Metagenome / Metatranscriptome Family F032746

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F032746
Family Type	Metagenome / Metatranscriptome
Number of Sequences	179
Average Sequence Length	39 residues
Representative Sequence	DWPNGKSYPVTAAQLLPILTGFLAPIHFSKLAKNWDED
Number of Associated Samples	143
Number of Associated Scaffolds	179

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	0.56 %
% of genes near scaffold ends (potentially truncated)	98.88 %
% of genes from short scaffolds (< 2000 bps)	84.36 %
Associated GOLD sequencing projects	137
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.26

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (97.207 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (16.760 % of family members)
Environment Ontology (ENVO)	Unclassified (32.402 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (46.369 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 31.82% β-sheet: 0.00% Coil/Unstructured: 68.18%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.26
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.26
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 179 Family Scaffolds
PF01370	Epimerase	68.72
PF13489	Methyltransf_23	8.38
PF02566	OsmC	3.91
PF00583	Acetyltransf_1	2.23
PF07993	NAD_binding_4	1.12
PF02156	Glyco_hydro_26	1.12
PF01916	DS	1.12
PF16798	DUF5069	1.12
PF08241	Methyltransf_11	0.56
PF04321	RmlD_sub_bind	0.56
PF03631	Virul_fac_BrkB	0.56
PF07715	Plug	0.56
PF13533	Biotin_lipoyl_2	0.56
PF13520	AA_permease_2	0.56

COG ID	Name	Functional Category	% Frequency in 179 Family Scaffolds
COG1764	Organic hydroperoxide reductase OsmC/OhrA	Defense mechanisms [V]	3.91
COG1765	Uncharacterized OsmC-related protein	General function prediction only [R]	3.91
COG0451	Nucleoside-diphosphate-sugar epimerase	Cell wall/membrane/envelope biogenesis [M]	1.12
COG0702	Uncharacterized conserved protein YbjT, contains NAD(P)-binding and DUF2867 domains	General function prediction only [R]	1.12
COG1086	NDP-sugar epimerase, includes UDP-GlcNAc-inverting 4,6-dehydratase FlaA1 and capsular polysaccharide biosynthesis protein EpsC	Cell wall/membrane/envelope biogenesis [M]	1.12
COG1899	Deoxyhypusine synthase	Translation, ribosomal structure and biogenesis [J]	1.12
COG4124	Beta-mannanase	Carbohydrate transport and metabolism [G]	1.12
COG1087	UDP-glucose 4-epimerase	Cell wall/membrane/envelope biogenesis [M]	0.56
COG1088	dTDP-D-glucose 4,6-dehydratase	Cell wall/membrane/envelope biogenesis [M]	0.56
COG1089	GDP-D-mannose dehydratase	Cell wall/membrane/envelope biogenesis [M]	0.56
COG1090	NAD dependent epimerase/dehydratase family enzyme	General function prediction only [R]	0.56
COG1091	dTDP-4-dehydrorhamnose reductase	Cell wall/membrane/envelope biogenesis [M]	0.56
COG1295	Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase)	Function unknown [S]	0.56

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	97.77 %
Unclassified	root	N/A	2.23 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	97.21 %
Unclassified	root	N/A	2.23 %
Viruses	superkingdom	All Organisms → Viruses	0.56 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	97.21 %
Unclassified	root	N/A	2.23 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.56 %

Name	Rank	Taxonomy	Distribution
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	35.20 %
Unclassified	root	N/A	2.23 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.56 %

Name	Rank	Taxonomy	Distribution
Verrucomicrobia	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	35.20 %
Unclassified	root	N/A	2.23 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.56 %

Name	Rank	Taxonomy	Distribution
Spartobacteria	class	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria	15.08 %
unclassified Verrucomicrobia	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia	11.17 %
Unclassified	root	N/A	2.23 %
Verrucomicrobiae	class	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae	1.12 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.56 %

Name	Rank	Taxonomy	Distribution
Chthoniobacterales	order	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales	15.08 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	11.17 %
Unclassified	root	N/A	2.23 %
Verrucomicrobiales	order	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales	1.12 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.56 %

Name	Rank	Taxonomy	Distribution
Chthoniobacteraceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae	15.08 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	11.17 %
Unclassified	root	N/A	2.23 %
Verrucomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae	1.12 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.56 %

Name	Rank	Taxonomy	Distribution
Candidatus Udaeobacter	genus	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter	15.08 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	11.17 %
Unclassified	root	N/A	2.23 %
Verrucomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae	1.12 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.56 %

Name	Rank	Taxonomy	Distribution
unclassified Candidatus Udaeobacter	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter	11.73 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	11.17 %
Unclassified	root	N/A	2.23 %
Candidatus Udaeobacter copiosus	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus	2.79 %
Verrucomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae	1.12 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.56 %

Name	Rank	Taxonomy	Distribution
Candidatus Udaeobacter sp.	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp.	11.73 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	11.17 %
