| Basic Information | |
|---|---|
| Family ID | F032814 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 179 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MDYTKLNCPPFTAEEAAMIQSTRIRVGRNLADFPLGPGISRE |
| Number of Associated Samples | 139 |
| Number of Associated Scaffolds | 171 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Eukaryota |
| % of genes with valid RBS motifs | 20.22 % |
| % of genes near scaffold ends (potentially truncated) | 36.31 % |
| % of genes from short scaffolds (< 2000 bps) | 74.86 % |
| Associated GOLD sequencing projects | 135 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Eukaryota (68.715 % of family members) |
| NCBI Taxonomy ID | 2759 |
| Taxonomy | All Organisms → cellular organisms → Eukaryota |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (7.821 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.961 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (41.899 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 24.29% β-sheet: 0.00% Coil/Unstructured: 75.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 171 Family Scaffolds |
|---|---|---|
| PF00217 | ATP-gua_Ptrans | 71.35 |
| PF02807 | ATP-gua_PtransN | 11.11 |
| PF10262 | Rdx | 1.17 |
| COG ID | Name | Functional Category | % Frequency in 171 Family Scaffolds |
|---|---|---|---|
| COG3869 | Protein-arginine kinase McsB | Posttranslational modification, protein turnover, chaperones [O] | 71.35 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 85.47 % |
| Unclassified | root | N/A | 14.53 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459014|G1P06HT01B48W8 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 614 | Open in IMG/M |
| 3300000557|SL_8KL_010_SEDDRAFT_10046617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Moritellaceae → Moritella → unclassified Moritella → Moritella sp. | 2024 | Open in IMG/M |
| 3300000557|SL_8KL_010_SEDDRAFT_10046617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Moritellaceae → Moritella → unclassified Moritella → Moritella sp. | 2024 | Open in IMG/M |
| 3300002835|B570J40625_101066870 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 685 | Open in IMG/M |
| 3300004112|Ga0065166_10181891 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 819 | Open in IMG/M |
| 3300004128|Ga0066180_10350089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Arcobacteraceae → Arcobacter | 584 | Open in IMG/M |
| 3300004463|Ga0063356_101453344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Arcobacteraceae → Arcobacter | 1012 | Open in IMG/M |
| 3300004765|Ga0007745_1296287 | Not Available | 552 | Open in IMG/M |
| 3300004767|Ga0007750_1552833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Sulfurospirillum → Sulfurospirillum arcachonense | 2854 | Open in IMG/M |
| 3300004767|Ga0007750_1552833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Sulfurospirillum → Sulfurospirillum arcachonense | 2854 | Open in IMG/M |
| 3300004769|Ga0007748_11266541 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300004769|Ga0007748_11356583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae | 736 | Open in IMG/M |
| 3300004794|Ga0007751_11266424 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1124 | Open in IMG/M |
| 3300004795|Ga0007756_11535096 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 1053 | Open in IMG/M |
| 3300004810|Ga0007757_11275092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales | 569 | Open in IMG/M |
| 3300005662|Ga0078894_10065583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Arcobacteraceae → Arcobacter | 3121 | Open in IMG/M |
| 3300005662|Ga0078894_10221653 | Not Available | 1713 | Open in IMG/M |
| 3300005961|Ga0075157_10390776 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 521 | Open in IMG/M |
| 3300005987|Ga0075158_10021779 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae | 3880 | Open in IMG/M |
| 3300005987|Ga0075158_10146252 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 1366 | Open in IMG/M |
| 3300005987|Ga0075158_10193101 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae | 1172 | Open in IMG/M |
| 3300005987|Ga0075158_10311743 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 891 | Open in IMG/M |
| 3300005988|Ga0075160_10020088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Sulfurovaceae | 3623 | Open in IMG/M |
| 3300005988|Ga0075160_10081943 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae | 1774 | Open in IMG/M |
| 3300005989|Ga0075154_10034488 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 3156 | Open in IMG/M |
| 3300005989|Ga0075154_10091281 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 1823 | Open in IMG/M |
| 3300006129|Ga0007834_1126516 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Tunicata → Appendicularia → Copelata → Oikopleuridae → Oikopleura → Oikopleura dioica | 526 | Open in IMG/M |
| 3300006165|Ga0075443_10301183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales | 589 | Open in IMG/M |
| 3300006356|Ga0075487_1265573 | Not Available | 602 | Open in IMG/M |
| 3300006419|Ga0075496_1495683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae | 815 | Open in IMG/M |
| 3300006805|Ga0075464_10023153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria | 3238 | Open in IMG/M |
| 3300007242|Ga0075172_1347257 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae | 500 | Open in IMG/M |
| 3300007513|Ga0105019_1012271 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 6735 | Open in IMG/M |
| 3300007513|Ga0105019_1012271 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 6735 | Open in IMG/M |
| 3300007513|Ga0105019_1012271 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 6735 | Open in IMG/M |
| 3300007667|Ga0102910_1106959 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 650 | Open in IMG/M |
| 3300007722|Ga0105051_11214157 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae | 535 | Open in IMG/M |
| 3300007860|Ga0105735_1011113 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1490 | Open in IMG/M |
| 3300007860|Ga0105735_1027689 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae | 1050 | Open in IMG/M |
| 3300007862|Ga0105737_1205392 | Not Available | 521 | Open in IMG/M |
| 3300007955|Ga0105740_1023353 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 873 | Open in IMG/M |
| 3300007958|Ga0105743_1027752 | Not Available | 599 | Open in IMG/M |
| 3300008021|Ga0102922_1048287 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae | 1324 | Open in IMG/M |
