NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F033049

Metagenome Family F033049

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F033049
Family Type Metagenome
Number of Sequences 178
Average Sequence Length 69 residues
Representative Sequence YSLTLNEELPLINHPVVQAGSNFGSGNNEVAPKQRGLMLKRGQALYVAASGATALTTGFYCNVQGGYY
Number of Associated Samples 142
Number of Associated Scaffolds 178

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 95.51 %
% of genes from short scaffolds (< 2000 bps) 85.96 %
Associated GOLD sequencing projects 127
AlphaFold2 3D model prediction Yes
3D model pTM-score0.28

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.191 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(19.663 % of family members)
Environment Ontology (ENVO) Unclassified
(69.663 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(79.775 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: No Secondary Structure distribution: α-helix: 6.25%    β-sheet: 0.00%    Coil/Unstructured: 93.75%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.28
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 178 Family Scaffolds
PF00135COesterase 0.56
PF16778Phage_tail_APC 0.56

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 178 Family Scaffolds
COG2272Carboxylesterase type BLipid transport and metabolism [I] 0.56


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.31 %
UnclassifiedrootN/A1.69 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2035265000|ErSWdraf_F5BXKTZ02HA2WDAll Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium585Open in IMG/M
3300001951|GOS2249_1006833All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1341Open in IMG/M
3300001954|GOS2235_1000821All Organisms → Viruses → Predicted Viral1475Open in IMG/M
3300001961|GOS2240_1010320All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1885Open in IMG/M
3300002482|JGI25127J35165_1053745All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium867Open in IMG/M
3300002482|JGI25127J35165_1072657All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium715Open in IMG/M
3300002483|JGI25132J35274_1012562All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2071Open in IMG/M
3300002483|JGI25132J35274_1062822All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium787Open in IMG/M
3300002483|JGI25132J35274_1099668All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium590Open in IMG/M
3300002483|JGI25132J35274_1105005All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium572Open in IMG/M
3300002488|JGI25128J35275_1070620All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium727Open in IMG/M
3300002488|JGI25128J35275_1082872All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium657Open in IMG/M
3300002488|JGI25128J35275_1107544All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium560Open in IMG/M
3300005404|Ga0066856_10364125All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium620Open in IMG/M
3300006024|Ga0066371_10059253All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1111Open in IMG/M
3300006413|Ga0099963_1296111All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium578Open in IMG/M
3300006480|Ga0100226_1571103All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium533Open in IMG/M
3300006637|Ga0075461_10204059All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium591Open in IMG/M
3300006754|Ga0098044_1314605All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium597Open in IMG/M
3300006789|Ga0098054_1115761All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium999Open in IMG/M
3300006802|Ga0070749_10247739All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1010Open in IMG/M
3300006810|Ga0070754_10503160All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium521Open in IMG/M
3300006928|Ga0098041_1032884All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1689Open in IMG/M
3300006929|Ga0098036_1205065All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium599Open in IMG/M
3300006990|Ga0098046_1010632All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2512Open in IMG/M
3300007069|Ga0101646_1018659All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium741Open in IMG/M
3300007112|Ga0101560_1091337All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium611Open in IMG/M
3300007234|Ga0075460_10256232All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium582Open in IMG/M
3300007344|Ga0070745_1192380All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium756Open in IMG/M
3300007346|Ga0070753_1289550All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium587Open in IMG/M
3300007539|Ga0099849_1029801All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2338Open in IMG/M
3300007541|Ga0099848_1007747All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium4819Open in IMG/M
3300007542|Ga0099846_1344815All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium505Open in IMG/M
3300007960|Ga0099850_1244248All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium694Open in IMG/M
3300008097|Ga0111541_10041451All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1774Open in IMG/M
3300009056|Ga0102860_1240848All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium523Open in IMG/M
3300009181|Ga0114969_10561480All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium630Open in IMG/M
3300009481|Ga0114932_10486089All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium727Open in IMG/M
3300009504|Ga0114946_10478379All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium638Open in IMG/M
3300009593|Ga0115011_10239313All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1357Open in IMG/M
3300009593|Ga0115011_10352597All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1133Open in IMG/M
3300009703|Ga0114933_10456335All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium833Open in IMG/M
3300009790|Ga0115012_10429715All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1019Open in IMG/M
3300009790|Ga0115012_10486292All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium962Open in IMG/M
3300009790|Ga0115012_10685702All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium820Open in IMG/M
3300009790|Ga0115012_11632278All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium559Open in IMG/M
3300010149|Ga0098049_1145445All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium733Open in IMG/M
3300010300|Ga0129351_1009275All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium4094Open in IMG/M
3300010354|Ga0129333_10783323All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium814Open in IMG/M
3300010885|Ga0133913_12310595All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1320Open in IMG/M