Unclassified	root	N/A	2.23 %
Candidatus Udaeobacter copiosus	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus	2.79 %
Verrucomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae	1.12 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.56 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2088090014\|GPIPI_17089073	All Organisms → cellular organisms → Bacteria	1087	Open in IMG/M
2170459005\|F1BAP7Q02IT1E5	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	517	Open in IMG/M
3300000893\|AP72_2010_repI_A001DRAFT_1065827	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	570	Open in IMG/M
3300000956\|JGI10216J12902_100777376	All Organisms → cellular organisms → Bacteria	2780	Open in IMG/M
3300001431\|F14TB_100424261	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	1691	Open in IMG/M
3300002128\|JGI24036J26619_10007256	All Organisms → cellular organisms → Bacteria	1972	Open in IMG/M
3300002128\|JGI24036J26619_10015662	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	1384	Open in IMG/M
3300005294\|Ga0065705_10519641	All Organisms → cellular organisms → Bacteria	763	Open in IMG/M
3300005295\|Ga0065707_10174884	All Organisms → cellular organisms → Bacteria	1458	Open in IMG/M
3300005340\|Ga0070689_100307263	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp.	1321	Open in IMG/M
3300005436\|Ga0070713_101181094	All Organisms → cellular organisms → Bacteria	740	Open in IMG/M
3300005439\|Ga0070711_100430811	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp.	1076	Open in IMG/M
3300005530\|Ga0070679_100513312	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp.	1142	Open in IMG/M
3300005540\|Ga0066697_10114874	All Organisms → cellular organisms → Bacteria	1575	Open in IMG/M
3300005540\|Ga0066697_10698111	All Organisms → cellular organisms → Bacteria	555	Open in IMG/M
3300005543\|Ga0070672_101351716	All Organisms → cellular organisms → Bacteria	637	Open in IMG/M
3300005544\|Ga0070686_100139978	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	1683	Open in IMG/M
3300005544\|Ga0070686_101070593	All Organisms → cellular organisms → Bacteria	664	Open in IMG/M
3300005548\|Ga0070665_100681970	All Organisms → Viruses → Predicted Viral	1040	Open in IMG/M
3300005552\|Ga0066701_10257981	All Organisms → cellular organisms → Bacteria	1078	Open in IMG/M
3300005552\|Ga0066701_10686986	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	616	Open in IMG/M
3300005553\|Ga0066695_10466871	All Organisms → cellular organisms → Bacteria	777	Open in IMG/M
3300005556\|Ga0066707_10098305	All Organisms → cellular organisms → Bacteria	1793	Open in IMG/M
3300005556\|Ga0066707_10800781	All Organisms → cellular organisms → Bacteria	582	Open in IMG/M
3300005556\|Ga0066707_10873385	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	552	Open in IMG/M
3300005559\|Ga0066700_10460571	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp.	891	Open in IMG/M
3300005560\|Ga0066670_10947698	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	525	Open in IMG/M
3300005598\|Ga0066706_10763158	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	766	Open in IMG/M
3300005713\|Ga0066905_100738005	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp.	848	Open in IMG/M
3300005713\|Ga0066905_101925466	All Organisms → cellular organisms → Bacteria	547	Open in IMG/M
3300005764\|Ga0066903_100060766	All Organisms → cellular organisms → Bacteria	4721	Open in IMG/M
3300005764\|Ga0066903_102792049	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp.	947	Open in IMG/M
3300005764\|Ga0066903_104204231	All Organisms → cellular organisms → Bacteria	770	Open in IMG/M
3300005841\|Ga0068863_101731987	All Organisms → cellular organisms → Bacteria	635	Open in IMG/M
3300005937\|Ga0081455_10164229	All Organisms → cellular organisms → Bacteria	1698	Open in IMG/M
3300006032\|Ga0066696_10054926	All Organisms → cellular organisms → Bacteria	2251	Open in IMG/M
3300006046\|Ga0066652_101046835	All Organisms → cellular organisms → Bacteria	773	Open in IMG/M
3300006175\|Ga0070712_100676255	All Organisms → cellular organisms → Bacteria	878	Open in IMG/M
3300006796\|Ga0066665_10063186	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	2598	Open in IMG/M
3300006796\|Ga0066665_10063500	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	2593	Open in IMG/M
3300006797\|Ga0066659_11844669	All Organisms → cellular organisms → Bacteria	512	Open in IMG/M
3300006800\|Ga0066660_10174074	All Organisms → cellular organisms → Bacteria	1617	Open in IMG/M
3300006871\|Ga0075434_102658391	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	500	Open in IMG/M
3300006904\|Ga0075424_102213102	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	579	Open in IMG/M
3300007255\|Ga0099791_10361970	All Organisms → cellular organisms → Bacteria	696	Open in IMG/M
3300009012\|Ga0066710_100486280	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae	1858	Open in IMG/M
3300009012\|Ga0066710_101490127	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp.	1044	Open in IMG/M
3300009090\|Ga0099827_10988849	All Organisms → cellular organisms → Bacteria	730	Open in IMG/M
3300009093\|Ga0105240_11049308	All Organisms → cellular organisms → Bacteria	869	Open in IMG/M
3300009137\|Ga0066709_100869564	All Organisms → cellular organisms → Bacteria	1311	Open in IMG/M
3300009156\|Ga0111538_11427551	All Organisms → cellular organisms → Bacteria	873	Open in IMG/M
3300010046\|Ga0126384_12160646	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	535	Open in IMG/M