| 3300008107|Ga0114340_1025235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales | 2763 | Open in IMG/M |
| 3300008108|Ga0114341_10018399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae | 5025 | Open in IMG/M |
| 3300008116|Ga0114350_1195691 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 504 | Open in IMG/M |
| 3300008117|Ga0114351_1111585 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1574 | Open in IMG/M |
| 3300008119|Ga0114354_1018263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales | 3183 | Open in IMG/M |
| 3300008119|Ga0114354_1018263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales | 3183 | Open in IMG/M |
| 3300008119|Ga0114354_1033611 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 2260 | Open in IMG/M |
| 3300008119|Ga0114354_1092859 | Not Available | 1856 | Open in IMG/M |
| 3300009071|Ga0115566_10500620 | Not Available | 689 | Open in IMG/M |
| 3300009151|Ga0114962_10708154 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 514 | Open in IMG/M |
| 3300009154|Ga0114963_10363895 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 791 | Open in IMG/M |
| 3300009160|Ga0114981_10298560 | Not Available | 874 | Open in IMG/M |
| 3300009180|Ga0114979_10700451 | Not Available | 573 | Open in IMG/M |
| 3300009218|Ga0103848_1095408 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 599 | Open in IMG/M |
| 3300009422|Ga0114998_10408005 | Not Available | 635 | Open in IMG/M |
| 3300009436|Ga0115008_10826795 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 680 | Open in IMG/M |
| 3300009442|Ga0115563_1340724 | Not Available | 540 | Open in IMG/M |
| 3300009455|Ga0114939_10033664 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 2281 | Open in IMG/M |
| 3300009495|Ga0115571_1145138 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii | 999 | Open in IMG/M |
| 3300009538|Ga0129287_10011240 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 4212 | Open in IMG/M |
| 3300009592|Ga0115101_1336959 | All Organisms → cellular organisms → Eukaryota | 3458 | Open in IMG/M |
| 3300009599|Ga0115103_1459831 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 2680 | Open in IMG/M |
| 3300009599|Ga0115103_1614158 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 2165 | Open in IMG/M |
| 3300009608|Ga0115100_10244113 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 978 | Open in IMG/M |
| 3300009677|Ga0115104_10692013 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 661 | Open in IMG/M |
| 3300009785|Ga0115001_10172755 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1404 | Open in IMG/M |
| 3300010430|Ga0118733_109372430 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii | 504 | Open in IMG/M |
| 3300010883|Ga0133547_11814700 | Not Available | 1127 | Open in IMG/M |
| 3300010885|Ga0133913_10508059 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 3175 | Open in IMG/M |
| 3300012030|Ga0136599_1019098 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 992 | Open in IMG/M |
| 3300012415|Ga0138263_1239360 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 628 | Open in IMG/M |
| 3300012504|Ga0129347_1017634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria | 1182 | Open in IMG/M |
| 3300012504|Ga0129347_1126484 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1267 | Open in IMG/M |
| 3300012520|Ga0129344_1279872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales | 2590 | Open in IMG/M |
| 3300012525|Ga0129353_1961838 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 517 | Open in IMG/M |
| 3300012528|Ga0129352_10135878 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 1038 | Open in IMG/M |
| 3300012711|Ga0157607_1231119 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 1323 | Open in IMG/M |
| 3300012715|Ga0157599_1087162 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 1145 | Open in IMG/M |
| 3300012723|Ga0157604_1147755 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1965 | Open in IMG/M |
| 3300012731|Ga0157616_1151418 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 594 | Open in IMG/M |
| 3300012756|Ga0138272_1153727 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 2942 | Open in IMG/M |
| 3300012782|Ga0138268_1624667 | Not Available | 770 | Open in IMG/M |
| 3300012952|Ga0163180_11538459 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 557 | Open in IMG/M |
| 3300013006|Ga0164294_10900458 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae | 595 | Open in IMG/M |
| 3300013087|Ga0163212_1202355 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae | 621 | Open in IMG/M |
| 3300013295|Ga0170791_16077813 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 746 | Open in IMG/M |
| 3300014493|Ga0182016_10275002 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1042 | Open in IMG/M |
| 3300017299|Ga0186338_1001274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria | 2985 | Open in IMG/M |
| 3300017788|Ga0169931_10077258 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 3334 | Open in IMG/M |
| 3300018871|Ga0192978_1011542 | All Organisms → cellular organisms → Eukaryota | 1507 | Open in IMG/M |
| 3300019048|Ga0192981_10218126 | Not Available | 740 | Open in IMG/M |
| 3300019117|Ga0193054_1010356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales | 1236 | Open in IMG/M |
| 3300019150|Ga0194244_10044945 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 708 | Open in IMG/M |
| 3300020109|Ga0194112_10781391 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Tunicata → Appendicularia → Copelata → Oikopleuridae → Oikopleura → Oikopleura dioica | 627 | Open in IMG/M |
| 3300020146|Ga0196977_1002204 | All Organisms → cellular organisms → Eukaryota | 6357 | Open in IMG/M |
| 3300020146|Ga0196977_1002204 | All Organisms → cellular organisms → Eukaryota | 6357 | Open in IMG/M |
| 3300020146|Ga0196977_1007791 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 2696 | Open in IMG/M |
| 3300020183|Ga0194115_10042350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales | 2999 | Open in IMG/M |
| 3300020190|Ga0194118_10067473 | All Organisms → cellular organisms → Eukaryota | 2279 | Open in IMG/M |
| 3300020193|Ga0194131_10063646 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 2299 | Open in IMG/M |
| 3300020196|Ga0194124_10097581 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1680 | Open in IMG/M |
| 3300020196|Ga0194124_10471235 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii | 556 | Open in IMG/M |
