300012199|Ga0137383_10545586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 848 | Open in IMG/M |
| 3300012200|Ga0137382_10162674 | Not Available | 1519 | Open in IMG/M |
| 3300012200|Ga0137382_10586972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 795 | Open in IMG/M |
| 3300012204|Ga0137374_10948705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 627 | Open in IMG/M |
| 3300012207|Ga0137381_11025766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 711 | Open in IMG/M |
| 3300012211|Ga0137377_10215559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1843 | Open in IMG/M |
| 3300012212|Ga0150985_118172209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1169 | Open in IMG/M |
| 3300012350|Ga0137372_10605272 | Not Available | 803 | Open in IMG/M |
| 3300012354|Ga0137366_11188032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 520 | Open in IMG/M |
| 3300012355|Ga0137369_10133227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1993 | Open in IMG/M |
| 3300012356|Ga0137371_10045472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3391 | Open in IMG/M |
| 3300012356|Ga0137371_10761254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 739 | Open in IMG/M |
| 3300012357|Ga0137384_10526478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 969 | Open in IMG/M |
| 3300012375|Ga0134034_1172494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 545 | Open in IMG/M |
| 3300012384|Ga0134036_1052588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 542 | Open in IMG/M |
| 3300012403|Ga0134049_1029405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 582 | Open in IMG/M |
| 3300012405|Ga0134041_1094613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 583 | Open in IMG/M |
| 3300012469|Ga0150984_108994486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 630 | Open in IMG/M |
| 3300012469|Ga0150984_111763949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 781 | Open in IMG/M |
| 3300012476|Ga0157344_1009261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 690 | Open in IMG/M |
| 3300012495|Ga0157323_1007896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 779 | Open in IMG/M |
| 3300012519|Ga0157352_1081431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 542 | Open in IMG/M |
| 3300012530|Ga0136635_10103439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 908 | Open in IMG/M |
| 3300012680|Ga0136612_10340875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 760 | Open in IMG/M |
| 3300012884|Ga0157300_1092807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 546 | Open in IMG/M |
| 3300012911|Ga0157301_10434824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 517 | Open in IMG/M |
| 3300012912|Ga0157306_10058361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 996 | Open in IMG/M |
| 3300012922|Ga0137394_10750169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 820 | Open in IMG/M |
| 3300012958|Ga0164299_11571756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 516 | Open in IMG/M |
| 3300012986|Ga0164304_11067592 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 644 | Open in IMG/M |
| 3300013096|Ga0157307_1158785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 532 | Open in IMG/M |
| 3300013307|Ga0157372_11381738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 812 | Open in IMG/M |
| 3300013307|Ga0157372_12635174 | Not Available | 577 | Open in IMG/M |
| 3300013308|Ga0157375_12786284 | Not Available | 584 | Open in IMG/M |
| 3300014157|Ga0134078_10134784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 958 | Open in IMG/M |
| 3300014254|Ga0075312_1100313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 602 | Open in IMG/M |
| 3300014497|Ga0182008_10765304 | Not Available | 557 | Open in IMG/M |
| 3300014969|Ga0157376_10827402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 940 | Open in IMG/M |
| 3300015164|Ga0167652_1082651 | Not Available | 538 | Open in IMG/M |
| 3300015356|Ga0134073_10123855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 790 | Open in IMG/M |