3300010301\|Ga0134070_10204332	All Organisms → cellular organisms → Bacteria	726	Open in IMG/M
3300010303\|Ga0134082_10123026	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	1037	Open in IMG/M
3300010323\|Ga0134086_10312561	All Organisms → cellular organisms → Bacteria	613	Open in IMG/M
3300010326\|Ga0134065_10035255	All Organisms → cellular organisms → Bacteria	1484	Open in IMG/M
3300010359\|Ga0126376_10707575	All Organisms → cellular organisms → Bacteria	970	Open in IMG/M
3300010360\|Ga0126372_12982881	All Organisms → cellular organisms → Bacteria	525	Open in IMG/M
3300010362\|Ga0126377_12253406	All Organisms → cellular organisms → Bacteria	621	Open in IMG/M
3300010366\|Ga0126379_12637356	All Organisms → cellular organisms → Bacteria	600	Open in IMG/M
3300010398\|Ga0126383_13361356	All Organisms → cellular organisms → Bacteria	523	Open in IMG/M
3300011119\|Ga0105246_11237482	All Organisms → cellular organisms → Bacteria	689	Open in IMG/M
3300012198\|Ga0137364_10387688	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	1045	Open in IMG/M
3300012198\|Ga0137364_11271573	All Organisms → cellular organisms → Bacteria	549	Open in IMG/M
3300012199\|Ga0137383_10008377	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus	6819	Open in IMG/M
3300012199\|Ga0137383_11012625	All Organisms → cellular organisms → Bacteria	605	Open in IMG/M
3300012200\|Ga0137382_10461674	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp.	899	Open in IMG/M
3300012201\|Ga0137365_10089341	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	2321	Open in IMG/M
3300012203\|Ga0137399_10207030	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter	1595	Open in IMG/M
3300012207\|Ga0137381_10559045	All Organisms → cellular organisms → Bacteria	997	Open in IMG/M
3300012208\|Ga0137376_11543494	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	555	Open in IMG/M
3300012211\|Ga0137377_10547880	All Organisms → cellular organisms → Bacteria	1094	Open in IMG/M
3300012350\|Ga0137372_10066254	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	3127	Open in IMG/M
3300012351\|Ga0137386_10100185	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	2048	Open in IMG/M
3300012357\|Ga0137384_10243400	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp.	1501	Open in IMG/M
3300012358\|Ga0137368_10019304	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus	6519	Open in IMG/M
3300012359\|Ga0137385_10636128	All Organisms → cellular organisms → Bacteria	894	Open in IMG/M
3300012361\|Ga0137360_11853522	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	509	Open in IMG/M
3300012362\|Ga0137361_10021860	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	4892	Open in IMG/M
3300012362\|Ga0137361_11037101	All Organisms → cellular organisms → Bacteria	740	Open in IMG/M
3300012582\|Ga0137358_10166408	All Organisms → cellular organisms → Bacteria	1503	Open in IMG/M
3300012910\|Ga0157308_10392868	All Organisms → cellular organisms → Bacteria	536	Open in IMG/M
3300012917\|Ga0137395_10171687	All Organisms → cellular organisms → Bacteria	1496	Open in IMG/M
3300012923\|Ga0137359_10414662	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp.	1193	Open in IMG/M
3300012923\|Ga0137359_10912928	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	757	Open in IMG/M
3300012925\|Ga0137419_10502117	All Organisms → cellular organisms → Bacteria	963	Open in IMG/M
3300012925\|Ga0137419_11221675	All Organisms → cellular organisms → Bacteria	630	Open in IMG/M
3300012925\|Ga0137419_11319468	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	607	Open in IMG/M
3300012925\|Ga0137419_11360879	All Organisms → cellular organisms → Bacteria	598	Open in IMG/M
3300012930\|Ga0137407_10003057	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	11088	Open in IMG/M
3300012951\|Ga0164300_10434351	All Organisms → cellular organisms → Bacteria	732	Open in IMG/M
3300012955\|Ga0164298_10413681	Not Available	875	Open in IMG/M
3300012960\|Ga0164301_10297849	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus	1084	Open in IMG/M
3300012960\|Ga0164301_10796146	All Organisms → cellular organisms → Bacteria	722	Open in IMG/M
3300012971\|Ga0126369_11577416	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	746	Open in IMG/M
3300012975\|Ga0134110_10252217	All Organisms → cellular organisms → Bacteria	752	Open in IMG/M
3300012985\|Ga0164308_10557692	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp.	968	Open in IMG/M
3300012989\|Ga0164305_10251113	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp.	1278	Open in IMG/M
3300013102\|Ga0157371_11022862	All Organisms → cellular organisms → Bacteria	631	Open in IMG/M
3300013296\|Ga0157374_10296497	All Organisms → cellular organisms → Bacteria	1599	Open in IMG/M
3300013307\|Ga0157372_10689841	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp.	1189	Open in IMG/M
3300013307\|Ga0157372_11226362	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp.	866	Open in IMG/M
3300013307\|Ga0157372_12614086	All Organisms → cellular organisms → Bacteria	579	Open in IMG/M
3300014157\|Ga0134078_10290480	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	700	Open in IMG/M
3300014166\|Ga0134079_10342146	All Organisms → cellular organisms → Bacteria	678	Open in IMG/M
3300015371\|Ga0132258_10619180	All Organisms → cellular organisms → Bacteria	2719	Open in IMG/M
3300015372\|Ga0132256_103879574	All Organisms → cellular organisms → Bacteria	503	Open in IMG/M
3300015373\|Ga0132257_100805673	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp.	1173	Open in IMG/M