| 3300020204|Ga0194116_10040743 | All Organisms → cellular organisms → Eukaryota | 3435 | Open in IMG/M |
| 3300020204|Ga0194116_10175680 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 1251 | Open in IMG/M |
| 3300020204|Ga0194116_10436503 | Not Available | 636 | Open in IMG/M |
| 3300020205|Ga0211731_10171339 | Not Available | 1511 | Open in IMG/M |
| 3300020205|Ga0211731_10257468 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 712 | Open in IMG/M |
| 3300020205|Ga0211731_10339697 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 827 | Open in IMG/M |
| 3300020205|Ga0211731_11470836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria | 1888 | Open in IMG/M |
| 3300020578|Ga0194129_10086642 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae | 2186 | Open in IMG/M |
| 3300021092|Ga0194122_10053611 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 2408 | Open in IMG/M |
| 3300021093|Ga0194123_10202051 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 1015 | Open in IMG/M |
| 3300021350|Ga0206692_1060602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria | 1449 | Open in IMG/M |
| 3300021376|Ga0194130_10115554 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1717 | Open in IMG/M |
| 3300022074|Ga0224906_1149782 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 659 | Open in IMG/M |
| 3300025890|Ga0209631_10382298 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 657 | Open in IMG/M |
| 3300026448|Ga0247594_1059772 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 658 | Open in IMG/M |
| 3300026513|Ga0247590_1097253 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 761 | Open in IMG/M |
| 3300027720|Ga0209617_10125902 | Not Available | 1019 | Open in IMG/M |
| 3300027720|Ga0209617_10189670 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 796 | Open in IMG/M |
| 3300027749|Ga0209084_1064202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Arcobacteraceae → Arcobacter | 1715 | Open in IMG/M |
| 3300027760|Ga0209598_10328998 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae | 587 | Open in IMG/M |
| 3300027770|Ga0209086_10189459 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 957 | Open in IMG/M |
| 3300027781|Ga0209175_10015239 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 3223 | Open in IMG/M |
| 3300027781|Ga0209175_10029587 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae | 2322 | Open in IMG/M |
| 3300027781|Ga0209175_10046391 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 1847 | Open in IMG/M |
| 3300027784|Ga0207421_10012291 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae | 8155 | Open in IMG/M |
| 3300027784|Ga0207421_10012291 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae | 8155 | Open in IMG/M |
| 3300027784|Ga0207421_10012291 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae | 8155 | Open in IMG/M |
| 3300027810|Ga0209302_10520705 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 525 | Open in IMG/M |
| 3300027851|Ga0209066_10294549 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae | 911 | Open in IMG/M |
| 3300028137|Ga0256412_1102305 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 1041 | Open in IMG/M |
| 3300028282|Ga0256413_1118348 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 962 | Open in IMG/M |
| 3300028282|Ga0256413_1222201 | Not Available | 675 | Open in IMG/M |
| 3300028282|Ga0256413_1301464 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 564 | Open in IMG/M |
| 3300028412|Ga0306910_1020770 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1126 | Open in IMG/M |
| (restricted) 3300028559|Ga0247831_1085476 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 1429 | Open in IMG/M |
| 3300028864|Ga0302215_10099161 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae | 1241 | Open in IMG/M |
| 3300029989|Ga0311365_10786766 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 823 | Open in IMG/M |
| 3300030528|Ga0210277_10582308 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Tunicata → Appendicularia → Copelata → Oikopleuridae → Oikopleura → Oikopleura dioica | 1192 | Open in IMG/M |
| 3300030528|Ga0210277_10856554 | Not Available | 1163 | Open in IMG/M |
| 3300030594|Ga0210280_1033396 | All Organisms → cellular organisms → Eukaryota | 811 | Open in IMG/M |
| 3300030595|Ga0210276_11076315 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Tunicata → Appendicularia → Copelata → Oikopleuridae → Oikopleura → Oikopleura dioica | 820 | Open in IMG/M |
| 3300030709|Ga0307400_10698809 | Not Available | 630 | Open in IMG/M |
| 3300030788|Ga0073964_11745444 | All Organisms → Viruses → Predicted Viral | 1435 | Open in IMG/M |
| 3300030849|Ga0075393_10808541 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Tunicata → Appendicularia → Copelata → Oikopleuridae → Oikopleura → Oikopleura dioica | 531 | Open in IMG/M |
| 3300030909|Ga0074033_11029630 | Not Available | 866 | Open in IMG/M |
| 3300031122|Ga0170822_10746244 | Not Available | 755 | Open in IMG/M |
| 3300031231|Ga0170824_110898740 | Not Available | 907 | Open in IMG/M |
| 3300031261|Ga0302140_10725909 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 722 | Open in IMG/M |
| 3300031269|Ga0307983_1027391 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 1201 | Open in IMG/M |
| 3300031580|Ga0308132_1104388 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 582 | Open in IMG/M |
| 3300031622|Ga0302126_10308555 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii | 532 | Open in IMG/M |
| 3300031638|Ga0302125_10102822 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii | 936 | Open in IMG/M |
| 3300031737|Ga0307387_10001730 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 4481 | Open in IMG/M |
| 3300031738|Ga0307384_10113798 | Not Available | 1121 | Open in IMG/M |
| 3300031750|Ga0307389_10010292 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3018 | Open in IMG/M |
| 3300031758|Ga0315907_10939593 | All Organisms → cellular organisms → Eukaryota | 631 | Open in IMG/M |
| 3300031784|Ga0315899_10215140 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 1931 | Open in IMG/M |
| 3300031784|Ga0315899_10595200 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1044 | Open in IMG/M |
| 3300031784|Ga0315899_11351289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Moritellaceae → Moritella → unclassified Moritella → Moritella sp. PE36 | 607 | Open in IMG/M |
| 3300031784|Ga0315899_11713172 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae | 516 | Open in IMG/M |