3300011013|Ga0114934_10083486All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1579Open in IMG/M
3300012013|Ga0153805_1012805All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1435Open in IMG/M
3300012919|Ga0160422_10625155All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium684Open in IMG/M
3300012919|Ga0160422_10735720All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium631Open in IMG/M
3300012920|Ga0160423_10034516All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3730Open in IMG/M
3300012920|Ga0160423_10324267All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1058Open in IMG/M
3300012950|Ga0163108_10273293All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1087Open in IMG/M
3300012952|Ga0163180_10049627All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2521Open in IMG/M
3300012953|Ga0163179_10216224All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1475Open in IMG/M
3300012953|Ga0163179_10611352All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium916Open in IMG/M
3300013087|Ga0163212_1051069All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1390Open in IMG/M
3300015050|Ga0181338_1003534All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2711Open in IMG/M
3300017716|Ga0181350_1045363All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1181Open in IMG/M
3300017719|Ga0181390_1081698All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium891Open in IMG/M
3300017724|Ga0181388_1150769All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium552Open in IMG/M
3300017726|Ga0181381_1082298All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium687Open in IMG/M
3300017729|Ga0181396_1084837All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium641Open in IMG/M
3300017731|Ga0181416_1036325All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1158Open in IMG/M
3300017733|Ga0181426_1128984All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium510Open in IMG/M
3300017735|Ga0181431_1010562All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2214Open in IMG/M
3300017735|Ga0181431_1010718All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2197Open in IMG/M
3300017737|Ga0187218_1007292All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3048Open in IMG/M
3300017738|Ga0181428_1051957All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium955Open in IMG/M
3300017738|Ga0181428_1054584All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium931Open in IMG/M
3300017740|Ga0181418_1061350All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium927Open in IMG/M
3300017740|Ga0181418_1140600All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium581Open in IMG/M
3300017744|Ga0181397_1050133All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1157Open in IMG/M
3300017746|Ga0181389_1097345All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium813Open in IMG/M
3300017753|Ga0181407_1018282All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1948Open in IMG/M
3300017757|Ga0181420_1182744All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium615Open in IMG/M
3300017758|Ga0181409_1068745All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1076Open in IMG/M
3300017758|Ga0181409_1147171All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium690Open in IMG/M
3300017760|Ga0181408_1072911All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium903Open in IMG/M
3300017760|Ga0181408_1110013All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium715Open in IMG/M
3300017765|Ga0181413_1074963All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1036Open in IMG/M
3300017765|Ga0181413_1121281All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium793Open in IMG/M
3300017768|Ga0187220_1043243All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1356Open in IMG/M
3300017768|Ga0187220_1175888All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium646Open in IMG/M
3300017770|Ga0187217_1020196All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2391Open in IMG/M
3300017771|Ga0181425_1010699All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3066Open in IMG/M
3300017781|Ga0181423_1041963All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1839Open in IMG/M
3300017781|Ga0181423_1222756All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium709Open in IMG/M
3300017782|Ga0181380_1011958All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3326Open in IMG/M
3300017785|Ga0181355_1319099All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium578Open in IMG/M
3300020189|Ga0181578_10398054All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium602Open in IMG/M
3300020222|Ga0194125_10030388All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium5898Open in IMG/M
3300020267|Ga0211648_1030032All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1132Open in IMG/M
3300020325|Ga0211507_1026318All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1159Open in IMG/M
3300020367|Ga0211703_10203579All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium519Open in IMG/M
3300020379|Ga0211652_10122147All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium789Open in IMG/M
3300020386|Ga0211582_10090274All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1122Open in IMG/M
3300020392|Ga0211666_10065016All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1525Open in IMG/M
3300020394|Ga0211497_10282135All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300020395|Ga0211705_10063300All Organisms → Viruses → Predicted Viral1332Open in IMG/M
3300020395|Ga0211705_10075391All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1216Open in IMG/M
3300020397|Ga0211583_10219343All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium692Open in IMG/M
3300020421|Ga0211653_10419691All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium575Open in IMG/M
3300020428|Ga0211521_10027218All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3177Open in IMG/M
3300020437|Ga0211539_10221099All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium779Open in IMG/M
3300020445|Ga0211564_10117524All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1325Open in IMG/M
3300020451|Ga0211473_10172474All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1114Open in IMG/M
3300020457|Ga0211643_10651626All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium514Open in IMG/M
3300020459|Ga0211514_10048912All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2172Open in IMG/M
3300020459|Ga0211514_10181214All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1041Open in IMG/M
3300020472|Ga0211579_10399021All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium780Open in IMG/M