| 3300015356|Ga0134073_10411990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 512 | Open in IMG/M |
| 3300015371|Ga0132258_13290105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1112 | Open in IMG/M |
| 3300015374|Ga0132255_104671019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 580 | Open in IMG/M |
| 3300017965|Ga0190266_11153994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 533 | Open in IMG/M |
| 3300018027|Ga0184605_10090784 | Not Available | 1340 | Open in IMG/M |
| 3300018061|Ga0184619_10070787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1540 | Open in IMG/M |
| 3300018061|Ga0184619_10247136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 821 | Open in IMG/M |
| 3300018061|Ga0184619_10301103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 735 | Open in IMG/M |
| 3300018081|Ga0184625_10317495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 812 | Open in IMG/M |
| 3300018422|Ga0190265_13077193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 557 | Open in IMG/M |
| 3300018431|Ga0066655_10585778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 750 | Open in IMG/M |
| 3300019233|Ga0184645_1040610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 582 | Open in IMG/M |
| 3300019279|Ga0184642_1103809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1023 | Open in IMG/M |
| 3300019356|Ga0173481_10256278 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 790 | Open in IMG/M |
| 3300019361|Ga0173482_10575894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 561 | Open in IMG/M |
| 3300019884|Ga0193741_1054085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1035 | Open in IMG/M |
| 3300021080|Ga0210382_10147611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1006 | Open in IMG/M |
| 3300021413|Ga0193750_1090743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 542 | Open in IMG/M |
| 3300022195|Ga0222625_1718147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 577 | Open in IMG/M |
| 3300022467|Ga0224712_10629042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 525 | Open in IMG/M |
| 3300022756|Ga0222622_10379253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 991 | Open in IMG/M |
| 3300022756|Ga0222622_11315790 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 532 | Open in IMG/M |
| 3300023168|Ga0247748_1034773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 737 | Open in IMG/M |
| 3300024288|Ga0179589_10114660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1117 | Open in IMG/M |
| 3300025910|Ga0207684_10349180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1273 | Open in IMG/M |
| 3300025935|Ga0207709_10105320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1874 | Open in IMG/M |
| 3300025937|Ga0207669_10430616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1041 | Open in IMG/M |
| 3300025945|Ga0207679_11936959 | Not Available | 537 | Open in IMG/M |
| 3300026008|Ga0208529_1033137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 502 | Open in IMG/M |
| 3300026035|Ga0207703_11826683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 584 | Open in IMG/M |
| 3300026530|Ga0209807_1145780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 913 | Open in IMG/M |
| 3300026542|Ga0209805_1133341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1162 | Open in IMG/M |
| 3300026547|Ga0209156_10107962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 1377 | Open in IMG/M |
| 3300026742|Ga0207597_101496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 743 | Open in IMG/M |
| 3300027379|Ga0209842_1054142 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300028380|Ga0268265_12562676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 516 | Open in IMG/M |
| 3300028707|Ga0307291_1003210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3524 | Open in IMG/M |
| 3300028717|Ga0307298_10234563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 543 | Open in IMG/M |
| 3300028718|Ga0307307_10203423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 627 | Open in IMG/M |