| 3300032463|Ga0314684_10110173 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 1391 | Open in IMG/M |
| 3300032463|Ga0314684_10193243 | Not Available | 1128 | Open in IMG/M |
| 3300032617|Ga0314683_10011995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales | 3088 | Open in IMG/M |
| 3300032617|Ga0314683_10368146 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 898 | Open in IMG/M |
| 3300032739|Ga0315741_10607307 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 919 | Open in IMG/M |
| 3300032742|Ga0314710_10440707 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 541 | Open in IMG/M |
| 3300032748|Ga0314713_10040731 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1558 | Open in IMG/M |
| 3300033572|Ga0307390_10613651 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 679 | Open in IMG/M |
| 3300034068|Ga0334990_0315289 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 849 | Open in IMG/M |
| 3300034105|Ga0335035_0149773 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 1471 | Open in IMG/M |
| 3300034355|Ga0335039_0254481 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 947 | Open in IMG/M |
| 3300034355|Ga0335039_0276726 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 897 | Open in IMG/M |
| 3300034355|Ga0335039_0395925 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae | 710 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 7.82% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.26% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 7.26% |
| Wastewater Effluent | Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent | 7.26% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 6.70% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 5.59% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 5.03% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 4.47% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.91% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 3.35% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 3.35% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.79% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.79% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 2.79% |
| Alkaline Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Alkaline → Sediment → Alkaline Sediment | 2.79% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 1.12% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.12% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.12% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 1.12% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.12% |
| Polar Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine | 1.12% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.68% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 1.68% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 1.68% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.56% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.56% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.56% |
| Watersheds | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Watersheds | 0.56% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 0.56% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.56% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 0.56% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.56% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 0.56% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.56% |
| Beach Aquifer Porewater | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Beach Aquifer Porewater | 0.56% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.56% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.56% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.56% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.56% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.56% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459014 | Litter degradation PV2 | Engineered | Open in IMG/M |
| 3300000557 | Alkaline sediment microbial communities from Lake Tanatar, Kulunda Steppe, Russia - 8KL_010_SED | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
| 3300004128 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (version 2) | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004765 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004767 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004769 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004794 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004795 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004810 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005961 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 B green DNA | Engineered | Open in IMG/M |
| 3300005987 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 B DNA | Engineered | Open in IMG/M |
| 3300005988 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C2 DNA | Engineered | Open in IMG/M |
| 3300005989 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 7/17/14 B DNA | Engineered | Open in IMG/M |
| 3300006129 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE06Nov07 | Environmental | Open in IMG/M |
| 3300006165 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA | Environmental | Open in IMG/M |
| 3300006356 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006419 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007242 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 7/17/14 C RNA (Eukaryote Community Metatranscriptome) | Engineered | Open in IMG/M |
| 3300007513 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate b | Environmental | Open in IMG/M |
| 3300007667 | Estuarine microbial communities from the Columbia River estuary - metaG 1558A-3 | Environmental | Open in IMG/M |
| 3300007722 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (megahit assembly) | Environmental | Open in IMG/M |
| 3300007860 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372A_3um | Environmental | Open in IMG/M |
| 3300007862 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_0.2um | Environmental | Open in IMG/M |
| 3300007955 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373B_3.0um | Environmental | Open in IMG/M |
| 3300007958 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459BC_3.0um | Environmental | Open in IMG/M |
| 3300008021 | Estuarine microbial communities from the Columbia River estuary - metaG 1569A-3 | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008119 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009218 | Microbial communities of water from Amazon river, Brazil - RCM1 | Environmental | Open in IMG/M |