3300020472|Ga0211579_10481905All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium700Open in IMG/M
3300021364|Ga0213859_10487095All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium537Open in IMG/M
3300021376|Ga0194130_10099997All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1889Open in IMG/M
3300021550|Ga0224715_1105578All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium741Open in IMG/M
3300021960|Ga0222715_10262533All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium999Open in IMG/M
3300022066|Ga0224902_104216All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium732Open in IMG/M
3300022074|Ga0224906_1012490All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3240Open in IMG/M
3300022167|Ga0212020_1062801All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium628Open in IMG/M
3300022176|Ga0212031_1002661All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1979Open in IMG/M
3300022198|Ga0196905_1083414All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium868Open in IMG/M
3300022553|Ga0212124_10747802All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium504Open in IMG/M
3300023116|Ga0255751_10199519All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1122Open in IMG/M
3300023117|Ga0255757_10191458All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1094Open in IMG/M
3300023174|Ga0214921_10012299All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium10253Open in IMG/M
3300024354|Ga0255171_1043825All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium851Open in IMG/M
3300025096|Ga0208011_1008976All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2845Open in IMG/M
3300025096|Ga0208011_1041441All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1093Open in IMG/M
3300025103|Ga0208013_1010975All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2892Open in IMG/M
3300025110|Ga0208158_1097923All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium690Open in IMG/M
3300025132|Ga0209232_1066211All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1281Open in IMG/M
3300025132|Ga0209232_1097571All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium996Open in IMG/M
3300025132|Ga0209232_1141304All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium777Open in IMG/M
3300025132|Ga0209232_1177923All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium662Open in IMG/M
3300025151|Ga0209645_1178022All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium640Open in IMG/M
3300025151|Ga0209645_1216336All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium555Open in IMG/M
3300025610|Ga0208149_1072551All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium857Open in IMG/M
3300025630|Ga0208004_1068554All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium906Open in IMG/M
3300025630|Ga0208004_1122359All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium594Open in IMG/M
3300025646|Ga0208161_1040095All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1576Open in IMG/M
3300025646|Ga0208161_1056654All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1225Open in IMG/M
3300025646|Ga0208161_1115229All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium718Open in IMG/M
3300025647|Ga0208160_1081134All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium869Open in IMG/M
3300025647|Ga0208160_1093548All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium788Open in IMG/M
3300025655|Ga0208795_1087516All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium853Open in IMG/M
3300025687|Ga0208019_1141171All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium689Open in IMG/M
3300025751|Ga0208150_1152348All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium733Open in IMG/M
3300025759|Ga0208899_1042360All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2018Open in IMG/M
3300025818|Ga0208542_1169377All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium582Open in IMG/M
3300027888|Ga0209635_10583190All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium838Open in IMG/M
3300027906|Ga0209404_10222623All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1179Open in IMG/M
3300027917|Ga0209536_101691455All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium766Open in IMG/M
3300028025|Ga0247723_1159333All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium523Open in IMG/M
3300029318|Ga0185543_1054147All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium847Open in IMG/M
3300029792|Ga0183826_1063691All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium559Open in IMG/M
3300031669|Ga0307375_10542139All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium694Open in IMG/M
3300031772|Ga0315288_10296278All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1692Open in IMG/M
3300031774|Ga0315331_10960648All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium584Open in IMG/M
3300031784|Ga0315899_10701284All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium941Open in IMG/M
3300031785|Ga0310343_11167030All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium582Open in IMG/M
3300032011|Ga0315316_10254965All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1469Open in IMG/M
3300032011|Ga0315316_11007717All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium678Open in IMG/M
3300032047|Ga0315330_10355179All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium913Open in IMG/M
3300032073|Ga0315315_10890556All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium805Open in IMG/M
3300032073|Ga0315315_10998699All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium751Open in IMG/M
3300032073|Ga0315315_11322894All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium632Open in IMG/M
3300034012|Ga0334986_0122612All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1530Open in IMG/M
3300034019|Ga0334998_0160685All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1430Open in IMG/M
3300034021|Ga0335004_0405557All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium771Open in IMG/M
3300034063|Ga0335000_0243179All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1135Open in IMG/M
3300034104|Ga0335031_0571707All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium673Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine19.66%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater17.98%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous15.73%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine12.36%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater4.49%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater3.93%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake1.69%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.69%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater1.69%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.69%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine1.69%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh1.69%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface1.69%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.12%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.12%
MarineEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Marine1.12%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater1.12%
Marine SedimentEnvironmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment1.12%
Stylissa Sp. (Marine Sponge)Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Stylissa Sp. (Marine Sponge)1.12%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment0.56%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.56%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.56%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.56%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.56%
Surface IceEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice0.56%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.56%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater0.56%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.56%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.56%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.56%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment0.56%
Cinachyra Sp. (Marine Sponge)Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Cinachyra Sp. (Marine Sponge)0.56%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2035265000Freshwater microbial communities from Swedish Lakes - surface of Lake ErkenEnvironmentalOpen in IMG/M
3300001951Marine microbial communities from North Seamore Island, Equador - GS034EnvironmentalOpen in IMG/M
3300001954Marine microbial communities from Colon, Panama - GS019EnvironmentalOpen in IMG/M
3300001961Marine microbial communities from Dirty Rock, Cocos Island, Costa Rica - GS025EnvironmentalOpen in IMG/M
3300002482Marine viral communities from the Pacific Ocean - ETNP_2_30EnvironmentalOpen in IMG/M
3300002483Marine viral communities from the Pacific Ocean - ETNP_6_30EnvironmentalOpen in IMG/M
3300002488Marine viral communities from the Pacific Ocean - ETNP_2_60EnvironmentalOpen in IMG/M
3300005404Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV205EnvironmentalOpen in IMG/M
3300006024Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_DCM_ad_63m_LV_BEnvironmentalOpen in IMG/M
3300006413Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0025mEnvironmentalOpen in IMG/M
3300006480Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_1_0075mEnvironmentalOpen in IMG/M
3300006637Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNAEnvironmentalOpen in IMG/M
3300006754Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaGEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006928Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaGEnvironmentalOpen in IMG/M
3300006929Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaGEnvironmentalOpen in IMG/M
3300006990Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaGEnvironmentalOpen in IMG/M
3300007069Marine sponge Cinachyra sp. microbiome, Papua New Guinea CO2seep, Dobu 'bubble', cg4adsHost-AssociatedOpen in IMG/M
3300007112Marine sponge Stylissa sp. microbiome, Papua New Guinea CO2seep, Dobu 'control', st5dcHost-AssociatedOpen in IMG/M
3300007234Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNAEnvironmentalOpen in IMG/M
3300007344Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4EnvironmentalOpen in IMG/M
3300007346Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31EnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007541Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaGEnvironmentalOpen in IMG/M
3300007542Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaGEnvironmentalOpen in IMG/M
3300007960Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaGEnvironmentalOpen in IMG/M
3300008097Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_DCM_ad_131m_LV_B (version 2)EnvironmentalOpen in IMG/M
3300009056Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3EnvironmentalOpen in IMG/M
3300009181Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaGEnvironmentalOpen in IMG/M
3300009481Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaGEnvironmentalOpen in IMG/M
3300009504Lake sediment microbial communities from Walker lake, Nevada to study Microbial Dark Matter (Phase II) - Walker Lake 11/02/13 Deep SedimentEnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300009703Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaGEnvironmentalOpen in IMG/M
3300009790Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 MetagenomeEnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300010300Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNAEnvironmentalOpen in IMG/M
3300010318Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNAEnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300011013Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaGEnvironmentalOpen in IMG/M
3300012013Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface IceEnvironmentalOpen in IMG/M
3300012919Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaGEnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300012950Marine microbial communities from the Central Pacific Ocean - Fk160115 155m metaGEnvironmentalOpen in IMG/M
3300012952Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 MetagenomeEnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300013087Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30LEnvironmentalOpen in IMG/M
3300015050Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017716Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.DEnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017724Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17EnvironmentalOpen in IMG/M
3300017726Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24EnvironmentalOpen in IMG/M
3300017729Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11EnvironmentalOpen in IMG/M
3300017731Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16EnvironmentalOpen in IMG/M
3300017733Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23EnvironmentalOpen in IMG/M
3300017735Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21EnvironmentalOpen in IMG/M
3300017737Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2)EnvironmentalOpen in IMG/M
3300017738Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12EnvironmentalOpen in IMG/M