3300015373\|Ga0132257_101455357	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp.	873	Open in IMG/M
3300015373\|Ga0132257_101513221	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp.	857	Open in IMG/M
3300015374\|Ga0132255_100028553	All Organisms → cellular organisms → Bacteria	7010	Open in IMG/M
3300015374\|Ga0132255_100680766	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus	1526	Open in IMG/M
3300015374\|Ga0132255_101176476	All Organisms → cellular organisms → Bacteria	1154	Open in IMG/M
3300015374\|Ga0132255_103197852	All Organisms → cellular organisms → Bacteria	698	Open in IMG/M
3300015374\|Ga0132255_103773085	All Organisms → cellular organisms → Bacteria	644	Open in IMG/M
3300016270\|Ga0182036_10396578	All Organisms → cellular organisms → Bacteria	1074	Open in IMG/M
3300016294\|Ga0182041_10015920	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus	4456	Open in IMG/M
3300016341\|Ga0182035_11269638	All Organisms → cellular organisms → Bacteria	659	Open in IMG/M
3300016371\|Ga0182034_11141035	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	677	Open in IMG/M
3300018073\|Ga0184624_10318352	All Organisms → cellular organisms → Bacteria	697	Open in IMG/M
3300018081\|Ga0184625_10557499	All Organisms → cellular organisms → Bacteria	569	Open in IMG/M
3300018468\|Ga0066662_10505591	All Organisms → cellular organisms → Bacteria	1102	Open in IMG/M
3300018482\|Ga0066669_11445441	All Organisms → cellular organisms → Bacteria	624	Open in IMG/M
3300018482\|Ga0066669_12238979	All Organisms → cellular organisms → Bacteria	519	Open in IMG/M
3300019877\|Ga0193722_1009645	All Organisms → cellular organisms → Bacteria	2449	Open in IMG/M
3300019879\|Ga0193723_1013050	All Organisms → cellular organisms → Bacteria	2619	Open in IMG/M
3300019887\|Ga0193729_1100767	All Organisms → cellular organisms → Bacteria	1099	Open in IMG/M
3300019888\|Ga0193751_1016842	All Organisms → cellular organisms → Bacteria	3689	Open in IMG/M
3300020006\|Ga0193735_1019985	All Organisms → cellular organisms → Bacteria	2078	Open in IMG/M
3300020006\|Ga0193735_1071116	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	1005	Open in IMG/M
3300021080\|Ga0210382_10275361	All Organisms → cellular organisms → Bacteria	738	Open in IMG/M
3300021168\|Ga0210406_10463449	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp.	1007	Open in IMG/M
3300021344\|Ga0193719_10283985	All Organisms → cellular organisms → Bacteria	696	Open in IMG/M
3300021413\|Ga0193750_1023799	All Organisms → cellular organisms → Bacteria	1443	Open in IMG/M
3300024245\|Ga0247677_1064152	All Organisms → cellular organisms → Bacteria	541	Open in IMG/M
3300024286\|Ga0247687_1074545	Not Available	522	Open in IMG/M
3300025926\|Ga0207659_10152795	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae	1804	Open in IMG/M
3300025930\|Ga0207701_10360747	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp.	1256	Open in IMG/M
3300025933\|Ga0207706_10221927	All Organisms → cellular organisms → Bacteria	1655	Open in IMG/M
3300025937\|Ga0207669_11920660	All Organisms → cellular organisms → Bacteria	506	Open in IMG/M
3300025938\|Ga0207704_11373838	All Organisms → cellular organisms → Bacteria	605	Open in IMG/M
3300025944\|Ga0207661_11184337	All Organisms → cellular organisms → Bacteria	703	Open in IMG/M
3300025960\|Ga0207651_11620021	All Organisms → cellular organisms → Bacteria	583	Open in IMG/M
3300026315\|Ga0209686_1067896	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	1272	Open in IMG/M
3300026318\|Ga0209471_1033012	All Organisms → cellular organisms → Bacteria	2515	Open in IMG/M
3300026326\|Ga0209801_1070054	All Organisms → cellular organisms → Bacteria	1554	Open in IMG/M
3300026330\|Ga0209473_1308317	All Organisms → cellular organisms → Bacteria	528	Open in IMG/M
3300026332\|Ga0209803_1075592	All Organisms → cellular organisms → Bacteria	1419	Open in IMG/M
3300026524\|Ga0209690_1004285	All Organisms → cellular organisms → Bacteria	8061	Open in IMG/M
3300026530\|Ga0209807_1125963	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	1032	Open in IMG/M
3300026538\|Ga0209056_10458907	All Organisms → cellular organisms → Bacteria	710	Open in IMG/M
3300026557\|Ga0179587_11094432	All Organisms → cellular organisms → Bacteria	524	Open in IMG/M
3300027458\|Ga0207602_101723	All Organisms → cellular organisms → Bacteria	755	Open in IMG/M
3300027727\|Ga0209328_10003444	All Organisms → cellular organisms → Bacteria	4575	Open in IMG/M
3300028379\|Ga0268266_10158442	All Organisms → cellular organisms → Bacteria	2047	Open in IMG/M
3300028715\|Ga0307313_10111424	All Organisms → cellular organisms → Bacteria	835	Open in IMG/M
3300028715\|Ga0307313_10138956	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	747	Open in IMG/M
3300028784\|Ga0307282_10254974	All Organisms → cellular organisms → Bacteria	843	Open in IMG/M
3300028790\|Ga0307283_10031759	Not Available	1179	Open in IMG/M
3300028791\|Ga0307290_10035603	All Organisms → cellular organisms → Bacteria	1776	Open in IMG/M
3300028811\|Ga0307292_10364459	All Organisms → cellular organisms → Bacteria	611	Open in IMG/M
3300030916\|Ga0075386_10012684	All Organisms → cellular organisms → Bacteria	1089	Open in IMG/M
3300030916\|Ga0075386_10027775	All Organisms → cellular organisms → Bacteria	562	Open in IMG/M
3300030916\|Ga0075386_10035033	All Organisms → cellular organisms → Bacteria	623	Open in IMG/M
3300031128\|Ga0170823_14282608	All Organisms → cellular organisms → Bacteria	1226	Open in IMG/M
3300031184\|Ga0307499_10262694	All Organisms → cellular organisms → Bacteria	556	Open in IMG/M
3300031446\|Ga0170820_11301579	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	1543	Open in IMG/M