| 3300009422 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 | Environmental | Open in IMG/M |
| 3300009436 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome | Environmental | Open in IMG/M |
| 3300009442 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 | Environmental | Open in IMG/M |
| 3300009455 | Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Crystal Spring | Environmental | Open in IMG/M |
| 3300009495 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 | Environmental | Open in IMG/M |
| 3300009538 | Microbial community of beach aquifer porewater from Cape Shores, Lewes, Delaware, USA - H-2W | Environmental | Open in IMG/M |
| 3300009592 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009599 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009608 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009677 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300012030 | Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 2 #697 | Environmental | Open in IMG/M |
| 3300012415 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA15.ICE_1m.20151115 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012504 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012520 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012525 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012528 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012711 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES133 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012715 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES122 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012723 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES129 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012731 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES145 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012756 | Freshwater microbial communities from Lake Croche, Canada - C_130709_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012782 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA30.ICE_1m.20151125 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012952 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 Metagenome | Environmental | Open in IMG/M |
| 3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
| 3300013087 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300017299 | Metatranscriptome of marine eukaryotic communities from northern Puget Sound, Washington in Ciliate medium, 15 C, 30 psu salinity and 405 ?mol photons light - Strombidinopsis acuminata SPMC142 (MMETSP0126) | Host-Associated | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300018871 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001026 (ERX1789475-ERR1719345) | Environmental | Open in IMG/M |
| 3300019048 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166) | Environmental | Open in IMG/M |
| 3300019117 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002348 (ERX1782351-ERR1711912) | Environmental | Open in IMG/M |
| 3300019150 | Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782105-ERR1711908) | Environmental | Open in IMG/M |
| 3300020109 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400m | Environmental | Open in IMG/M |
| 3300020146 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_10-13C | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300020190 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surface | Environmental | Open in IMG/M |
| 3300020193 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015053 Kigoma Offshore 120m | Environmental | Open in IMG/M |
| 3300020196 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015031 Kigoma Deep Cast 0m | Environmental | Open in IMG/M |
| 3300020204 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015008 Mahale S9 surface | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020578 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015038 Kigoma Deep Cast 35m | Environmental | Open in IMG/M |
| 3300021092 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015021 Mahale Deep Cast 10m | Environmental | Open in IMG/M |
| 3300021093 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015023 Mahale A surface | Environmental | Open in IMG/M |
| 3300021350 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021376 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surface | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300025890 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes) | Environmental | Open in IMG/M |
| 3300026448 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 57R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026513 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 51R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027720 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027760 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027781 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C2 DNA (SPAdes) | Engineered | Open in IMG/M |
| 3300027784 | Alkaline sediment microbial communities from Lake Tanatar, Kulunda Steppe, Russia - 8KL_010_SED (SPAdes) | Environmental | Open in IMG/M |
| 3300027810 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027851 | Freshwater microbial communities in response to fracking from Pennsylvania, USA - Allegheny Zone_MetaG_DW_15 (SPAdes) | Environmental | Open in IMG/M |
| 3300028137 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028282 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028412 | Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 2 #698 (v2) | Environmental | Open in IMG/M |
| 3300028559 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_1m | Environmental | Open in IMG/M |
| 3300028864 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N3_1 | Environmental | Open in IMG/M |
| 3300029989 | III_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030528 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO084SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030585 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb4 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030594 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO141-VCO089SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030595 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO083SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030709 | Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030788 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_R_0.2 metaT (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030849 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB4 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030909 | Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Mineral N2 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031261 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1 | Environmental | Open in IMG/M |