3300017740Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13EnvironmentalOpen in IMG/M
3300017744Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23EnvironmentalOpen in IMG/M
3300017746Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29EnvironmentalOpen in IMG/M
3300017753Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26EnvironmentalOpen in IMG/M
3300017757Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22EnvironmentalOpen in IMG/M
3300017758Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30EnvironmentalOpen in IMG/M
3300017760Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16EnvironmentalOpen in IMG/M
3300017765Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28EnvironmentalOpen in IMG/M
3300017768Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2)EnvironmentalOpen in IMG/M
3300017770Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2)EnvironmentalOpen in IMG/M
3300017771Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13EnvironmentalOpen in IMG/M
3300017781Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017785Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300020189Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071401CT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020222Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015034 Kigoma Deep Cast 250mEnvironmentalOpen in IMG/M
3300020267Marine microbial communities from Tara Oceans - TARA_B100000927 (ERX556026-ERR599108)EnvironmentalOpen in IMG/M
3300020325Marine microbial communities from Tara Oceans - TARA_B100000034 (ERX556073-ERR598966)EnvironmentalOpen in IMG/M
3300020367Marine microbial communities from Tara Oceans - TARA_B100000508 (ERX556112-ERR599005)EnvironmentalOpen in IMG/M
3300020379Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556001-ERR599168)EnvironmentalOpen in IMG/M
3300020386Marine microbial communities from Tara Oceans - TARA_B100000609 (ERX555990-ERR599038)EnvironmentalOpen in IMG/M
3300020392Marine microbial communities from Tara Oceans - TARA_B100000963 (ERX555916-ERR599163)EnvironmentalOpen in IMG/M
3300020394Marine microbial communities from Tara Oceans - TARA_B000000557 (ERX556068-ERR599026)EnvironmentalOpen in IMG/M
3300020395Marine microbial communities from Tara Oceans - TARA_B100000427 (ERX555987-ERR599133)EnvironmentalOpen in IMG/M
3300020397Marine microbial communities from Tara Oceans - TARA_B100000123 (ERX556052-ERR599075)EnvironmentalOpen in IMG/M
3300020421Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556005-ERR599007)EnvironmentalOpen in IMG/M
3300020428Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556032-ERR599094)EnvironmentalOpen in IMG/M
3300020437Marine microbial communities from Tara Oceans - TARA_B100000282 (ERX555906-ERR599074)EnvironmentalOpen in IMG/M
3300020445Marine microbial communities from Tara Oceans - TARA_B100001996 (ERX555961-ERR599087)EnvironmentalOpen in IMG/M
3300020451Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996)EnvironmentalOpen in IMG/M
3300020457Marine microbial communities from Tara Oceans - TARA_B100001113 (ERX555941-ERR599014)EnvironmentalOpen in IMG/M
3300020459Marine microbial communities from Tara Oceans - TARA_X000000368 (ERX555913-ERR599095)EnvironmentalOpen in IMG/M
3300020472Marine microbial communities from Tara Oceans - TARA_B100001250 (ERX556017-ERR598995)EnvironmentalOpen in IMG/M
3300021364Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304EnvironmentalOpen in IMG/M
3300021376Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surfaceEnvironmentalOpen in IMG/M
3300021550Marine sponge Stylissa sp. microbiome, Papua New Guinea CO2seep, Upa-Upasina 'control', st9ic 200bp no Eukaryotes lastHost-AssociatedOpen in IMG/M
3300021960Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9DEnvironmentalOpen in IMG/M
3300022066Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 (v2)EnvironmentalOpen in IMG/M
3300022074Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2)EnvironmentalOpen in IMG/M
3300022167Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v2)EnvironmentalOpen in IMG/M
3300022176Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2)EnvironmentalOpen in IMG/M
3300022198Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022200Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022553Powell_combined assemblyEnvironmentalOpen in IMG/M
3300023116Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaGEnvironmentalOpen in IMG/M
3300023117Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409AT metaGEnvironmentalOpen in IMG/M
3300023174Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505EnvironmentalOpen in IMG/M
3300024354Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8dEnvironmentalOpen in IMG/M
3300025096Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025103Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025110Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025132Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes)EnvironmentalOpen in IMG/M
3300025151Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025610Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025630Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025646Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025647Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025655Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025687Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025751Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025759Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)EnvironmentalOpen in IMG/M
3300025818Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027888Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-30_32 (SPAdes)EnvironmentalOpen in IMG/M
3300027906Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027917Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes)EnvironmentalOpen in IMG/M
3300028025Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FCEnvironmentalOpen in IMG/M
3300029318Marine giant viral communities collected during Tara Oceans survey from station TARA_038 - TARA_Y100000289EnvironmentalOpen in IMG/M
3300029792Marine giant viral communities collected during Tara Oceans survey from station TARA_041 - TARA_Y100000052EnvironmentalOpen in IMG/M
3300031669Soil microbial communities from Risofladan, Vaasa, Finland - TR-1EnvironmentalOpen in IMG/M
3300031772Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20EnvironmentalOpen in IMG/M
3300031774Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915EnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300031785Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-25_MGEnvironmentalOpen in IMG/M