3300031446\|Ga0170820_17348551	All Organisms → cellular organisms → Bacteria	662	Open in IMG/M
3300031744\|Ga0306918_10065633	All Organisms → cellular organisms → Bacteria	2471	Open in IMG/M
3300031890\|Ga0306925_10089621	All Organisms → cellular organisms → Bacteria	3264	Open in IMG/M
3300031890\|Ga0306925_11281143	All Organisms → cellular organisms → Bacteria	729	Open in IMG/M
3300031947\|Ga0310909_10534840	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp.	981	Open in IMG/M
3300031954\|Ga0306926_10062122	All Organisms → cellular organisms → Bacteria	4497	Open in IMG/M
3300032001\|Ga0306922_10219890	All Organisms → cellular organisms → Bacteria	2039	Open in IMG/M
3300032179\|Ga0310889_10767812	All Organisms → cellular organisms → Bacteria	507	Open in IMG/M
3300032180\|Ga0307471_100723113	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	1161	Open in IMG/M
3300032180\|Ga0307471_100769097	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp.	1129	Open in IMG/M
3300032180\|Ga0307471_103408507	All Organisms → cellular organisms → Bacteria	563	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	83.24%
Host-Associated	Host-Associated	16.76%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	81.56%
Plants	Host-Associated → Plants	16.76%
Aquatic	Environmental → Aquatic	1.68%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	81.56%
Rhizosphere	Host-Associated → Plants → Rhizosphere	10.06%
Rhizoplane	Host-Associated → Plants → Rhizoplane	6.70%
Sediment	Environmental → Aquatic → Sediment	1.12%
Freshwater	Environmental → Aquatic → Freshwater	0.56%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	72.63%
Loam	Environmental → Terrestrial → Soil → Loam	8.94%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	5.59%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	5.03%
Soil	Host-Associated → Plants → Rhizosphere → Soil	4.47%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	1.12%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	1.68%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.56%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	37.99%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	20.67%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	12.85%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	5.59%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	5.03%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	4.47%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	4.47%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	3.35%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	1.12%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	1.12%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	1.68%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.56%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.56%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.56%

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	16.76%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	15.08%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	12.29%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	5.03%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	5.03%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	3.91%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	3.91%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	3.91%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	3.35%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	2.79%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	2.23%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	2.23%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	1.12%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere	1.12%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	1.12%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	1.12%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere	1.68%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	1.68%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	1.68%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	1.68%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	1.68%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	1.68%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	1.68%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.56%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.56%
Grass Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil	0.56%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.56%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.56%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.56%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.56%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.56%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.56%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.56%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.56%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.56%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.56%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2088090014	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
2170459005	Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm	Environmental	Open in IMG/M
3300000893	Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A001	Environmental	Open in IMG/M
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental	Open in IMG/M
3300001431	Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly	Environmental	Open in IMG/M
3300002128	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5	Environmental	Open in IMG/M