| 3300031269 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #991 | Environmental | Open in IMG/M |
| 3300031580 | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1111_SCM (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031622 | Marine microbial communities from Western Arctic Ocean, Canada - CB4_20m | Environmental | Open in IMG/M |
| 3300031638 | Marine microbial communities from Western Arctic Ocean, Canada - CB4_surface | Environmental | Open in IMG/M |
| 3300031737 | Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R1 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031738 | Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031750 | Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R3 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300032463 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_surf (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032617 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_surf (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032739 | Forest Soil Metatranscriptomics Site 2 LB Combined Assembly | Environmental | Open in IMG/M |
| 3300032742 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_24May_surf (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032748 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_24May_surf (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300033572 | Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034068 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031 | Environmental | Open in IMG/M |
| 3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
| 3300034355 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2PV_01814580 | 2170459014 | Switchgrass, Maize And Mischanthus Litter | MHADMLKTPPLPEDEAAMIKSTRIRVGRNLANYPLGP |
| SL_8KL_010_SEDDRAFT_100466172 | 3300000557 | Alkaline Sediment | MDSSKLICPPLFQANDANNMIVSTRIRVGRNLAEFPLGPGLTREQR* |
| SL_8KL_010_SEDDRAFT_100466173 | 3300000557 | Alkaline Sediment | MDFTKLNTPPFEAEEAKLIKSTRIRVGRNLAEYPLGPGLTKE* |
| B570J40625_1010668702 | 3300002835 | Freshwater | MDHTQLNCPPFSEEDAKMIRSTRIRVGRNLADFPLGPGLTRE* |
| Ga0065166_101818912 | 3300004112 | Freshwater Lake | MESSKLNAPPFPEEDGKFIISTRIRVGRNLADYPLGPGITND* |
| Ga0066180_103500891 | 3300004128 | Freshwater Lake | MDYTKLNCPPFSKEEAALIVSTRIRVGRNLADFPLGPGISRE* |
| Ga0063356_1014533441 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MDYTKLQCPPLKNSEAKMIRSTRIRVGRNLADYPLGPGLSKE* |
| Ga0007745_12962871 | 3300004765 | Freshwater Lake | MDHTQLKCPPFSDEDAKMIKSTRIRVGRNLAGYPLGPGLSKEQ |
| Ga0007750_15528332 | 3300004767 | Freshwater Lake | MDYTKLNCPPFTKEEASLIVSTRIRVGRNLADFPLGPGISRE* |
| Ga0007750_15528334 | 3300004767 | Freshwater Lake | MDYTKLNCPPFTEEEKAFIVSTRIRVGRNLADFPLGPGISRE* |
| Ga0007748_112665411 | 3300004769 | Freshwater Lake | MDYSKLNCPPFTAEESALIVSTRIRVGRNLKDFPLGPGISKE* |
| Ga0007748_113565831 | 3300004769 | Freshwater Lake | ADKHSSDMDATKINAPPFTGEDAEMIKSTRIRVGRNLADFPLGPGISNL* |
| Ga0007751_112664241 | 3300004794 | Freshwater Lake | MDYKKLNCPPLTEEQASMIVSTRIRVGRNLADFPLGPGISRE* |
| Ga0007756_115350965 | 3300004795 | Freshwater Lake | MESSKLNAPPLPEEEAKLIISTRIRVGRNLADYPLGPGITNE* |
| Ga0007757_112750922 | 3300004810 | Freshwater Lake | MDYTKLNCPPFKKEEASLIVSTRIRVGRNLADFPLGPGISRE* |
| Ga0078894_100655837 | 3300005662 | Freshwater Lake | MDYTKLSCPPFTAQESALIVSTRIRVGRNLKDFPLGPGISKE* |
| Ga0078894_102216533 | 3300005662 | Freshwater Lake | MDASKLNAPPFAPEDAAMIVSTRIRVGRNLADYPLGPALTKE* |
| Ga0075157_103907762 | 3300005961 | Wastewater Effluent | MTTSKLNAPPFPKADAKMIRSTRIRVGRNLHGFPLGPGITN |
| Ga0075158_100217794 | 3300005987 | Wastewater Effluent | VSDMDYKKLHCPPFDESDAKMIKSTRIRVGRNLADYPLGPGLTK* |
| Ga0075158_101462521 | 3300005987 | Wastewater Effluent | MDSAALNAPPFPEEDGAMIISTRIRVGRNLADYPL |
| Ga0075158_101931013 | 3300005987 | Wastewater Effluent | MDYKKLHCPPFDESDAKMIKSTRIRVGRNLAEYPLGPGLTQ* |
| Ga0075158_103117432 | 3300005987 | Wastewater Effluent | MDSSALDAPPLPEEDGAMIISTRIRVGRNLADYPLGPGITNA* |
| Ga0075160_100200888 | 3300005988 | Wastewater Effluent | MDYTKLECPPLRNSEAKLIRSTRIRVGRNLADYPLGPGLTNE* |
| Ga0075160_100819431 | 3300005988 | Wastewater Effluent | LSKTIMATVDAKHVSDMDYTKLECPPLRNSEAKLIRSTRIRVGRNLADYPLGPGLTKE* |
| Ga0075154_100344881 | 3300005989 | Wastewater Effluent | MDSAALNAPPFPEEDGAMIISTRIRVGRNLADYPLGPGITNE* |
| Ga0075154_100912811 | 3300005989 | Wastewater Effluent | MDSSALDAPPLPEEDGAMIISTRIRVGRNLADYPLGPGI |
| Ga0007834_11265161 | 3300006129 | Freshwater | MDYKKLNCPPLTEEQASMIVSTRIRVGRNLADFPLGP |
| Ga0075443_103011832 | 3300006165 | Marine | PFAPDEAAMIVSTRIRVGRNLADFPLGPGVSKAQRD* |
| Ga0075487_12655731 | 3300006356 | Aqueous | MDHSKLDCPPFSEEDSKMILSTRIRVGRNLADFPLGPGISKE* |
| Ga0075496_14956833 | 3300006419 | Aqueous | MDHKALKCPPFSPDEAAMIVSTRIRVGRNLAEYPLGPGVSKAQRD |
| Ga0075464_100231536 | 3300006805 | Aqueous | MDHTQLNCPPFPEEDAIMIKSTRIRVGRNLKAFPLGPGISRE* |
| Ga0075172_13472573 | 3300007242 | Wastewater Effluent | TPPFEAKEAKLIKSTRIRVGRNLAGYPLGPGLNKE* |
| Ga0105019_101227117 | 3300007513 | Marine | MNFEELECPPFSDDDASMIISTRIRVGRNLADFPLGPGITKE* |
| Ga0105019_10122716 | 3300007513 | Marine | MDFTQLKCPPFTEDEAAMILSTRIRVGRNLADFPLGPGVSK* |
| Ga0105019_10122719 | 3300007513 | Marine | MDYGQLKCPPLKAEDAAMILSTRIRVGRNLADVPLGPGITKE* |
| Ga0102910_11069593 | 3300007667 | Estuarine | MDYTKLNCPPFTAEEAAMIVSTRIRVGRNLADLPLGPGISKEKR |
| Ga0105051_112141571 | 3300007722 | Freshwater | HQSDMDFTKLNCPPFTDKEAKRIKSTRIRVGRNLKDYPLGPGLTKE* |
| Ga0105735_10111135 | 3300007860 | Estuary Water | NMDHTQLNCPPFPEEDAIMIKSTRIRVGRNLKAFPLGPGISRE* |
| Ga0105735_10276893 | 3300007860 | Estuary Water | MDFSKLNCPPFSEEDAKMIRSTRIRIGRNLKAYPLGPGITREGRNAVEAAA* |
| Ga0105737_12053921 | 3300007862 | Estuary Water | TQLECPPFSEEDAEMIVSTRIRVGRNLAEFPLGPGISKE* |
| Ga0105740_10233532 | 3300007955 | Estuary Water | MNYKELVCPPFSEVEKGMIISTRIRVGRNLADYPLGPGITKE* |
| Ga0105743_10277521 | 3300007958 | Estuary Water | MNYKELKCPPFSKEEAARIISTRIRVGRNMADVPLGPGITKD* |
| Ga0102922_10482872 | 3300008021 | Estuarine | KIDAGHVSNMDHTQLNCPPFSEEDAKMIKSTRIRVGRNLADFPLGPGLTRE* |