3300032011Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416EnvironmentalOpen in IMG/M
3300032047Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915EnvironmentalOpen in IMG/M
3300032073Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416EnvironmentalOpen in IMG/M
3300034012Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027EnvironmentalOpen in IMG/M
3300034019Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049EnvironmentalOpen in IMG/M
3300034021Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057EnvironmentalOpen in IMG/M
3300034063Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053EnvironmentalOpen in IMG/M
3300034104Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ErSWdraft_47762602035265000FreshwaterMTIQVFSLTEKNILPLINRPVVQAGANFTSANSTTAPKLRGLTLQRGQSLYAAFSGATSLTNGFYVNVEAGYY
GOS2249_100683313300001951MarineNQVISTTLQKTLPLINHPTVQAGTNFTGTNNEVAPKQRGLMLRRGQALFVAASGATALTNGFFCNVQGGFY*
GOS2235_100082123300001954MarineNHPTVQAGSNFGSANNALAPKQRGLMLKRGQALYVAASGANALTNGFYCNVQGGFY*
GOS2240_101032043300001961MarineYKSSTVQAGANFGSANNALAPKQRGLMLKRGQALYVAASGANALTNGFYCNVQGGFY*
JGI25127J35165_105374523300002482MarineTTLTEKLPLINHPTVQSGALNFAGSNNEIAPKQRGLMLRRGQALYVAASGATALTNGFYCNVQGGFY*
JGI25127J35165_107265713300002482MarineLSTTLTEKLPLINHPTVQSGALNFAGSNNEIAPKQRGLMLRRGQALYVAASGATALTNGFYCNIQGGFY*
JGI25132J35274_101256223300002483MarineQSYSLSEQKILPFINHPTVQAGANFGSANNALAPKQRGLMLKRGXALYVAASGANAXTNGFYCNVQGGFY*
JGI25132J35274_106282213300002483MarineENQILSTTLTEKLPLINHPTVQSGALNFAGSNNEIAPKQRGLMLRRGQALYVAASGATALTNGFYCNIQGGFY*
JGI25132J35274_109966813300002483MarineDCSQQSYSLSEQKILPFINHPTVQAGANFGSANNSLAPKQRGLMLKRGQALYVAASGATALTNGFYCNVQGGFY*
JGI25132J35274_110500513300002483MarineNHPTVQAGANFGSANNALAPKQRGLMLKRGQALYVAASGANALTNGFYCNVQGGFY*
JGI25128J35275_107062033300002488MarineSVASKQNYSLTLNEELPLINHPVVQAGSNFGSGNNEVAPKQRGLMLKRGQALYVAASGATALTTGFYCNVQGGYY*
JGI25128J35275_108287213300002488MarineDSVASKQNYSLTLNEELPLINHPVVQAGSNFGSGNNEVAPKQRGLMLKRGQALYVAASGATALTTGFYCNVQGGYY*
JGI25128J35275_110754423300002488MarineNEVLPFINHPTVQAGSNFGSANNEIAPKQRGLMLKRGQALYVAASGATALTNGFYCNVQGGFY*
Ga0066856_1036412513300005404MarineLPLINHPVVQAGNNFGSANNEIAPKQRGLMLKRGQALYVAASGTTALTTGFYCNVQGGYY
Ga0066371_1005925313300006024MarineLPLINHPVVQAGSNFGSANNEVAPKQRGLMLKRGQALYVSVSGTAALTNGFYCNIQGGYY
Ga0099963_129611123300006413MarineSLSEQKILPFINHPTVQAGANFGSANNALAPKQRGLMLKRGQALYVAASGATALTNGFYCNVQGGFY*
Ga0100226_157110313300006480MarineHFPLEKLPLINHPTVQSGALNFAGSNNEIAPKQRGLMLRRGQALYVAASGSTALTNVFYCNVQGGFY*
Ga0075461_1020405923300006637AqueousIASVPATYDNQYYSLTQNNVLPLINHPVVQAGSNFTSANSTTAPKMRGLMLQRGQALYVSVSGATSLSNGFYFGVQAGYY*
Ga0098044_131460513300006754MarineCSLTLKGVLPYINHPVAQSGANVSSSNSNILPKQRGLMLQRGQALYCSVSGATALTNGFYCNVQAGYY*
Ga0098054_111576113300006789MarineASIDAVAATQYCSLTLKEVLPLINHPVVQAGSNFGSANNEIAPKQRGLMLKRGQALYVSVSGTAALTNGFYCNIQGGYY*
Ga0070749_1024773913300006802AqueousVSIPATYEHQYYSLTEYNVLPLINHPTVQAGSNFYTANSATAPKIRGMMLKRGQALYAAYSGTTALTNGFYVTAQGGYY*
Ga0070754_1050316033300006810AqueousSLTEKQILPLINHPVPHAGGNFSSATSSVSPKIRGLVVQRGQALYASVSGTTSLTNGFYVNVQGGYY*
Ga0098041_103288413300006928MarineTLNEELPLINHPVVQAGTNFTSANNEVAPKQRGLMLKRGQALFVAASGTTALTTGFYCNVQGGYY*
Ga0098036_120506523300006929MarineLPFINHPVVQAGTNMGSANSSKALKSRGLMLKRGQALYAAVSGSTALTNGFYVGVQGGFY
Ga0098046_101063213300006990MarineSLTDKEDLPFINHPVVQAGTNMGSANSSKALKSRGLMLKRGQALYAAVSGSTALTNGFYVGVQGGFY*
Ga0101646_101865913300007069Cinachyra Sp. (Marine Sponge)VSSVEAVGSEVVYSLTDKEDLPFINHPVVQAGTNMGSANSNKALKSRGLMLKRGQALYAAVSGSTALTNGFYVGVQGGFY*
Ga0101560_109133723300007112Stylissa Sp. (Marine Sponge)DKPFYSLTLEEILPFINHPTVQAGANFGSANNEIAPKQRGLMLRRGQALYVAASGSTALTNGFYCNVQGGFY*
Ga0075460_1025623213300007234AqueousTYDNQYYSLTQNNVLPLINHPVVQAGSNFTSANSTTAPKMRGLMLQRGQALYVSVSGATSLSNGFYFGVQAGYY*
Ga0070745_119238023300007344AqueousLTEKGVLPLINHPVVQAGANFGSANSSTSPKMRGLMLQRGQALYAAVSGATSLANGFYVNVQAGYY*
Ga0070753_128955013300007346AqueousNVEATPSDQEYSLTLKEKLPLINHPVPHAGSNFGSANNEVSPKMRGLMLPRGVALYAAVSGTTALTNGFYVNIQAGYY*
Ga0099849_102980113300007539AqueousNQFYSLTLNNVLPLINHPVVQAGTNFTSTNSTTSPKMRGMMLQRGQALYIAVSGGTSLTNGFYVGVQGGYY*
Ga0099847_106822633300007540AqueousINHPVPHAGANFGSANNEIAPKMRGLILPRGSALYAAASGTTALTSGFYINVQGGYY*
Ga0099848_100774713300007541AqueousVASIPATYANQYFSLTEYAILPLINHPTVQAGTNFYSTNSTVSPKNRGLMLKRGQALYAAFSGATALTNGFYVTCQGGYY*
Ga0099846_134481513300007542AqueousLFVASVPSIVDDQFYSLTLKEVLPFINHPVVQAGSNFVTANNEVAPKQRGLMLQRGQAIYAAVSGTTALTNGFYVNVQAGYY*
Ga0099850_124424833300007960AqueousIESVAADQSYSLTLKEKLPLVNHPVPHAGANFGSANNEVAPKMRGLMLPRGTALYAAASGTTALTNGFYVNVQAGYY*
Ga0111541_1004145123300008097MarineVANLPSTPTYENCSLSMKGVLPFINHPTVQAGANVTSTNSNVSPKNRGLMLKRGQALYCAASGSTALRNGFYCNVQGGYY*
Ga0102860_124084833300009056EstuarineNEVLPLINHPVPHAGANFGSANNEVSPKMRGLVMERGQALYAAVSGTTALTNGFYVCVQGGFY*
Ga0114969_1056148013300009181Freshwater LakeYDNQVFSLTEKNILPLINRPVVQAGANFTSANSTTAPKLRGLTLQRGQSLYAAFSGATSLTNGFYVNVEAGYY*
Ga0114932_1048608913300009481Deep SubsurfacePLINHPVVQAGSNFGSANNEIAPKQRGLMLKRGQALYVSVSGTAALTNGFYCNIQGGYY*
Ga0114946_1047837913300009504SedimentLPLFVASIPSTFDNQFYSLTLNGVLPLISHPVVQAGANVTSANSSISPKLRGLMLQRGQALYVAASGSTALTNGFYVSVQGGYY*
Ga0115011_1023931323300009593MarinePTVQAGANFGGANAAHAPKQRGLMLKRGQAIYAAVEGTTAITFGFYINVQGGFY*
Ga0115011_1035259723300009593MarineNHPTVQSGAANWGSANNEIAPKQRGLMLKRGQALYVSASGTAALTNGFYCNVQGGYY*
Ga0114933_1045633523300009703Deep SubsurfaceFVASIDAVAATQYCSLTLKEVLPLINHPVVQAGSNFGSANNEIAPKQRGLMLKRGQALYVSVSGTAALTNGFYCNIQGGYY*
Ga0115012_1042971523300009790MarineAAKQLYSTTLHEDLPLINHPVVQAGSNFTSANNEVAPKQRGIMLKRGQALYVASTGSTALTTGFYCNVQGGYY*
Ga0115012_1048629223300009790MarineFSLTLNEVLPLINHPVVQAGTNFGSANNEVAPKQRGLMLKRGQALYVAASGATALTTGFYCNIQGGYY*
Ga0115012_1068570213300009790MarinePTVQSGALNFAGSNNEIAPKQRGLMLKRGQALYVAASGATALTNGFYCNVQGGYY*
Ga0115012_1163227813300009790MarineTVQAGTNFTSANNEVAPKQRGLMLKRGQALYASVGGTVALTYPFYANVQGGYY*
Ga0098049_114544513300010149MarineLFIASLPSTSTYQTCSLTLKGTLPLINHPVAQSGNNVSSSNSNILPKQRGLMLQRGQALYCSVGGATSLTNGFYCNVQAGYY*
Ga0129351_100927513300010300Freshwater To Marine Saline GradientTLKEKLPLINHPVPHAGANFSSNNNEVSPKMRGLMLPRGTALYAAVSGTVALTNGFYVNVQSGYY*
Ga0136656_116971513300010318Freshwater To Marine Saline GradientEKLPLINHPVPHAGANFSSNNNEVSPKMRGLMLPRGTALYAAVSGTVALTNGFYINVQSGYY*
Ga0129333_1078332323300010354Freshwater To Marine Saline GradientIPAVYENQTYSLTINNVLPLINHPVVQAGTNFTSTNSTTSPKTRGLILQRGQALYVAASGATALTSGFYVGVQAGYY*
Ga0133913_1231059513300010885Freshwater LakeTYENVEYSLTTNLVLPYINHPVPQAGANFTSTNSTVSPKMRGLMLQRGQALYVSVSGTTSLTNGFYCNVQAGYY*
Ga0114934_1008348613300011013Deep SubsurfaceYCSLTLKEVLPLINHPVVQAGSNFGSANNEIAPKQRGLMLKRGQALYVSVSGTAALTNGFYCNIQGGYY*
Ga0153805_101280523300012013Surface IceVEYSLTTNLVLPLINHPVPQAGANFSSTNSTVSPKMRGLMLQRGQALYVSVSGTTSLTNGFYCNVQAGYY*