3300005172	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132	Environmental	Open in IMG/M
3300005294	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil	Environmental	Open in IMG/M
3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3	Environmental	Open in IMG/M
3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Environmental	Open in IMG/M
3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Environmental	Open in IMG/M
3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Environmental	Open in IMG/M
3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Environmental	Open in IMG/M
3300005540	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146	Environmental	Open in IMG/M
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated	Open in IMG/M
3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Environmental	Open in IMG/M
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated	Open in IMG/M
3300005552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150	Environmental	Open in IMG/M
3300005553	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144	Environmental	Open in IMG/M
3300005556	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156	Environmental	Open in IMG/M
3300005559	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149	Environmental	Open in IMG/M
3300005560	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119	Environmental	Open in IMG/M
3300005598	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155	Environmental	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated	Open in IMG/M
3300006032	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145	Environmental	Open in IMG/M
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental	Open in IMG/M
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental	Open in IMG/M
3300006796	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114	Environmental	Open in IMG/M
3300006797	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108	Environmental	Open in IMG/M
3300006800	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109	Environmental	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300007255	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1	Environmental	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Host-Associated	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010301	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015	Environmental	Open in IMG/M
3300010303	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015	Environmental	Open in IMG/M
3300010323	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG	Environmental	Open in IMG/M
3300010326	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated	Open in IMG/M
3300012198	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG	Environmental	Open in IMG/M
3300012199	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG	Environmental	Open in IMG/M
3300012200	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG	Environmental	Open in IMG/M
3300012201	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG	Environmental	Open in IMG/M
3300012203	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG	Environmental	Open in IMG/M
3300012207	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG	Environmental	Open in IMG/M
3300012208	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG	Environmental	Open in IMG/M
3300012211	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG	Environmental	Open in IMG/M
3300012350	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG	Environmental	Open in IMG/M
3300012351	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG	Environmental	Open in IMG/M
3300012357	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG	Environmental	Open in IMG/M
3300012358	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG	Environmental	Open in IMG/M
3300012359	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG	Environmental	Open in IMG/M
3300012361	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG	Environmental	Open in IMG/M
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental	Open in IMG/M
3300012582	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG	Environmental	Open in IMG/M
3300012910	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2	Environmental	Open in IMG/M
3300012917	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG	Environmental	Open in IMG/M
3300012923	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG	Environmental	Open in IMG/M
3300012925	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012930	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012951	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG	Environmental	Open in IMG/M
3300012955	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG	Environmental	Open in IMG/M
3300012960	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300012975	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015	Environmental	Open in IMG/M
3300012985	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG	Environmental	Open in IMG/M
3300012989	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG	Environmental	Open in IMG/M
3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Host-Associated	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Host-Associated	Open in IMG/M
3300014157	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG	Environmental	Open in IMG/M
3300014166	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300016270	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080	Environmental	Open in IMG/M