| 3300028719|Ga0307301_10057005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1207 | Open in IMG/M |
| 3300028719|Ga0307301_10322266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 507 | Open in IMG/M |
| 3300028720|Ga0307317_10045347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1401 | Open in IMG/M |
| 3300028722|Ga0307319_10051873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1288 | Open in IMG/M |
| 3300028755|Ga0307316_10091033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1057 | Open in IMG/M |
| 3300028787|Ga0307323_10044806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1553 | Open in IMG/M |
| 3300028811|Ga0307292_10055892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1485 | Open in IMG/M |
| 3300028824|Ga0307310_10102290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1276 | Open in IMG/M |
| 3300028828|Ga0307312_10175204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1370 | Open in IMG/M |
| 3300028878|Ga0307278_10390330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 612 | Open in IMG/M |
| 3300028881|Ga0307277_10469908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 564 | Open in IMG/M |
| 3300030336|Ga0247826_11152089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 621 | Open in IMG/M |
| 3300030634|Ga0247636_10274186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 564 | Open in IMG/M |
| 3300031054|Ga0102746_10781482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 601 | Open in IMG/M |
| 3300031421|Ga0308194_10110261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 804 | Open in IMG/M |
| 3300031716|Ga0310813_10391532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1193 | Open in IMG/M |
| 3300031720|Ga0307469_11768715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 597 | Open in IMG/M |
| 3300031731|Ga0307405_10643770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 871 | Open in IMG/M |
| 3300031731|Ga0307405_10840921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 772 | Open in IMG/M |
| 3300031854|Ga0310904_11401089 | Not Available | 509 | Open in IMG/M |
| 3300032174|Ga0307470_11193269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 618 | Open in IMG/M |
| 3300033412|Ga0310810_10611629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1043 | Open in IMG/M |
| 3300034669|Ga0314794_138086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 555 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 17.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 12.72% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.67% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.20% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.89% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.89% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.89% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.89% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 2.31% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.31% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.31% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.73% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.73% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.73% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.16% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.16% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.16% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.16% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.16% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.16% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.16% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.16% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.16% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.16% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.16% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.16% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.16% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.16% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.58% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.58% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.58% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.58% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.58% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.58% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.58% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.58% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.58% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.58% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.58% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.58% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300001536 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300003996 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005874 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006576 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009818 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 | Environmental | Open in IMG/M |
| 3300009822 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 | Environmental | Open in IMG/M |
| 3300009823 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010139 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012375 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012384 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012403 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012405 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Host-Associated | Open in IMG/M |
| 3300012519 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610 | Environmental | Open in IMG/M |
| 3300012530 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ85 (21.06) | Environmental | Open in IMG/M |
| 3300012680 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ224A (23.06) | Environmental | Open in IMG/M |
| 3300012884 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013096 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014254 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D2 | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015164 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4b, rock/ice/stream interface) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300019233 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019884 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2 | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021413 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c1 | Environmental | Open in IMG/M |
| 3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300023168 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S064-202C-5 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026008 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_202 (SPAdes) | Environmental | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026742 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A5w-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027379 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300030634 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb1 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030903 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031054 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 1C (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300034669 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI11643J12802_106158691 | 3300000890 | Soil | LPVAAAAALGIGFVVSGGIGATMRLLMRRSREGRTKARFGPFSLVDRD* |
| A1565W1_102839722 | 3300001536 | Permafrost | AAGALGAGFLAAGGIGAAMRLIGRRGREGQKKARFGR* |
| C688J18823_104252041 | 3300001686 | Soil | ALGAGFFFAGGIGATMRLLARRGREGTTKAKLGPFSLVDRDD* |
| JGI25405J52794_100323713 | 3300003911 | Tabebuia Heterophylla Rhizosphere | IATAAALGVGFVVAGGIGATMRLIMRRGREGTEKARFGPFSLVDRD* |
| Ga0055467_100013584 | 3300003996 | Natural And Restored Wetlands | AAGVAVGLGFVLAGGVGATMRLLARKGREGDEKVRFGRFSFVDRS* |
| Ga0063454_1016164451 | 3300004081 | Soil | AAGAASAGFVLAGGIGATMRLFARRGREGRAKAGVGRFWLVDRG* |