Ga0160422_1062515513300012919SeawaterQYYSLTLNEILPLINHPTVQAGSNFGSGNNEIAPKQRGLMLKRGQALYVAASGATALTNGFYCNVQGGFY*
Ga0160422_1073572013300012919SeawaterPLINHPVVQAGSNFGSGNNEVAPKQRGLMLKRGQALYVAASGSTALTTGFYCNVQGGYY*
Ga0160423_1003451653300012920Surface SeawaterFVSSVEAVGSEVVYSLTDKEDLPFINHPVVQAGTNMGSANSNKALKSRGLMLKRGQALYAAVSGSTALTNGFYVGVQGGFY*
Ga0160423_1032426723300012920Surface SeawaterEKLPLINHPTVQSGALNFAGSNNEIAPKQRGLMLKRGQALYVAASGATALTNGFYCNVQGGFY*
Ga0163108_1027329313300012950SeawaterVVQAGSNFGSANNEIAPKQRGLMLSRGQALYVSVSGATALTNGFYCNVQGGYY*
Ga0163180_1004962723300012952SeawaterLINHPVVQAGSNFGSGNNEVAPKQRGLMLKRGQALYVAASGSTALTTGFYCNVQGGFY*
Ga0163179_1021622413300012953SeawaterFTSSIDSVASKQNYSLTLNEELPLINHPVVQAGSNFGSGNNEVAPKQRGLMLKRGQALYVAASGTTALTTGFYCNVQGGYY*
Ga0163179_1061135213300012953SeawaterYSLTLNEELPLINHPVVQAGSNFGSGNNEVAPKQRGLMLKRGQALYVAASGATALTTGFYCNVQGGYY*
Ga0163212_105106913300013087FreshwaterSLTESNILPLINHPVVQAGANFTSTNSKTSPKIRGLILQRGQALYVATSGATALTNGFYVNVQAGFY*
Ga0181338_100353433300015050Freshwater LakeATYDNQSYSLTEQNILPLINRPVAQAGANFTSANSTTAPKLRGLTLQRGQSLYAAFSGATSLTNGFYVNVEAGYY*
Ga0181350_104536323300017716Freshwater LakeTTYDNQSYSLTEQNILPLINRPVVQAGANFTSANSTTAPKLRGLTLQRGQSLYAAFSGATSLTNGFYVNVEAGYY
Ga0181390_108169813300017719SeawaterVAENQILSTTLTEKLPLINHPVVQSGAANFAGANNEIAPKQRGLMLKRGQALYVAASGATALTNGFFCNLQGGFY
Ga0181388_115076913300017724SeawaterTTLTEKLPLINHPVVQSGAANFGASNNEIAPKQRGLMLRRGQALYVAASGATALTNGFYCNVQGGFY
Ga0181381_108229813300017726SeawaterVLPFINHPTVQAGSNFVTANNEVAPKQRGLMLKRGQALYVAASGATALTNGFYCNVQGGF
Ga0181396_108483723300017729SeawaterAATQYCSLTLKEVLPLINHPVVQAGSNFGSANNEIAPKQRGLMLKRGQALYVSVSGTAALTNGFYCNIQGGYY
Ga0181416_103632523300017731SeawaterLFSASIDSVASKQIFSLTLNEVLPLINHPVVQAGSNFTSANNEVAPKQRGLMLKRGQALYVAASGASALTTGFYCNVQGGFY
Ga0181426_112898413300017733SeawaterTLKEVLPLINHPVVQAGSNFGSANNEIAPKQRGLMLKRGQALYVSVSGTAALTNGFYCNIQGGYY
Ga0181431_101056213300017735SeawaterRIPLINHPVVQAGSNFGSANNEVAPKQRGLMLKRGQALYVSVSGTAALTNGFYCNIQGGY
Ga0181431_101071823300017735SeawaterPVVQAGNNFGSANNEIAPKQRGLMLKRGQALYVAASGTTALTTGFYCNVQGGYY
Ga0187218_100729243300017737SeawaterVVYSLTDKEDLPFINHPVVQAGTNMGSANSSKALKSRGLMLKRGQALYAAVSGANALTNGFYVGVQGGFY
Ga0181428_105195723300017738SeawaterLTLNEELPLINHPVVQAGTNFTSANNEVAPKQRGLMLKRGQALYVAASGTTALTTGFYCNIQGGYY
Ga0181428_105458413300017738SeawaterLSSIDSVAATQSCSLTLKEILPLINHPVVQAGSNFGSANNEVAPKQRGLMLKRGQALYVSVSGTAAL
Ga0181418_106135023300017740SeawaterDSVASKQNYSLTLNEELPLINHPVVQAGTNFTSANNEVAPKQRGLMLKRGQALYVAASGSTALTTGFYCNVQGGYY
Ga0181418_114060013300017740SeawaterLSTTLTEKLPLINHPVVQSGAANFAGANNEIAPKQRGLMLKRGQALYVAASGATALTNGFFCNLQGGFY
Ga0181397_105013323300017744SeawaterNEVLPFINHPTVQAGSNFVTANNEVAPKQRGLMLKRGQALYVAASGATALTNGFFCNLQGGFY
Ga0181389_109734523300017746SeawaterLHEDLPLINHPVVQAGSNFTSANNEVAPKQRGLMLKRGQALYVAASGSTALTTGFYCNVQGGYY
Ga0181407_101828213300017753SeawaterALVQAGSIFTSANNEVAPKQRGHMLTRGRALYVAASGSTALTTGFYCNVQGGFY
Ga0181420_118274423300017757SeawaterLTEKLPLINHPVVQSGAANFAGANNEIAPKQRGLMLKRGQALYVAASGATALTNGFYCNVQGGFY
Ga0181409_106874523300017758SeawaterYSLTLNKKLPLINHPTVQAGANFVSANNEVAPKQRGLLLERGQALYVAASGATALTNGFFCNLQGGFY
Ga0181409_114717113300017758SeawaterKEVLPLINHPVVQAGSNFGSANNEIAPKQRGLMLKRGQALYVSVSGTAALTNGFYCNIQGGYY
Ga0181408_107291113300017760SeawaterPFINHPTVQAGSNFVTANNEVAPKQRGLMLKRGQALYVAASGATALTNGFFCNLQGGFY
Ga0181408_111001323300017760SeawaterASKQIFSLTLNEVLPLINHPVVQAGTNFTSANNEVAPKQRGFMLKRGQALYVAASGATALTTGFYCNVQGGFY
Ga0181413_107496323300017765SeawaterASIDSVSTTQECSLTLKEILPLINHPVVQAGSNFGSANNEVAPKQRGLMLKRGQALYVSVSGTSALTNGFYCNIQGGYY
Ga0181413_112128113300017765SeawaterSKQIFSLTLNEVLPLINHPVVQAGNNFGSANNEVAPKQRGLMLKRGQALYVAASGSTALTTGFYCNVQGGYY
Ga0187220_104324323300017768SeawaterLPLINHPVVQAGSNFTSANNEVAPKQRGLMLKRGQALYVAASGSTALTTGFYCNVQGGFY
Ga0187220_117588823300017768SeawaterSKQNYSLTLNEELPLINHPVVQAGTNFTSANNEVAPKQRGFMLKRGQALYVAASGSTALSTGFYCNVQGGFY
Ga0187217_102019623300017770SeawaterNHPVVQAGTNMGSANSSKALKSRGLMLKRGQALYAAVSGANALTNGFYVGVQGGFY
Ga0181425_101069943300017771SeawaterEALGSEVVYSLTDKEDLPFINHPVVQAGTNMGSANSSKALKSRGLMLKRGQALYAAVSGATALTNGFYVGVQGGFY
Ga0181423_104196313300017781SeawaterSEVVYSLTDKEDLPFINHPVVQAGTNMGSANSSKALKSRGLMLKRGQALYAAVSGANALTNGFYVGVQGGFY
Ga0181423_122275613300017781SeawaterKQIFSLTLNEVLPLINHPVVQAGSNFTSANNEVAPKQRGLMLKRGQALYVAASGATALTTGFYCNVQGGFY
Ga0181380_101195813300017782SeawaterNHPVVQSGAANFAGANNEIAPKQRGLMLKRGQALYVAASGATALTNGFFCNLQGGFY
Ga0181355_131909923300017785Freshwater LakeASISSVYENQNYSLTLNSILPLINHPVVQAGANFSSANSTISPKSRGLMLQRGQALYVAASGGTALTNGFYVGVQAGYY
Ga0181578_1039805423300020189Salt MarshFYSLTLNEVLPFINHPVVQAGSNFVTANNEVAPKQRGLMLQRGQAIYAAVSGTTALTNGFYVNVQAGYY
Ga0194125_1003038883300020222Freshwater LakePSVYENQNYSLTINNILPLINHPVVQAGTNFTSTNSLTSPKTRGLMLQRGQALYVAAGGSVALTNGFYVGVQAGYY
Ga0211648_103003223300020267MarinePLINHPTVQAGSNFGSANNEIAPKQRGLMLKRGQALYVAASGANALTNGFYCNVQGGFY
Ga0211507_102631823300020325MarineYSLTVNEVLPLINHPVVQAGANFTGANSKVSPKLRGLMLSRGQALYAAASGASALTNGFYVGVQGGYY
Ga0211703_1020357913300020367MarinePFINHPTVQAGANFGSANNALAPKQRGLMLKRGQALYVAASGANALTNGFYCNVQGGFY
Ga0211652_1012214723300020379MarineTQNYSLTLNEELPLINHPVVQAGSNFGSGNNEVAPKQRGLMLKRGQALYVAASGTSALTTGFYCNVQGGYY
Ga0211582_1009027413300020386MarineQQEYSLTLNKKLPFINHPTVQAGSNFGSGNNEIAPKQRGLMLRRGQALYVAASGATALTNGFYCNVQGGFY
Ga0211666_1006501613300020392MarineQSIPQVAENQILSTTLKETLPLINHPTVQAGSNFGSANNEIAPKQRGLMLRRGQALFVAASGPTALTNGFYCNVQGGFY
Ga0211497_1028213523300020394MarineLFVASVDSSQQYYSLTLNEILPLINHPTVQAGSNFGSANNEIAPKQRGLMLKRGQALYVAASGATALTNGFYCNVQGGFY
Ga0211705_1006330013300020395MarineEELPLINHPVVQAGTNFTSANNEVAPKQRGLMLKRGQALYVAANGATALSTGFYCNVQGGYY
Ga0211705_1007539123300020395MarineVASKQNYSLTLNEELPLINHPVVQAGSNFGSGNNEVAPKQRGLMLKRGQALYVAASGSTALTTGFYCNVQGGYY
Ga0211583_1021934323300020397MarineVVQSGAANFGASNNEIAPKQRGLMLRRGQALYVAASGSTALTNGFYCNVQGGFY
Ga0211653_1041969123300020421MarineNHPVVQAGSNFGSANNEIAPKQRGLMLKRGQALYVSVSGTAALTNGFYCNIQGGYY
Ga0211521_1002721843300020428MarinePLFTASIDSVASKQTFSLTLNEVLPLINHPVVQAGNNFGSANNEVAPKQRGLMLKRGQALYVAASGATALTTGFYCNIQGGLY
Ga0211539_1022109913300020437MarineVSSVDAVAENLSYSLTIKKDLPLINHPTVQAGANFDGANSQIAPKQRGLMLRRGQALYAAVSGSTALTNGFYVGVQGGFY
Ga0211564_1011752423300020445MarineAVAATQYCSLTLKEILPLINHPVVQAGSNFGSANNEVAPKQRGLMLKRGQALYVSVSGTAALTNGFYCNIQGGYY
Ga0211473_1017247423300020451MarineLHEDLPLIKHPVVQAGSNFTSANNEVAPKQRGIMLKRGQALYVASTGSTALTTGFYCNVQGGYY
Ga0211643_1065162623300020457MarineDLPLINHPVVQAGSNFTSANNEVAPKQRGIMLKRGQALYIASSGSTALTTGFYCNVQGGY
Ga0211514_1004891223300020459MarineSKQTFSLTLNEVLPLINHPVVQAGNNFGSANNEVAPKQRGLMLKRGQALYVAASGATALTTGFYCNIQGGLY
Ga0211514_1018121423300020459MarineLINHPVVQAGSNFGSANNEIAPKQRGLMLKRGQALYVSVSGTAALTNGFYCNIQGGYY
Ga0211579_1039902123300020472MarineQNYSLTLNEELPLINHPVVQAGSNFGSGNNEVAPKQRGLMLKRGQALYVAASGATALTTGFYCNVQGGYY
Ga0211579_1048190523300020472MarineASKQNYSLTLNEELPLINHPVVQAGTNFTSANNEVAPKQRGLMLKRGQALYVAASGSTALTTGFYCNVQGGFY