3300016294	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178	Environmental	Open in IMG/M
3300016341	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170	Environmental	Open in IMG/M
3300016371	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172	Environmental	Open in IMG/M
3300018073	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1	Environmental	Open in IMG/M
3300018081	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1	Environmental	Open in IMG/M
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300019877	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1	Environmental	Open in IMG/M
3300019879	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2	Environmental	Open in IMG/M
3300019887	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2	Environmental	Open in IMG/M
3300019888	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2	Environmental	Open in IMG/M
3300020006	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2	Environmental	Open in IMG/M
3300021080	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo	Environmental	Open in IMG/M
3300021168	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M	Environmental	Open in IMG/M
3300021344	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2	Environmental	Open in IMG/M
3300021413	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c1	Environmental	Open in IMG/M
3300024245	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK18	Environmental	Open in IMG/M
3300024286	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK28	Environmental	Open in IMG/M
3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025930	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Environmental	Open in IMG/M
3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026315	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes)	Environmental	Open in IMG/M
3300026318	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)	Environmental	Open in IMG/M
3300026326	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)	Environmental	Open in IMG/M
3300026330	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes)	Environmental	Open in IMG/M
3300026332	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes)	Environmental	Open in IMG/M
3300026524	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes)	Environmental	Open in IMG/M
3300026530	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes)	Environmental	Open in IMG/M
3300026538	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)	Environmental	Open in IMG/M
3300026557	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal	Environmental	Open in IMG/M
3300027458	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-ROWE17-B (SPAdes)	Environmental	Open in IMG/M
3300027727	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes)	Environmental	Open in IMG/M
3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300028715	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203	Environmental	Open in IMG/M
3300028784	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121	Environmental	Open in IMG/M
3300028790	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122	Environmental	Open in IMG/M
3300028791	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144	Environmental	Open in IMG/M
3300028811	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149	Environmental	Open in IMG/M
3300030916	Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300031128	Oak Summer Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031184	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S	Environmental	Open in IMG/M
3300031446	Fir Summer Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031744	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)	Environmental	Open in IMG/M
3300031890	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)	Environmental	Open in IMG/M
3300031947	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H	Environmental	Open in IMG/M
3300031954	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)	Environmental	Open in IMG/M
3300032001	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)	Environmental	Open in IMG/M
3300032179	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
GPIPI_03633720	2088090014	Soil	FGDWPSGKLYPVTAAQLLPISTGFLAPIHFSKLAKNWNED
E41_02576910	2170459005	Grass Soil	PATTTIGPIGKSYPVTAAQLLPILTGFLAPIHFSKLAKNWIEK
AP72_2010_repI_A001DRAFT_10658271	3300000893	Forest Soil	DWPNGKSYPVTAAQLLPILTGFLAPIHFSKLAKNCDED*
JGI10216J12902_1007773761	3300000956	Soil	WPNGKSYPVTAAQLLPVFTGFLAPIHSFKLAKNWLQN*
F14TB_1004242611	3300001431	Soil	FGDWPTGKSYPVTAAQLLPILTGFLAPIHFFKLAKNWVED*
JGI24036J26619_100072561	3300002128	Corn, Switchgrass And Miscanthus Rhizosphere	NGKSYPVTAAQLLPILTGFLAPIHFSKLAKNRDED*
JGI24036J26619_100156621	3300002128	Corn, Switchgrass And Miscanthus Rhizosphere	NGKSYPVTAAQLLPILTGFLAPIHFSKLAKNCAED*
Ga0066683_106259852	3300005172	Soil	MSRRRYACHYSDWPSGKLYPVTAAQLLPILTGFLAPIHFS
Ga0065705_105196412	3300005294	Switchgrass Rhizosphere	RNDFGDWPSGKSYPVTAAQLLPILTGFLAPIHFSTLAKNWDED*
Ga0065707_101748843	3300005295	Switchgrass Rhizosphere	RNAFDDWPNGKSYPVTAAQLLPILTGFLAPIHFSKLAKNRDED*
Ga0070689_1003072631	3300005340	Switchgrass Rhizosphere	LRNAFDDWPNGKSYPVTAAQLLPILTGFLAPIHFSKLAKNRDED*
Ga0070713_1011810941	3300005436	Corn, Switchgrass And Miscanthus Rhizosphere	NAFDDWPNGKLYPVTAAQLLPILTGFLAPIHFSKLAKNRDEDYRLAL*
Ga0070711_1004308111	3300005439	Corn, Switchgrass And Miscanthus Rhizosphere	FGDWPNGKSYPVTAAQLLPIRTGFLAPIHFSKLAKNWDED*
Ga0070679_1005133121	3300005530	Corn Rhizosphere	FDDWPNGKSYPVTAAQLLPILTGFLAPIHFSKLAKNRDED*
Ga0066697_101148741	3300005540	Soil	NGKSYPVTAAQLLPILTGFLAPIHFSKLAKNWIEN*