| Ga0114340_10252353 | 3300008107 | Freshwater, Plankton | MDATKLVAPPFSQEDASMIKSTRIRVGRNLDGYPLGPGITNE* |
| Ga0114341_100183998 | 3300008108 | Freshwater, Plankton | MDYTKLNCPPFTDEEAALIVSTRIRVGRNLKDFPLGPGISKE* |
| Ga0114350_11956911 | 3300008116 | Freshwater, Plankton | MDYTKLNCPPFTEEENAMIVSTRIRVGRNLADFPLGPGI* |
| Ga0114351_11115851 | 3300008117 | Freshwater, Plankton | MDYTKLNCPPFTEEENAMIVSTRIRVGRNLADFPLGPGISRE* |
| Ga0114354_10182632 | 3300008119 | Freshwater, Plankton | MDYTKLNCPPFTAEEAAMIQSTRIRVGRNLADFPLGPGISRE* |
| Ga0114354_10182635 | 3300008119 | Freshwater, Plankton | MDYTKLNCPPFTEEESKMIQSTRIRVGRNLADFPLGPGISRE* |
| Ga0114354_10336115 | 3300008119 | Freshwater, Plankton | MDYTKLNCPPFTSEEAAMIQSTRIRVGRNLADFPLGPGISRE* |
| Ga0114354_10928591 | 3300008119 | Freshwater, Plankton | MDYTKLNCPPFTEEESKMIQSTRIRVGRNLADFPLGPGISKD* |
| Ga0115566_105006201 | 3300009071 | Pelagic Marine | KCPPFSADEAAMIVSTRIRVGRNLADFPLGPGVTKA* |
| Ga0114962_107081542 | 3300009151 | Freshwater Lake | MDYTKLNCPPFIKEEAALIVSTRIRVGRNLADFPLGPGISRE* |
| Ga0114963_103638952 | 3300009154 | Freshwater Lake | MDYTKLNCPPFTKEEAALIVSTRIRVGRNLADFPLGPGISRE* |
| Ga0114981_102985601 | 3300009160 | Freshwater Lake | MDFSKLNCPPFSEEDAKMIKSTRIRIGRNLKAYPLGPGITREGRNAVEAAA* |
| Ga0114979_107004511 | 3300009180 | Freshwater Lake | CPPFSKEEAALIVSTRIRVGRNLADFPLGPGISRE* |
| Ga0103848_10954081 | 3300009218 | River Water | NISDMDYKKLNCPPLTEEQASMIVSTRIRVGRNLADFPLGPGISRE* |
| Ga0114998_104080051 | 3300009422 | Marine | TKLKCPPFPADEAAMIVSTRIRVGRNLADYPLGPGVTKE* |
| Ga0115008_108267951 | 3300009436 | Marine | MDYTQLKCPPFTADEASMIVSTRIRVGRNLADYPLGPGVTKV* |
| Ga0115563_13407242 | 3300009442 | Pelagic Marine | PFSEEEAAMIISTRIRVGRNLAEFPLGPGVTKEQRN* |
| Ga0114939_100336642 | 3300009455 | Groundwater | MDSSKLNAPPFPAEEAAMIVSTRIRVGRNLADYPLGPGITNE* |
| Ga0115571_11451381 | 3300009495 | Pelagic Marine | LDCPPFSPEDASMIVSTRIRVGRNLAEFPLGPGISKV* |
| Ga0129287_100112404 | 3300009538 | Beach Aquifer Porewater | MNYEELDCPPFADDEAAMIKSTRIRVGRNLADYPLGPGISRE* |
| Ga0115101_13369591 | 3300009592 | Marine | MNYKELKCPPFTKEEAARIISTRIRVGRNLADVPLGPGITKE* |
| Ga0115103_14598311 | 3300009599 | Marine | SNMNYKELKCPPFTKEEAARIISTRIRVGRNLADVPLGPGITKE* |
| Ga0115103_16141584 | 3300009599 | Marine | MNYEELDCPPFTEDEAAMILSTRIRVGRNVEGFPLGPSITKE* |
| Ga0115100_102441132 | 3300009608 | Marine | MNYKELKWPPFSKEEAARIISTRIRVGRNMADVPLGPGITKD* |
| Ga0115104_106920133 | 3300009677 | Marine | MDYNQLQCPPLKAEDAAMILSTRIRVGRNLADVPLGPGISKA* |
| Ga0115001_101727554 | 3300009785 | Marine | MDHTQLKCPPFTADEAEMILSTRIRVGRNLAAYPLGPGITKE* |
| Ga0118733_1093724302 | 3300010430 | Marine Sediment | MDYTKLNCPPLPADEAAMINSTRIRVGRNLADFPLGPGITKEQRD* |
| Ga0133547_118147002 | 3300010883 | Marine | MDYTQLKCPPFTADESAMILSTRIRVGRNLAEFPLGPGISKE* |
| Ga0133913_105080594 | 3300010885 | Freshwater Lake | MDATKINAPPFTGEDAEMIKSTRIRVGRNLADFPLGPGISNL* |
| Ga0136599_10190982 | 3300012030 | Saline Lake | MNFQDLACPPFEPEDAAMILSTRIRVGRNMADFPLGPGVSKDQRN* |
| Ga0138263_12393602 | 3300012415 | Polar Marine | MDHTKLKCPPFSKEDDAMIISTRIRVGRNLAAYPLGPGITGPQR |
| Ga0129347_10176342 | 3300012504 | Aqueous | MNYKDLKCPPFSADEAAMIVSTRIRVGRNLADYPLGPGVTKA* |
| Ga0129347_11264842 | 3300012504 | Aqueous | MDHKQLKCPPFSPEDAARIVSTRIRVGRNLADFPLGPGVTKA* |
| Ga0129344_12798727 | 3300012520 | Aqueous | MDYTQLNCPPFTELEASMILSTRIRVGRNLADYPLGPGVSKE* |
| Ga0129353_19618381 | 3300012525 | Aqueous | MDYTQLNCPPFTELEASMILSTRIRVGRNLADYPL |
| Ga0129352_101358781 | 3300012528 | Aqueous | LNCPPFTELEASMILSTRIRVGRNLADYPLGPGVSKE* |
| Ga0157607_12311191 | 3300012711 | Freshwater | MDYEKLVCPPFDDEDAKMIKSTRIRVGRNLAKFPLGPGITREQRN* |
| Ga0157599_10871621 | 3300012715 | Freshwater | MDYEKLVCPPFDDEDAKMIKSTRIRVGRNLAKFPLGPG |
| Ga0157604_11477551 | 3300012723 | Freshwater | MDYEKLVCPPFDDEDAKMIKSTRIRVGRNLAKFPLGP |
| Ga0157616_11514181 | 3300012731 | Freshwater | YEKLVCPPFDDEDAKMIKSTRIRVGRNLAKFPLGPGITREQRN* |
| Ga0138272_11537274 | 3300012756 | Freshwater Lake | MDATKLVAPPFSQEDAAMIKSTRIRVGRNLDGYPLGPGITNE* |
| Ga0138268_16246671 | 3300012782 | Polar Marine | GDLKCPPFAPDEAAMIVSTRIRVGRNLAEFPLGPGVSKAQRD* |
| Ga0163180_115384592 | 3300012952 | Seawater | MDYTQLKCPPLKAEDAAMILSTRIRVGRNLAEVPLGPGITKE* |
| Ga0164294_109004582 | 3300013006 | Freshwater | MDYKKLNTPPLPEEDAKMIKSTRIRVGRNLADYPLGPGLSKE* |
| Ga0163212_12023552 | 3300013087 | Freshwater | MDFSKLNTPSLPEADAKMIKSTRIRVGRNLADYPLGPGLTKE* |
| Ga0170791_160778131 | 3300013295 | Freshwater | MDYTKLNCPPFTEEESKMIVSTRIRVGRNLADFPLGPGISKE* |
| Ga0182016_102750021 | 3300014493 | Bog | MDASKLNAPPFAPEDAAMIVSTRIRVGRNLADFPLGPALTKE* |
| Ga0186338_10012744 | 3300017299 | Host-Associated | MDAAKVNAPPFPEDEAKMIRSTRIRVGRNLADFPLGPGLKRE |
| Ga0169931_100772585 | 3300017788 | Freshwater | MDYTKLNCPPFTPEDARMIRSTRIRIGRNLKAFPLGPGITREGRN |
| Ga0192978_10115422 | 3300018871 | Marine | MDYTQLKCPPFTADESSMILSTRIRVGRNLADFPLGPGISKD |
| Ga0192981_102181262 | 3300019048 | Marine | MDYTKLDCPPFNAEDSAMILSTRIRVGRNLADFPLGPGISKE |
| Ga0193054_10103561 | 3300019117 | Marine | MDWESLDCPELDEEDAAMIVSTRIRVGRNLAEFPLGPGVTKE |
| Ga0194244_100449451 | 3300019150 | Marine | LKCPPFSADEAAMIISTRIRVGRNLAEFPLGPGVTKV |
| Ga0194112_107813911 | 3300020109 | Freshwater Lake | MNASELSCPPLPEDEQAMIVSTRIRVGRNLEGYPLAPGVTNAQRIEIM |
| Ga0196977_10022042 | 3300020146 | Soil | MDPTKLNCPPLEEDEAAMIVSTRIRVGRNLADFPLGPALTKE |
| Ga0196977_10022047 | 3300020146 | Soil | MDYKKLHTPPFPEEEAKLIRSTRIRVGRNLADFPLGPGITRD |
| Ga0196977_10077914 | 3300020146 | Soil | MTVAKINAPALTGEDAAMIKSTRIRVGRNLADFPLGPGITND |
| Ga0194115_100423502 | 3300020183 | Freshwater Lake | MDYTKLNCPPFTAEESALIVSTRIRVGRNLKDFPLGPGISKE |
| Ga0194118_100674733 | 3300020190 | Freshwater Lake | MDHTQLKCPPFEEEDAAMIKSTRIRVGRNLAAYPLGPGLTRE |
| Ga0194131_100636463 | 3300020193 | Freshwater Lake | MDHTQLNCPPFSAEDAAMIKSTRIRVGRNLARFPLGPGLTREMRNNI |
| Ga0194124_100975811 | 3300020196 | Freshwater Lake | MDYTKLNCPPFEAEDAKMIRSTRIRIGRNLKAYPG |
| Ga0194124_104712351 | 3300020196 | Freshwater Lake | MDYTKLNCPPFSAEESALIVSTRIRVGRNLEHFPLGPGISKE |
| Ga0194116_100407436 | 3300020204 | Freshwater Lake | MDHTQLECPPFEEEDAAMIKSTRIRVGRNLAAYPLGPGLTRE |
| Ga0194116_101756801 | 3300020204 | Freshwater Lake | MDATKLIAPPFSEEDAAMIKSTRIRVGRNLDGYPLGPGITDQ |
| Ga0194116_104365031 | 3300020204 | Freshwater Lake | MDHTQLNCPPFSAEDAAMIKSTRIRVGRNLAKFPLGPGLTREQR |
| Ga0211731_101713393 | 3300020205 | Freshwater | MDYTKLNCPPFTEEESKMIQSTRIRVGRNLADFPLGPGISKD |
| Ga0211731_102574681 | 3300020205 | Freshwater | VSDMDYTKLNCPPFTEEESKMIVSTRIRVGRNLADFPLGPGISKE |
| Ga0211731_103396972 | 3300020205 | Freshwater | MDYTKLNCPPFTEEESKMIQSTRIRVGRNLADFPLGPGISRE |