Ga0213859_1048709523300021364SeawaterLINHPTVQAGGNFDSATRQIAPKQRGLMLRRGQAIYAAVSGATALTNGFYVGVQGGFY
Ga0194130_1009999723300021376Freshwater LakeNQFFSLTESNILPLINHPVVQAGANFTSTNSKTSPKIRGLILQRGQALYVATSGATALTNGFYVNVQAGFY
Ga0224715_110557813300021550Stylissa Sp. (Marine Sponge)VSSVEAVGSEVVYSLTDKEDLPFINHPVVQAGTNMGSANSNKALKSRGLMLKRGQALYAAVSGSTALTNGFYVGVQGGFY
Ga0222715_1026253313300021960Estuarine WaterKEKLPLINHPVPHAGANFGSANNEIAPKMRGLILPRGSALYAAASGTTALTSGFYINVQGGYY
Ga0224902_10421623300022066SeawaterQILSTTLTEKLPLINHPVVQSGAANFGASNNEIAPKQRGLMLRRGQALYVAASGATALTNGFYCNLQGGFY
Ga0224906_101249013300022074SeawaterLASEVVYSLTDKEDLPFINHPVVQAGTNMGSANSSKALKSRGLMLKRGQALYAAVSGANALTNGFYVGVQGGFY
Ga0212020_106280113300022167AqueousKLPLINHPVPHAGANFGSANNEIAPKMRGLILPRGSALYAAASGTTALTSGFYINVQGGY
Ga0212031_100266123300022176AqueousVASIPATYANQYFSLTEYAILPLINHPTVQAGTNFYSTNSTVSPKNRGLMLKRGQALYAAFSGATALTNGFYVTCQGGYY
Ga0196905_108341423300022198AqueousFYSLTLNEELPLINHPVPHAGGNFGSATNEVAPKNRGLVIQRGQAIYAAVGGTTNLTSGFYVCAQGGYY
Ga0196901_103311213300022200AqueousLDQTLPLINHPVPHAGANFGSANNLIAPKNRGLVLQRGQALYAAVSGTTSLTNGFYINVQGGYY
Ga0212124_1074780223300022553FreshwaterYSLTTNLVLPYINHPVPQAGANFTSTNSTVSPKMRGLMLQRGQALYVSVSGTTSLTNGFYCNVQAGYY
Ga0255751_1019951913300023116Salt MarshPFINHPVVQAGANFVTANNEVAPKQRGLILQRGQAIYAAVSGTTALTNGFYVNVQGGYY
Ga0255757_1019145823300023117Salt MarshLFVASIPSVVGDQTYSLTLEEVLPFINHPVVQAGSNFVTANNEVAPKQRGLILQRGQAIYAAVSGTTALTNGFYVNIQGGYY
Ga0214921_10012299123300023174FreshwaterVASVPATYENVEYSLTTNLVLPYINHPVPQAGANFTSTNSTVSPKMRGLMLQRGQALYVSVSGTTSLTNGFYCNVQAGYY
Ga0255171_104382513300024354FreshwaterYSLTLNEVLPLINHPVPHAGANFGSANNEVSPKMRGLVMERGQALYAAVSGTTALTNGFYVCVQGGFY
Ga0208011_100897633300025096MarineCSLTLKEVLPLINHPVVQAGSNFGSANNEIAPKQRGLMLKRGQALYVSVSGTAALTNGFYCNIQGGYY
Ga0208011_104144123300025096MarineNQYCSLTQKKILPFINHPVVQAGSNFVSAHNELAPKQRGLMLKRGQALYVSVSGTSALTNGFYCNIQGGYY
Ga0208013_101097533300025103MarineMKEILPLINHPTVQSGAANWGSANNEIAPKQRGLMLKRGQALYVSASGTAALTNGFYCNVQGGYY
Ga0208158_109792323300025110MarineEDLPFINHPVVQAGSNFVTTNNEVAPKQRGLMLKRGQALYVAATGSSALTTGFYCNVQGGYY
Ga0209232_106621113300025132MarineASKQNYSLTLNEELPLINHPVVQAGTNFTSANNEVAPKQRGLMLKRGQALYVAANGPTALSTGFYCNVQGGYY
Ga0209232_109757123300025132MarineDAVAATQYCSLTLKEVLPLINHPVVQAGSNFGSANNEIAPKQRGLMLKRGQALYVSVSGTAALTNGFYCNIQGGYY
Ga0209232_114130413300025132MarineSSIDSVASKQNYSLTLNEELPLINHPVVQAGSNFGSGNNEVAPKQRGLMLKRGQALYLAASGSTALTTGFYCNVQGGYY
Ga0209232_117792313300025132MarineSLTLKEVLPLINHPVVQAGSNFGSANNEVAPKQRGLMLKRGQALYVSVSGTAALTNGFYCNIQGGYY
Ga0209645_117802223300025151MarineLPLINHPVVQAGSNFGSGNNEVAPKQRGLMLKRGQALYVAASGSTALTTGFYCNVQGGYY
Ga0209645_121633613300025151MarineNQILSTTLTEKLPLINHPTVQSGALNFAGSNNEIAPKQRGLMLRRGQALYVAASGATALTNGFYCNIQGGFY
Ga0208149_107255133300025610AqueousPLINHPVPHAGANFGSANNEIAPKMRGLILPRGSALYAAASGTTALTSGFYINVQGGYY
Ga0208004_106855413300025630AqueousFPLFVVSIPATYDNQYYSLTENNVLPLINHPSVQAGANFSSSNSTTAPKIRGMMLKRGQALYVAYSGTTALTNGFYVTAQGGYY
Ga0208004_112235923300025630AqueousFIASVPATYDNQYYSLTQNNVLPLINHPVVQAGSNFTSANSTTAPKMRGLMLQRGQALYVSVSGATSLSNGFYFGVQAGYY
Ga0208161_104009513300025646AqueousPVFTASIPAIAANQVFSLTEKQILPLINHPVPHAGGNFSSATSSISPKMRGLVIQRGQALYAAVSGTTSLTNGFYVNVQGGYY
Ga0208161_105665423300025646AqueousLPFINHPVVQAGSNFVTANNEVAPKQRGLILQRGQAIYAAVSGTTALTNGFYVNVQGGYY
Ga0208161_111522923300025646AqueousFPLFVASIPATYENQYYSLTENNVLPLINHPTVQAGANFSSANSTTAPKIRGLMLKRGQALYAAFSGATALTNGFYVTCQGGYY
Ga0208160_108113423300025647AqueousTYENLTYSLSASGVLPLINHPVVQAGSAATTTAPKMRGLMMRKGQSLYVAASGASALTNGFYVNVQAGYY
Ga0208160_109354813300025647AqueousASIPAVYENQTYSLTINNVLPLINHPVVQAGTNFTSTNSTTSPKTRGLILQRGQALYVAASGATALTSGFYVGVQAGYY
Ga0208795_108751613300025655AqueousALINHPVVQAGTNFTSTNSTTSPKMRGMMLQRGQALYIAVSGGTSLTNGFYVGVQGGYY
Ga0208019_114117113300025687AqueousLLASVPAVYENITYSLTANNVLPLINHPVVQAGSASSTSAPKIRGLMLQRGQALYVAAGGATALTNGFYVNVQGGYY
Ga0208150_115234833300025751AqueousQSYSLTLKEKLPLINHPVPHAGANFGSANNEIAPKMRGLILPRGSALYAAASGTTALTSGFYINVQGGYY
Ga0208899_104236013300025759AqueousYSLTDKEDLPFINHPVVQAGTNMGSANSSKALKSRGLMLKRGQALYAAVSGANALTNGFYVGVQGGFY
Ga0208542_116937713300025818AqueousTYDNQYYSLTQNNVLPLINHPVVQAGSNFTSANSTTAPKMRGLMLQRGQALYVSVSGATSLSNGFYFGVQAGYY
Ga0209635_1058319023300027888Marine SedimentLPFINHPVVQAGANFTTANNEVAAKHRGLVLQRGQALYAAVSGTTSLTNGFYVNVQAGYY
Ga0209404_1022262313300027906MarineYCSLTMKEVLPLINHPVVQAGSNFGSANNEIAPKQRGLMLKRGQALYVSVSGTAALTNGFYCNVQGGYY
Ga0209536_10169145523300027917Marine SedimentVPAVYEHITYSLTANNVLPLINHPVVQAGSASSTSAPKIRGLMLQRGQALYVAASGATALTNGFYVNVQGGYY
Ga0247723_115933323300028025Deep Subsurface SedimentPLFVASIPATYENLTFSLSAKGILPLINHPVVQAGSAATDSAPKMRGLMMRKGQALYVAASGAVALTNGFYVNVQGGYY
Ga0185543_105414723300029318MarineSTAANQSFSLTESGDLPLINHPVVQAGSNFDSANSKIAPKARGLMLKRGQALYAAASGASALTNGFYVGIQGGFY
Ga0183826_106369123300029792MarineSEQKILPFINHPTVQAGANFGSANNALAPKQRGLMLKRGQALYVAASGATALTNGFYCNVQGGFY
Ga0307375_1054213913300031669SoilFSLTLNSVLPLINHPVVQAGANFNSANSLISPKIRGLMLQRGQALYAAAGGSTSLTNGFYVGMQAGYY
Ga0315288_1029627823300031772SedimentASIPATFDNQYFSLTEKNILPLINHPVVQSGTNFTSANSTTSPKIRGLMLQRGQALYAAVSGPTSLTNGFYVGIQAGYY
Ga0315331_1096064813300031774SeawaterSLTLNEELPLINHPVVQAGNNFGSANNEIAPKQRGLMLKRGQSLYVAASGTTALTTGFYCNVQGGYY
Ga0315899_1070128413300031784FreshwaterVPAIAANQTYSLTLNEILPLINHPVPHAGDNFGSANNEVSPKTRGLVMERGQALYAAVSGTTALTSGFYVCVQGGFY
Ga0310343_1116703023300031785SeawaterNQILSTTLTEKLPLINHPTVQSGASNFAGSNNEIAPKQRGLMLRRGQALYVAASGSTALTNGFYCNVQGGFY
Ga0315316_1025496523300032011SeawaterTQSIPQVSENQILSTTLTEKLPLINHPVVQSGAANFGASNNEIAPKQRGLMLRRGQALYVAASGATALTNGFYCNVQGGFY
Ga0315316_1100771713300032011SeawaterAATQSCSLTLKEILPLINHPVVQAGSNFGSANNEVAPKQRGLMLKRGQALYVSVSGTAALTNGFYCNIQGGYY
Ga0315330_1035517913300032047SeawaterTLKEILPLINHPVVQAGSNFGSANNEVAPKQRGLMLKRGQALYVSVSGTSALTNGFYCNIQGGYY
Ga0315315_1089055613300032073SeawaterTTQECSLTLKEILPLINHPVVQAGSNFGSANNEVAPKQRGLMLKRGQALYVSVSGTSALTNGFYCNIQGGYY
Ga0315315_1099869913300032073SeawaterSIDAVAATQSCSLTLKEILPLINHPVVQAGSNFGSANNEVAPKQRGLMLKRGQALYVSVSGTAALTNGFYCNIQGGYY
Ga0315315_1132289423300032073SeawaterQQSYSCTLNEVLPFINHPTVQAGSNFGSANNEIAPKQRGLMLKRGQALYVAASGATALTNGFYCNVQGGFY
Ga0334986_0122612_1_2373300034012FreshwaterSIPATYENQLYSLTINNVLPLINHPVVQAGANFTSTNSTTSPKTRGLILQRGQALYVAASGATALTNGFYVGVQAGYY
Ga0334998_0160685_1194_14303300034019FreshwaterSIPAVYENQNFSLTLNSILPLINHPVVQAGANFSSTNSTVSPKIRGLMMQRGQALYVAASGATSLTNGFYAGVQAGYY
Ga0335004_0405557_588_7703300034021FreshwaterLPLINHPVPQAGANFTSTNSLTSPKIRGLMLQRGQALYAAVSGPTALTNGFYVGVQGGYY
Ga0335000_0243179_3_2033300034063FreshwaterLTEYDILPLINHPTVQAGSNFFTANSATSPKIRGMMLKRGQALYASYSGTTALTSGFYVTAQGGYY
Ga0335031_0571707_200_4003300034104FreshwaterMTLNNVLPLINHPVVQAGANFTSTNSTTSPKTRGLILQRGQALYVATSGATSLTNGFYIGVQAGFY


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.