| Ga0063455_1000264535 | 3300004153 | Soil | LGAGFVLAGGVGATMRFAARRGREGRERARVGRFAVVDKS* |
| Ga0062594_1016761501 | 3300005093 | Soil | ALGAGFVLAGGVGATMRFVARRGRDGRERVKLGRFSLVDKS* |
| Ga0066679_105595192 | 3300005176 | Soil | GAGFVVAGGVGATMRLLARRGREGRQRARVGRFAVVDRN* |
| Ga0066688_109230811 | 3300005178 | Soil | AAAGALVLGFVLSGGIGATMRLAFRRGREGETKARLGPFSLVDRS* |
| Ga0066671_102410021 | 3300005184 | Soil | GAGFVLAGGIGATARLVLRRGREGKTKARFGPLSLVDRG* |
| Ga0070676_113854161 | 3300005328 | Miscanthus Rhizosphere | AAAAALGAGFVVSGGIGATMRLLMRRGREGKTKARFGPFSLVDRD* |
| Ga0070690_1007079262 | 3300005330 | Switchgrass Rhizosphere | KLPIVATKAIEAGFFIASRIGATMRLLARRGRKDRTKARFGRFSFVDRD* |
| Ga0066388_1065367622 | 3300005332 | Tropical Forest Soil | PLAVVAALGAGFVLSGGVGATMRLLMRKGREGTTKARFGHFSLVDRD* |
| Ga0070710_108182742 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | LGAGFFAAGGVGATMRLLARRGREGTTKAKVGPFSLVDRDD* |
| Ga0070710_111960942 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | AGFFAAGGVGATMRLLARRGREGTTKAKVGPFSLVDRDD* |
| Ga0066681_105794322 | 3300005451 | Soil | KLPAAVAAAFGVGFVAAGGIGATMRLVMRRGREGRTKAKFGPFSLVDRD* |
| Ga0066687_101393263 | 3300005454 | Soil | LGAGFFLAGGIGATMRLLARRGREGTTKAKLGPFSVVDRDD* |
| Ga0066701_103067391 | 3300005552 | Soil | AGFFLAGGVGATMRLLARRGREGTTKAKVGPFSLVDRDD* |
| Ga0066661_102325012 | 3300005554 | Soil | AAGALGLGFVAAGGIGATMRLIMRRGREGEEKARFGRFSLVNRD* |
| Ga0066661_102351961 | 3300005554 | Soil | GALGAGFFAAGGIGATMRLLARRSREGTTKAKLGPFSLVDRDD* |
| Ga0066693_101978131 | 3300005566 | Soil | VVAAGALGLGFVTAGGIGATMRLIMRRGREGNEKARLGRFSLVNRDK* |
| Ga0066693_103762051 | 3300005566 | Soil | PVATAAALGVGFVLAGGVGATMRLIMRRGREGHTKARFGPFSLIDRD* |
| Ga0066705_102775111 | 3300005569 | Soil | AGALGVGFIAAGGIGATMRLIMRRGREGTQKAKVGRFSLLSR* |
| Ga0066702_100820241 | 3300005575 | Soil | LGAGFVLAGGIGATARLVMRRGREGKTKARFGLFSLVDRG* |
| Ga0066708_105567992 | 3300005576 | Soil | VASGGIGATMRLLMRRSREGKSQMTLGRFRLVDRR* |
| Ga0066708_109150562 | 3300005576 | Soil | AALGAGFVLAGGVGATMRLLMRRGREGRTKARLGPFSLIDRD* |
| Ga0066708_110174672 | 3300005576 | Soil | GFFLAGGIGATMRLLARRGREGTTKAKVGPFSLVNRDD* |
| Ga0068857_1002973081 | 3300005577 | Corn Rhizosphere | VRAKLPVITAGALTAGFVVAGGIGATMRLIGRHREGKTKARVGRFSFVDRR* |
| Ga0066706_114613772 | 3300005598 | Soil | AAGALGLGFVAAGGIGATARLLMRRGREGDEKLRVGRFALVERD* |
| Ga0068852_1017089342 | 3300005616 | Corn Rhizosphere | AAVGAGFLYAGGIGATMRLLARRGREGHERLRMGRFSVVDRD* |
| Ga0066903_1079604142 | 3300005764 | Tropical Forest Soil | KLLGPKLPLLAAGAFAAGFVLGGGIGATVRLVLRRRREGREEARVGRFSLIRRR* |
| Ga0068863_1023154641 | 3300005841 | Switchgrass Rhizosphere | VISGGIGATMRLLMRKSREGTTKARLGPLWLIDRD* |
| Ga0068858_1019278052 | 3300005842 | Switchgrass Rhizosphere | AGFFIAGGVGATMRLLARRGREGRTKARFGRFSFVDRD* |
| Ga0075288_10589641 | 3300005874 | Rice Paddy Soil | ASALGAGFVLAGGVGATMRFAARRGREGRERARVGRFAVVDKS* |
| Ga0070717_107193821 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LAGGFMLAGGVGATMRLLARRSREGHRKAKLGRFSLIDRG* |
| Ga0066656_101943271 | 3300006034 | Soil | LPVIAAGALAAGFVVAGGIGATMRMIGRHRESTEKARFGRFSFVDRN* |
| Ga0070716_1007374222 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | FAAGGVGATMRLLARRGREGTTKAKVGPFSLVDRDD* |
| Ga0074047_118774322 | 3300006576 | Soil | FVLAGGLGATMRLLARRGREGDTKVQAGRFKLVDRG* |
| Ga0066653_103691592 | 3300006791 | Soil | AAFAAMFVLGGGIGATMRLLARRGREGHETARLGRWVVIERK* |
| Ga0075431_1014168851 | 3300006847 | Populus Rhizosphere | FLAGGVGATMRLLFRRGREGKEKARLGRFSFVDRD* |
| Ga0075425_1000499991 | 3300006854 | Populus Rhizosphere | GFVLAGGIGATMRLVFRRGREGTEKARLGRFTIIDRD* |
| Ga0075434_1019208521 | 3300006871 | Populus Rhizosphere | LLAGGIGATMRLLMRRSREGRTKARLGPFSLVDRD* |
| Ga0075434_1021108471 | 3300006871 | Populus Rhizosphere | GALTAGFVIAGGIGATMRLIGRHRESKTKARFGRFSLIDRD* |
| Ga0068865_1012527172 | 3300006881 | Miscanthus Rhizosphere | TGFVLAGGLGATMRLLARRGREGETKVQAGRFKLVDRG* |
| Ga0074063_116705741 | 3300006953 | Soil | FILAGGVGATMRYLARRGREGDEQLRAGRFSLVRRG* |
| Ga0066710_1025053041 | 3300009012 | Grasslands Soil | GGFFLAGGIGATARLLFRRGREGTRKAGVGRFTFVDRG |