| Ga0211731_114708362 | 3300020205 | Freshwater | MDYTKLNCPPFTSEEAAMIQSTRIRVGRNLAYFPLGPGISRE |
| Ga0194129_100866424 | 3300020578 | Freshwater Lake | MDYTQLNCPPFSAEDAAMIKSTRIRVGRNLAGFPLGPGLTREMRNNI |
| Ga0194122_100536113 | 3300021092 | Freshwater Lake | MDYTKLNCPPFEAEDAKMIRSTRIRIGRNLKAYPL |
| Ga0194123_102020512 | 3300021093 | Freshwater Lake | VSDMDYTKLNCPPFTAEESALIVSTRIRVGRNLKDFPLGPGISKE |
| Ga0206692_10606023 | 3300021350 | Seawater | MDYTQLKCPPFSAEDSAMILSTRIRVGRNLADVPLGPGISKE |
| Ga0194130_101155543 | 3300021376 | Freshwater Lake | MDHTQLNCPPFEEEDAAMIKSTRIRVGRNLAAYPLGPGLTRE |
| Ga0224906_11497822 | 3300022074 | Seawater | MNYKELDCPPFSEVEAGMILSTRIRVGRNLADYPLGPGITKE |
| Ga0209631_103822982 | 3300025890 | Pelagic Marine | MDHSKLDCPPFSEEDSKMILSTRIRVGRNLADFPLGPGISKE |
| Ga0247594_10597721 | 3300026448 | Seawater | MNYKELKCPPFTKEEAARIISTRIRVGRNLADVPVGPGITKE |
| Ga0247590_10972533 | 3300026513 | Seawater | MDFNQLKCPPLKAEDANMIISTRIRVGRNLADVPLGPGISK |
| Ga0209617_101259021 | 3300027720 | Freshwater And Sediment | MDYTKLNCPPFTKEEASLIVSTRIRVGRNLADFPLGPGISRE |
| Ga0209617_101896701 | 3300027720 | Freshwater And Sediment | CPPFSEEDAKMIRSTRIRVGRNLADFPLGPGLTRE |
| Ga0209084_10642021 | 3300027749 | Freshwater Lake | MDYTKLNCPPFTEEEKAFIVSTRIRVGRNLADFPLGPGI |
| Ga0209598_103289981 | 3300027760 | Freshwater Lake | MDYKKLNTPPFSEDEAKLIKSTRIRVGRNLADYPLGPGLTKEQ |
| Ga0209086_101894591 | 3300027770 | Freshwater Lake | SKLIAPPFSEEDAKMIKSTRIRVGRNLEGFPLGPGISNEQRL |
| Ga0209175_100152394 | 3300027781 | Wastewater Effluent | MDSAALNAPPFPEEDGAMIISTRIRVGRNLADYPLGPGITNE |
| Ga0209175_100295872 | 3300027781 | Wastewater Effluent | MDYKKLHCPPFDESDAKMIKSTRIRVGRNLAEYPLGPGLTQ |
| Ga0209175_100463913 | 3300027781 | Wastewater Effluent | MDSSALDAPPLPEEDGAMIISTRIRVGRNLADYPLGPGITNA |
| Ga0207421_1001229110 | 3300027784 | Alkaline Sediment | MDFTKLNTPPFEAEEAKLIKSTRIRVGRNLAEYPLGPGLTKE |
| Ga0207421_1001229111 | 3300027784 | Alkaline Sediment | MDSSKLICPPLFQANDANNMIVSTRIRVGRNLAEFPLGPGLTREQR |
| Ga0207421_100122915 | 3300027784 | Alkaline Sediment | MDYTKLNAPALPADEAAMIKSTRIRVGRNLADYPLGPGLNQK |
| Ga0209302_105207052 | 3300027810 | Marine | MDYTQLKCPPFTADEASMIVSTRIRVGRNLADYPLGPGVTKV |
| Ga0209066_102945491 | 3300027851 | Watersheds | LQCPPFAEAEAKLIRSTRIRVGRNLADYPLGPGVSRE |
| Ga0256412_11023051 | 3300028137 | Seawater | LKCPPFSADEAAMIVSTRIRVGRNLADFPLGPGVTKA |
| Ga0256413_11183483 | 3300028282 | Seawater | MDYNQLQCPPLKAEDAAMILSTRIRVGRNLADVPLGPGISKA |
| Ga0256413_12222011 | 3300028282 | Seawater | KHVSNMDHTKLKCPPFPPDEAAMIVSTRIRVGRNLADFPLGPGVTKA |
| Ga0256413_13014641 | 3300028282 | Seawater | MNYKELNCPPFTADESARILSTRIRVGRNLADYPLGPGITKE |
| Ga0306910_10207702 | 3300028412 | Saline Lake | MNFQDLACPPFEPEDAAMILSTRIRVGRNMADFPLGPGVSKDQRN |
| (restricted) Ga0247831_10854762 | 3300028559 | Freshwater | MDATKINAPPFTGEDAEMIKSTRIRVGRNLADFPLGPGISNL |
| Ga0302215_100991612 | 3300028864 | Fen | MDYKKLVCPPLPEDEARMIKSTRIRVGRNLADYPLGPGLSKE |
| Ga0311365_107867662 | 3300029989 | Fen | MTVTRVNAPPFAEEDAKMIKSTRIRVGRNLKGFPLGPGVTNE |
| Ga0210277_105823081 | 3300030528 | Soil | MDYKKLNCPKFPEDEDKMINSTRIRVGRNLADYPLGSGVSRE |
| Ga0210277_108565542 | 3300030528 | Soil | MDYKKLDCPRFPEDEDKMINSTRIRVGRNLADYPLGTGISKEQR |
| Ga0247639_11156493 | 3300030585 | Soil | HRSDMDYTKLNCPKLASDEDAMINSTRIRVGRNLADYPLGTAATK |
| Ga0210280_10333961 | 3300030594 | Soil | CPRFPEDEDKMINSTRIRVGRNLADYPLGTGISKEQR |
| Ga0210276_110763151 | 3300030595 | Soil | YKKLNCPKFPEDEDKMINSTRIRVGRNLADYPLGSGVSRE |
| Ga0307400_106988092 | 3300030709 | Marine | KHADLKCPPFAPEEAAMIVSTRIRVGRNLAEFPLGPGVSKAQRD |
| Ga0073964_117454442 | 3300030788 | Marine | MDFTKLNIEPFTGEEASMILSTRIRVGRNLKDFPLGPGISRE |
| Ga0075393_108085412 | 3300030849 | Soil | MDYTKLKCPKFPQDEDKMINSTRIRVGRNLAEYPLGPGVSKS |
| Ga0074033_110296301 | 3300030909 | Soil | HTAKHVSDMTIKSLKAPPFSEEDAAFIKSTRVRVGRNLAGYPLGPGITN |
| Ga0170822_107462441 | 3300031122 | Forest Soil | SKLKCDPFTPEEEAMIISTRIRVGRNLKDFPLGPAITD |
| Ga0170824_1108987401 | 3300031231 | Forest Soil | PKNAKHVTDMDASKLKCDPFTPEEEAMIISTRIRVGRNLKDFPLGPAITD |
| Ga0302140_107259091 | 3300031261 | Bog | MESAALKAEPFSEEDSKMIVSTRIRVGRNLHGLPLGPGITNE |
| Ga0307983_10273912 | 3300031269 | Saline Water | MDFKTLKCPPFSAEDGAMILSTRIRVGRNMADFPLGPGVSKDQRN |
| Ga0308132_11043881 | 3300031580 | Marine | MDYTQLKCPPFTADEAAMILSTRIRVGRNMAEVPLGPGISKE |
| Ga0302126_103085552 | 3300031622 | Marine | HVSDMDYTKLQCPPFPAEDAAMIKSTRIRVGRNLADYPLGPGITRE |
| Ga0302125_101028222 | 3300031638 | Marine | AQHVSDMDYTKLQCPPFPAEDAAMIKSTRIRVGRNLADYPLGPGITRE |
| Ga0307387_100017302 | 3300031737 | Marine | MDYTQLNCPPFTSDEAAMILSTRIRVGRNLAEFPLGPGITKEQRD |
| Ga0307384_101137982 | 3300031738 | Marine | MDYNKLNCEPFSEEDAKMILSTRIRVARNLADFPLGTGISRE |
| Ga0307389_100102922 | 3300031750 | Marine | MDYTQLNCPPFTSDEAAMILSTRIRVGRNLADVPLGPGITKEQRD |
| Ga0315907_109395932 | 3300031758 | Freshwater | MDYTKLNCPPFTEEENAMIVSTRIRVGRNLADFPLGPGISRE |
| Ga0315899_102151401 | 3300031784 | Freshwater | MDYTKLNCPPFTKEEADLIVSTRIRVGRNLADFPLGPGISR |
| Ga0315899_105952001 | 3300031784 | Freshwater | MDYSKLNCPPFSAEEAALIVSTRIRVGRNLKDFPLGPGISKE |
| Ga0315899_113512891 | 3300031784 | Freshwater | ELNCPEFSPDEAAMIVSTRIRVGRNLADYPLGPGITNAQRIEVMERVT |
| Ga0315899_117131722 | 3300031784 | Freshwater | KLNCPPFTAEEAALIVSTRIRVGRNLKDFPLGPGISKE |
| Ga0314684_101101732 | 3300032463 | Seawater | KLKCPAFPPDEAAMIVSTRIRVGRNLAEFPLGPGVSKAQRD |
| Ga0314684_101932431 | 3300032463 | Seawater | MNYKDLKCPPFSADEAAMIVSTRIRVGRNLAEFPLGPGVTKT |
| Ga0314683_100119953 | 3300032617 | Seawater | MDHTQLNAPPFSEDDAKMIRSTRIRVGRNLADFPLGPGITKEQRL |
| Ga0314683_103681461 | 3300032617 | Seawater | MKHTDLKCPPFAPDEAAMIVSTRIRVGRNLAAFPLGPGVSK |
| Ga0315741_106073072 | 3300032739 | Forest Soil | MDATKLNCPPLSEEDEKRIVSTRIRVGRNLADFPLGPQLTKE |
| Ga0314710_104407073 | 3300032742 | Seawater | MNYKELVCPPFTEQEASMILSTRIRVGRNLAEFPLGPGIT |
| Ga0314713_100407313 | 3300032748 | Seawater | MNYKDLKCPPFSADEAVMIVSTRIRVGRNLAEFPLGPGVTKT |
| Ga0307390_106136512 | 3300033572 | Marine | MNHEELNCPPFSPEDASMILSTRIRVGRNLAEFPLGP |
| Ga0334990_0315289_464_592 | 3300034068 | Freshwater | MDFKLLKCPPLTGSDASMIVSTRIRVGRNLEDFPLGPGISKE |
| Ga0335035_0149773_286_414 | 3300034105 | Freshwater | MDFKLLKCPPLTESDASMIVSTRIRVGRNLADFPLGPGISKE |
| Ga0335039_0254481_819_947 | 3300034355 | Freshwater | MDHTQLNCPPFSEEDAKMIRSTRIRVGRNLADFPLGPGLTRE |
| Ga0335039_0276726_41_169 | 3300034355 | Freshwater | MNASKLNAPPFNEEDSKMIVSTRIRVGRNLAEFPLGPGLTGE |
| Ga0335039_0395925_91_219 | 3300034355 | Freshwater | MDYKKLNTPPFEAKEASLIKSTRIRVGRNLAGYPLGPGLSKE |
| ⦗Top⦘ |