| Ga0105250_103502132 | 3300009092 | Switchgrass Rhizosphere | LAAAAALGAGFVVSGGIGATMRLLMRRGREGRTKARFGPFSLVDRD* |
| Ga0105250_103950012 | 3300009092 | Switchgrass Rhizosphere | GFFLAGGIGATMRLLARRGREGTRKAKVGPFSLVDRDD* |
| Ga0066709_1002222755 | 3300009137 | Grasslands Soil | ATAAAVGAGFVLAGGIGATMRLLFRRGREGNEKARFGPFSLIDRD* |
| Ga0066709_1031027572 | 3300009137 | Grasslands Soil | GLGFVASGGIGATMRLLMRRGREGRQTAKVGRLRISR* |
| Ga0066709_1036145121 | 3300009137 | Grasslands Soil | ATVAALGAGFVLAGGIGATMRLVLRRGREGRTKARLGRFSLTDRD* |
| Ga0111538_140672322 | 3300009156 | Populus Rhizosphere | FVLAGGVGATMRFVARRGREGRERARVGRFSVVDRS* |
| Ga0105242_100477621 | 3300009176 | Miscanthus Rhizosphere | AGGVGATMRLLARRGREGTTKAKVGPFSLVDRDD* |
| Ga0105249_102371151 | 3300009553 | Switchgrass Rhizosphere | LAGGVGATMRLLARRGREGTTKAKVGPFSLVDRDD* |
| Ga0105072_11012802 | 3300009818 | Groundwater Sand | GLGFFLAGGIGATMRLLARRGREGKEKARFGRFSFVDRD* |
| Ga0105066_11181672 | 3300009822 | Groundwater Sand | AGFVLFGGVGATLRYLARRGREGKEKARVGPFSFTTRD* |
| Ga0105078_10079773 | 3300009823 | Groundwater Sand | FVVAGGIGATMRLLFRRGREGEEKARFGPFAFIDRR* |
| Ga0126313_103663013 | 3300009840 | Serpentine Soil | GFVVSGGIGATMRLLMRRGREGKTKARFGPFSLVDRD* |
| Ga0126305_111778301 | 3300010036 | Serpentine Soil | AGFLFAGGIGATARLFFRRGREGTERARLGRFTIVDRN* |
| Ga0126312_111553481 | 3300010041 | Serpentine Soil | AAALGVGFVVSGGIGATMRLLMRRGREGKTKARFGPFSLVDRD* |
| Ga0127464_11214511 | 3300010139 | Grasslands Soil | AGGIGATMRLLARRGREGTTKAKVGPFSLVDRDD* |
| Ga0134066_102336552 | 3300010364 | Grasslands Soil | AFGVGFVASGGIGATMRLLMRRSREGKAQLTVGRFRIVDRG* |
| Ga0134125_130769932 | 3300010371 | Terrestrial Soil | LAGGAMAAGFVFAGGIGATMRYIARRGREGDRKAKLGRFSLVDRG* |
| Ga0134128_125387202 | 3300010373 | Terrestrial Soil | FLAGGVGATMRLLARRGREGTTKAKVGPFSLVDRDD* |
| Ga0134124_131069642 | 3300010397 | Terrestrial Soil | AGALGTGFVLGGGIGATMRLLMRRSREGDEKARVGRFSLARRR* |
| Ga0134127_121076301 | 3300010399 | Terrestrial Soil | SALGAGFVLAGGVGATMRFVARRGREGRERARLGRFSVVDRS* |
| Ga0134121_117828783 | 3300010401 | Terrestrial Soil | ASALGAGFVLAGGVGATMRFVARRGREGRQRVKLGRFSVVDRS* |
| Ga0137383_105455862 | 3300012199 | Vadose Zone Soil | GFVLAGGIGATMRYAARRGREGSEKVHVGRWSLRHRN* |
| Ga0137382_101626742 | 3300012200 | Vadose Zone Soil | VATAGALGVGFIAAGGIGATMRLIMRRSREGTQKAKVGRFSLLSR* |
| Ga0137382_105869722 | 3300012200 | Vadose Zone Soil | AAFGTGFLLSGGIGATMRLIFRRGREGNEKARLGRFSFVDRD* |
| Ga0137374_109487051 | 3300012204 | Vadose Zone Soil | ALGAGFVVAGGIGATMRLLFRRGREGEEKARLGPFAFIDRR* |
| Ga0137381_110257662 | 3300012207 | Vadose Zone Soil | GFFAAGGIGATMRLLARRGREGTTKAKVGPFSLVDRDD* |
| Ga0137377_102155593 | 3300012211 | Vadose Zone Soil | LKGKLPAAIAAAFGVGFVAAGGIGATMRLLMGRGRDGRAKARFGPFSRVGRD* |
| Ga0150985_1181722091 | 3300012212 | Avena Fatua Rhizosphere | LAGGVGATMRLLFRRGREGKEKARFGPFSLVDRD* |
| Ga0137372_106052722 | 3300012350 | Vadose Zone Soil | VLGGGIGATMRLLARRGREGHETARLGRWVVVERK* |
| Ga0137367_1001684410 | 3300012353 | Vadose Zone Soil | VAGGIGATMRLLFRRGREGEEKARLGPFAFIDRR* |
| Ga0137366_111880322 | 3300012354 | Vadose Zone Soil | AGALGLGFVAAGGIGATMRLLMRRGREGETKARLGRFSLVGRD* |
| Ga0137369_101332271 | 3300012355 | Vadose Zone Soil | RELGAGFVLAGGVGATMRLLFRRGREGTEKARVGRFTLIDRD* |
| Ga0137371_100454721 | 3300012356 | Vadose Zone Soil | GAGFFAAGGIGATMRLLARRGREGTTKAKVGPFSLVDRDD* |
| Ga0137371_107612542 | 3300012356 | Vadose Zone Soil | GAGFVVAGGIGAVARLVMRRSREGEHKAKVGRFSLVDRR* |
| Ga0137384_105264781 | 3300012357 | Vadose Zone Soil | GAVGAGFVLAGGIGAVARLVMRRSREGEPKAKVGRFSLVDRR* |
| Ga0134034_11724942 | 3300012375 | Grasslands Soil | VLAGGVGATMRLLMRRGREGHTKARFGPFSLIDRD* |
| Ga0134036_10525881 | 3300012384 | Grasslands Soil | AGGIGATMRLLARRGREGTTKAKVGPFSLVNRDD* |
| Ga0134049_10294052 | 3300012403 | Grasslands Soil | FLAGGIGATMRLLARRGREGTTKAKVGPFSLVDRDD* |
| Ga0134041_10946132 | 3300012405 | Grasslands Soil | LAGGVGATMRLLMRRGREGHTKARFGPFSLIDRD* |
| Ga0150984_1089944862 | 3300012469 | Avena Fatua Rhizosphere | VLAGGIGATMRLLARRGREGRHKASFGRFTVVEHD* |
| Ga0150984_1117639492 | 3300012469 | Avena Fatua Rhizosphere | GFVLAGGIGATMRLFARRGREGRAKAGVGRFWLVDRG* |
| Ga0157344_10092611 | 3300012476 | Arabidopsis Rhizosphere | VAAAAAAALGIGFVVAGGIGATMRLLARRGREGRTKARFGPFSLVDRD* |
| Ga0157323_10078961 | 3300012495 | Arabidopsis Rhizosphere | AAAAAALGIGFVVAGGIGATMRLLARRGREGRTKARFGPFSLVDRD* |
| Ga0157352_10814312 | 3300012519 | Unplanted Soil | VLAGGIGATMRLFARKSREGTEKARFGRFRIVDRD* |
| Ga0136635_101034392 | 3300012530 | Polar Desert Sand | AAAGALGVGFVLAGGIGAGMRLIARRGREGRTKARFGRFSVVDRD* |
| Ga0136612_103408752 | 3300012680 | Polar Desert Sand | VGFFVAGGIGATMRLLARRGREGNEKARFGRFRLVDRD* |
| Ga0157300_10928072 | 3300012884 | Soil | LAAGGAATGFVLAGGLGATMRLLARRGREGETKVQAGRF* |
| Ga0157301_104348242 | 3300012911 | Soil | GAGFFLAGGIGATMRLFARRGREGTTKAKFGPFSLVDRDD* |
| Ga0157306_100583613 | 3300012912 | Soil | LAGGIGATMRLFARRGREGHTKASVGPFRLVGRD* |
| Ga0137394_107501692 | 3300012922 | Vadose Zone Soil | FFAAGGIGATMRLLARRSREGTTKAKLGPFSLVDRDD* |
| Ga0164299_115717562 | 3300012958 | Soil | FVVSGGIGATMRLLMRRGREGKTKARFGPFSLVDRD* |
| Ga0164304_110675922 | 3300012986 | Soil | LPLAAAAALGAGFVISGGIGATMRLVMRRNQEGRTKARFGRFSFVDRD* |
| Ga0157307_11587852 | 3300013096 | Soil | LAGGVGATMRFVARRGREGRQRVKLGRFSVVDRS* |
| Ga0157372_113817382 | 3300013307 | Corn Rhizosphere | GFFLAGGVGATMRLLARRGREGTTKAKVGPFSLVDRDD* |
| Ga0157372_126351741 | 3300013307 | Corn Rhizosphere | LPAAAAAALGVGFVVAGGIGSTMRLVMRRGREGEQKVKLGRFSLLERD* |
| Ga0157375_127862843 | 3300013308 | Miscanthus Rhizosphere | VLAGGVGATMRFVARRGREGRQRVKLGRFSVVDRS* |
| Ga0134078_101347841 | 3300014157 | Grasslands Soil | ALGAGFMLAGGIGATMRLLARRSREGTTKAKLGPFSLVDRDN* |
| Ga0075312_11003131 | 3300014254 | Natural And Restored Wetlands | LAGGVGATMRLVARKGREGDEKVRFGRFSFVDRS* |
| Ga0182008_107653042 | 3300014497 | Rhizosphere | ASALGAGFVLAGGVGATMRFAARRGREGRERARLGRFAVVDKS* |
| Ga0157376_108274022 | 3300014969 | Miscanthus Rhizosphere | VSGGIGATMRLLARRGREGKTKARFGPFSLVDRD* |
| Ga0167652_10826512 | 3300015164 | Glacier Forefield Soil | LGLGFVVSGGIGATARLLMRRGREGDEKAKAGRFSLVDKG* |
| Ga0134073_101238551 | 3300015356 | Grasslands Soil | GFFLAGGIGATMRLFARRGREGKTKAKVGPFSLVDRD* |
| Ga0134073_104119901 | 3300015356 | Grasslands Soil | AVGALGAGFMLAGGIGATMRLLARRSREGTTKAKLGPFSLVDRDN* |
| Ga0132258_132901053 | 3300015371 | Arabidopsis Rhizosphere | FVVAGGIGATMRLIGRHREGRTKARFGRFSFVDRS* |
| Ga0132255_1046710192 | 3300015374 | Arabidopsis Rhizosphere | VGALGAGFMFAGGIGATMRLLARRSREGTTKAKLGPFSLVDRDD* |
| Ga0190266_111539942 | 3300017965 | Soil | FVLAGGIGATMRLFARRGREGKEKARLGRFSFVDRD |
| Ga0184605_100907843 | 3300018027 | Groundwater Sediment | SAGFVLAGGIGATMRYLARRGREGDEKARFGPFKLIGRS |
| Ga0184619_100707873 | 3300018061 | Groundwater Sediment | FIAGGIGATMRLLARRGREGTTKARFGRFSVVNRD |
| Ga0184619_102471363 | 3300018061 | Groundwater Sediment | FVVAGGIGATMRLLFRSGREGKEKARVGRFAFIDRR |
| Ga0184619_103011031 | 3300018061 | Groundwater Sediment | AAGSLGVGFVVAGGIGAAMRLLARRGREGRTKARFGRFSVVDRD |
| Ga0184625_103174952 | 3300018081 | Groundwater Sediment | FVVSGGVGATMRLLMRRGREGKTKARFGPFSLVDRD |
| Ga0190265_130771931 | 3300018422 | Soil | GFVLAGGIGATMRYLARRGREGSETARVGRFSFIDRGR |
| Ga0066655_105857781 | 3300018431 | Grasslands Soil | ALGAGFFAAGGVGATMRLLARRGREGTTKAKVGPFSLVDRDD |
| Ga0184645_10406102 | 3300019233 | Groundwater Sediment | GAGFVVAGGIGATMRLLFRRGREGEEKARLGPFAFIDRR |
| Ga0184642_11038093 | 3300019279 | Groundwater Sediment | AGALAAGFVVAGGIGATMRLLFRRGREGKEKARVGRFAFIDRR |
| Ga0173481_102562781 | 3300019356 | Soil | AGGAATGFVLAGGLGATMRLLARRGREGDTKVQAGRFKLVDRG |
| Ga0173482_105758941 | 3300019361 | Soil | GFVLAGGVGATMRFVARRGREGRQRVKLGRFSVVDRS |
| Ga0193741_10540852 | 3300019884 | Soil | AVGAGFVLAGGIGATMRLFARRGREGKEKARLGRFSFVDRD |
| Ga0210382_101476111 | 3300021080 | Groundwater Sediment | AGFVLAGGVGATMRLLMRRGREGHTKARFGPFSVVDRD |
| Ga0193750_10907431 | 3300021413 | Soil | IGFVVSGGIGATMRLLMRRGREGRTKARFGPFSLVDRD |
| Ga0222625_17181471 | 3300022195 | Groundwater Sediment | VVAGGIGATMRLLFRRGREGEEKARLGPFAFIDRR |
| Ga0224712_106290422 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | AGGFVLAGGIGATMRLLARRSREGERKAKLGRFSLIDRG |
| Ga0222622_103792531 | 3300022756 | Groundwater Sediment | GAGFFLAGGIGATMRLLARRGREGTTKAKVGPFSLVDRDD |
| Ga0222622_113157902 | 3300022756 | Groundwater Sediment | VAALGAGFFLAGGIGATTRLLFRRGREGKEKARLGRFSFVDRD |
| Ga0247748_10347731 | 3300023168 | Soil | GVGFVVAGGIGATMRLIMRRGREGTEKARFGPFSLVDRD |
| Ga0179589_101146601 | 3300024288 | Vadose Zone Soil | GAGFFAAGGIGATMRLLARRSREGTTKAKLGPFSLVDRDD |
| Ga0207684_103491803 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | GAGFFRGGGVGATMRLLARRGREGTTKAKAGRFSLVDRDD |
| Ga0207709_101053201 | 3300025935 | Miscanthus Rhizosphere | FVLAGGVGATMRFVARRGRDGRERVKLGRFSIVDRS |
| Ga0207669_104306161 | 3300025937 | Miscanthus Rhizosphere | VLAGGVGATMRFVARRGREGRQRVKLGRFSVVDRS |
| Ga0207679_119369592 | 3300025945 | Corn Rhizosphere | VALGAGFVLAGGIGATVRLIFRRGREGTTKARFGPFVIVDRDR |
| Ga0208529_10331371 | 3300026008 | Rice Paddy Soil | AGAASAGFVLAGGIGATMRYLARRGREGDEKVRVGRWSLRDRG |
| Ga0207703_118266832 | 3300026035 | Switchgrass Rhizosphere | AGFFIAGGVGATMRLLARRGREGRTKARFGRFSFVDRD |
| Ga0209807_11457802 | 3300026530 | Soil | LGAGFFLAGGIGATARLVMRRGREGATKARAGRFRIVGDD |
| Ga0209805_11333413 | 3300026542 | Soil | LGAGFILAGGVGATMRLLMRRGREGHTKARFGPFSLVDRD |
| Ga0209156_101079623 | 3300026547 | Soil | VGFVVAGGLGATMRLLMRRGREGKTKAKFGPFSLVDRD |
| Ga0207597_1014961 | 3300026742 | Soil | AAALGVGFVVAGGIGATMRLIMRRGREGTEKARFGPFSLVDRD |
| Ga0209842_10541421 | 3300027379 | Groundwater Sand | GFFLAGGIGATMRLLARRGREGKEKARFGRFSFIDRD |
| Ga0268265_125626762 | 3300028380 | Switchgrass Rhizosphere | AIGAGFFIAGGVGATMRLLARRGREGRTKARFGRFSFVDRD |
| Ga0307291_10032101 | 3300028707 | Soil | GFFLAGGIGATMRLLARRGREGTTKAKVGPFSLVDRDD |
| Ga0307298_102345631 | 3300028717 | Soil | LGAGFVVAGGIGATMRLLFRRGREGKEKARVGPFAFIDRR |
| Ga0307307_102034232 | 3300028718 | Soil | FAAGGIGATMRLLARRSREGTTKAKLGPFSLVDRDD |
| Ga0307301_100570051 | 3300028719 | Soil | LGVGFVVSGGVGATVRLLMRRGREGKTKARFGPFSLVDRD |
| Ga0307301_103222661 | 3300028719 | Soil | AVGALGAGFVVAGGIGATMRLLFRRGREGEEKARLGPFAFIDRR |
| Ga0307317_100453471 | 3300028720 | Soil | MLKGKLPIAAAAALGVGFIVSGGIGASMRLLMRRGREGRTKARFGPFSLVDRD |
| Ga0307319_100518731 | 3300028722 | Soil | VGFVVSGGVGATMRLLMRRGREGKTKARFGPFSLVDRD |
| Ga0307316_100910332 | 3300028755 | Soil | GFVVSGGIGATMRLLMRRSREDRTKARFGPFSFGDRD |
| Ga0307323_100448061 | 3300028787 | Soil | LALGFVVSGGIGATMRLLMRRSREDRTKARFGPFSFGDRD |
| Ga0307292_100558923 | 3300028811 | Soil | LAAAAALGAGFVISGGIGATMRLVMRRSREGRTKARFGPFSFVDRD |
| Ga0307310_101022901 | 3300028824 | Soil | GAGFVISGGVGATMRLVMRRNREGRTKARFGPFSFVDRD |
| Ga0307312_101752043 | 3300028828 | Soil | VGFVAAGGIGATMRLVMRRGREGRTKARFGPFSFVDRD |
| Ga0307278_103903302 | 3300028878 | Soil | AGAGIVLAGGIGAVMRLVARRGREGRETARIGRFSLVDRD |
| Ga0307300_102111491 | 3300028880 | Soil | KGKVPAAAAGALALGFVVSGGIGATMRLLMRRSREDRTKARFGPFSFGDRD |
| Ga0307277_104699081 | 3300028881 | Soil | FFLAGGIGATMRLLARRGREGTTKAKVGPFSLVDRDD |
| Ga0247826_111520892 | 3300030336 | Soil | AALGIGFVVSGGIGATMRLLMRRSREGRTKARFGPFSLVDRD |
| Ga0247636_102741862 | 3300030634 | Soil | AVGAGFLLAGGIGATMRLFARRGREGKEKARFGRFSFVDRD |
| Ga0308206_11237812 | 3300030903 | Soil | AGALGAGFVVAGGIGATVRLLFRRGREGEEKARLGPFAFIDRR |
| Ga0102746_107814821 | 3300031054 | Soil | FVLAGGVGASMRFVARRGREGRERARVGRFAVIDKS |
| Ga0308194_101102611 | 3300031421 | Soil | TAAALGAGFVFAGGIGATMRLIMRRGREGRTKARFGHFSLVDRD |
| Ga0310813_103915321 | 3300031716 | Soil | GAGFVVAGGIGATMRLVMRRGREGTQKAKVGRFSLLARD |
| Ga0307469_117687151 | 3300031720 | Hardwood Forest Soil | AAAAALGAGFVVSGGIGATMRLLMRRGREGKTKARFGPFSLVDRD |
| Ga0307405_106437701 | 3300031731 | Rhizosphere | ALGAGFLFAGGIGATMRLLARREREGTTKARFGRFSFVERD |
| Ga0307405_108409212 | 3300031731 | Rhizosphere | AGFVVAGGIGATMRLLARRGREGRTRASFGPFSLVDRG |
| Ga0310904_114010892 | 3300031854 | Soil | TGFVLAGGLGATMRLLARRGREGDTKMQAGRFKLVDRG |
| Ga0307470_111932691 | 3300032174 | Hardwood Forest Soil | LAVGGAATGFVLAGGIGATMRLLARRGREGHQKVRAGRFTLVDRG |
| Ga0310810_106116291 | 3300033412 | Soil | FFIAGGIGATMRLLARRGREGRTKARVGRFSFVDRD |
| Ga0314794_138086_439_555 | 3300034669 | Soil | VGFVVAGGIGATMRLIMRRGREGAEKARFGPFSLVDRD |
| ⦗Top⦘ |