Ga0066697_106981111	3300005540	Soil	DWPNGKSYPVTAAQLLPILTGFLAPIHFSKLAKNWHED*
Ga0070672_1013517161	3300005543	Miscanthus Rhizosphere	GKSYPVTAAQLLPIRTGFLAPIHDQNPFHNEFSKLAKNCCQK*
Ga0070686_1001399781	3300005544	Switchgrass Rhizosphere	NTFDDWPNGKSYPVTAAQLLPILTGFLAPIHFSKLAKNRDED*
Ga0070686_1010705931	3300005544	Switchgrass Rhizosphere	NTFDDWPNGKSYPVTAAQLLPILTGFLAPIHFSKLAKNREED*
Ga0070665_1006819702	3300005548	Switchgrass Rhizosphere	FGDWPNGKSYPVTAAQLLPILTGFLAPIHFFKLAKN*
Ga0066701_102579811	3300005552	Soil	LSGIGLGKSYPVTAAQLLPVCTGFLAPIHFFKLAKN*
Ga0066701_106869861	3300005552	Soil	IGLGKSYPVTAAQLLPIRTGFLAPIHFFKLAKNWIEN*
Ga0066695_104668711	3300005553	Soil	DWPNGKSYPVTAAQLLPILTGFLAPIHFSKLAKNWIED*
Ga0066707_100983051	3300005556	Soil	GKSYPVTAAQLLPIRTGFLAPIHFSKLAKNWIKD*
Ga0066707_108007811	3300005556	Soil	GKSYPVTAAQLLPILTGFLAPIHFSKLAKNWIQK*
Ga0066707_108733852	3300005556	Soil	FFGDWPSGKSYPVTAAQLLPIFTGFLAPIHFSKLAKNWIED*
Ga0066700_104605711	3300005559	Soil	PNGKSYPVTAAQLLPILTGFLAPIHFSKLAKNWIEN*
Ga0066670_109476981	3300005560	Soil	SDWPSGKLYPVTAAQLLPILTGFLAPIHVSKLAKN*
Ga0066706_107631581	3300005598	Soil	NGKSYPVTAAQLLPIHTGFLAPIHFSKLAKNYIEN*
Ga0066905_1007380052	3300005713	Tropical Forest Soil	DWPSGKSYPVTAAQLLPILTGFLAPIHFSKLAKNRDED*
Ga0066905_1019254662	3300005713	Tropical Forest Soil	FGDWPNGKSYPVTAAQLLPILTGFLAPIHFSKLAKN*
Ga0066903_1000607667	3300005764	Tropical Forest Soil	GKSYPVTAAQLLPIRTGFLAPIHFSKLAKNWTEN*
Ga0066903_1027920492	3300005764	Tropical Forest Soil	DWPSGKLYPVTAAQLLPILTGFLAPIHFSKLAKNQNED*
Ga0066903_1042042311	3300005764	Tropical Forest Soil	DWPNGKSYPVTAAQLLPILTGFLAPIHFSKLAKNWNED*
Ga0068863_1017319871	3300005841	Switchgrass Rhizosphere	DWPNGKSYPVTAAQLLPILTGFLAPIHFSKLAKN*
Ga0081455_101642293	3300005937	Tabebuia Heterophylla Rhizosphere	PAFTLEILEDWPNGKSYPVTAAQLLPILTGFLAPTHFSKLAKNRDED*
Ga0066696_100549263	3300006032	Soil	SGIGPIGKSYPVTAAQLLPIRTGFLAPIHFFKLAKN*
Ga0066652_1010468351	3300006046	Soil	DWPNGKSYPVTAAQLLPILTGFLAPIHFSKLAKNWIEH*
Ga0070712_1006762552	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	PNGKLYPVTAAQLLPILTGFLAPIHFSKLAKNRDED*
Ga0066665_100631861	3300006796	Soil	PSLPNFFGNWPNGKSYPVTAAQLLPVLTGFLAPTHFSKLAKNWIED*
Ga0066665_100635001	3300006796	Soil	ACHYSDWPSGKLYPVTAAQLLPILTGFLAPIHVSKLAKN*
Ga0066659_118446691	3300006797	Soil	GKLYPVTAAQLLPIRTGFLAPIHFFKLAKNCIQK*
Ga0066660_101740743	3300006800	Soil	GKLYPVTAAQLLPIRTGFLAPVHFSKLAKNWIEK*
Ga0075434_1026583911	3300006871	Populus Rhizosphere	GKSYPVTAAQLLPILTGFLAPIHFSKLAKNWHED*
Ga0075424_1022131022	3300006904	Populus Rhizosphere	GKSYPVTAAQLLPILTGFLAPIHFFKLAKNWIEK*
Ga0099791_103619701	3300007255	Vadose Zone Soil	PFRDWPIGKLYPVTAAQLLPIFTGFLAPIHFLKLAKNWIEE*
Ga0066710_1004862803	3300009012	Grasslands Soil	GIGPIGKSYPVTAAQLLPILTGFLAPIHFSKLAKNWIQK
Ga0066710_1014901272	3300009012	Grasslands Soil	WPNGKSYPVTAAQLLPILTGFLAPIHFSKLAKNWHED
Ga0099827_109888491	3300009090	Vadose Zone Soil	GIGLGKSYPVTAAQLLPVSTGFLAPIHFFKLAKNWIEN*
Ga0105240_110493082	3300009093	Corn Rhizosphere	LGKSYPVTAAQLLPVFTGFLAPIHFFKLAKNWPQN*
Ga0066709_1008695641	3300009137	Grasslands Soil	ACHYSDWPSGKLYPVTAAQLLPILTGFLAPIHFSKLAKN*
Ga0111538_114275511	3300009156	Populus Rhizosphere	WPNGKSYPVTAAQLLPILTGFLAPIHFPKLAKNRDED*
Ga0126384_121606461	3300010046	Tropical Forest Soil	NGFGNWPSGKSYPVTAAQLLPILTGFLAPIHFSKLAKNCDED*
Ga0134070_102043322	3300010301	Grasslands Soil	LPAFTPEIFGDWPNGKSYPVTAAQLLPILTGFLAPIHFSKLAKNRDED*
Ga0134082_101230261	3300010303	Grasslands Soil	RIGPIGKSYPVTAAQLLPIRTGFLAPIHFSKLAKNWMEK*
Ga0134086_103125611	3300010323	Grasslands Soil	DWPNGKSYPVTAAQLLPILTGFLAPIHFFKLAKN*
Ga0134065_100352551	3300010326	Grasslands Soil	GKLYPVTAAQLLPIFTGFLAPIHFLKLAKNWIEE*
Ga0126376_107075751	3300010359	Tropical Forest Soil	PNGKLYPVTAAQLLPILTGFLAPIHFSKLAKNWIEK*
Ga0126372_129828811	3300010360	Tropical Forest Soil	SFEDWPIGKLYPVTAAQLFPILTGFLAPIHFSKLAKNWIQK*
Ga0126377_122534062	3300010362	Tropical Forest Soil	GKSYPVTAAQLLPILTGFLAPIHFSKLAKNWDED*
Ga0126379_126373562	3300010366	Tropical Forest Soil	PNGKSYPVTAAQLLPILTGFLAPIHFSKLAKNWD*
Ga0126383_133613562	3300010398	Tropical Forest Soil	GKLYPVTAAQLLPILTGFLAPIHFSKLAKNCDDD*
Ga0105246_112374821	3300011119	Miscanthus Rhizosphere	GDWPTGKSYPVTAAQLLPVLTGFLAPIHFSKLAKNWDED*
Ga0137364_103876881	3300012198	Vadose Zone Soil	HYSRIGPIGKSYPVTAAQLLPIRTGFLAPIHFSKLAKNWIEK*
Ga0137364_112715731	3300012198	Vadose Zone Soil	DWPNGKSYPVTAAQLLPILTGFLAPIHFSKLAKNRDED*
Ga0137383_100083771	3300012199	Vadose Zone Soil	LHPRTLSGIGLGKSYPVTAAQLLPVCTGFLAPIHFFKLAKN*
Ga0137383_110126252	3300012199	Vadose Zone Soil	DWPIGKLYPVTAAQLPPILTGFLAPIHFFKLAKNWIEE*
Ga0137382_104616741	3300012200	Vadose Zone Soil	HACHYSDWPNGKSYPVTAAQLLPILTGFLAPIHFFKLAKN*
Ga0137365_100893414	3300012201	Vadose Zone Soil	GLASGKLYPVTAAQLLPILTGFLAPIHFFKLAKNWAED*
Ga0137399_102070301	3300012203	Vadose Zone Soil	NGKSYPVTAAQLLPILTGFLAPIHFSKLAKNWTEE*
Ga0137381_105590452	3300012207	Vadose Zone Soil	WPIGKLYPVTAAQLLPIRTGFLAPIHFFKLAKNWIEK*
Ga0137376_115434941	3300012208	Vadose Zone Soil	PIGKSYPVTAAQLLPIRTGFLAPIHFSKLAKNWIEK*
Ga0137377_105478801	3300012211	Vadose Zone Soil	NWPNGKLYPVTAAQLLPIRTGFLAPVHFFKLAKNWIEE*
Ga0137372_100662545	3300012350	Vadose Zone Soil	PIGKLYPVTAAQLLPIRTGFLAPIHFFKLAKNWIEK*
Ga0137386_101001852	3300012351	Vadose Zone Soil	MTAEGKSYPVTAAQLLRLHTGFLAPIHCFKLAKN*
Ga0137384_102434001	3300012357	Vadose Zone Soil	PEIFGDWPNGKSYPVTAAQLLPILTGFLAPIHFSKLAKNRDEH*
Ga0137368_100193048	3300012358	Vadose Zone Soil	DWPNGKSYPVTAAQLLPSLTGFLAPIHFFKLAKN*
Ga0137385_106361281	3300012359	Vadose Zone Soil	GDWPNGKSYPVTAAQLLSILTGFLAPIHFSKLAKNCSED*
Ga0137360_118535221	3300012361	Vadose Zone Soil	PQKNFGDWPSGKLYPVTAAQLLPILTGFLAPIHFSKLAKNWIED*
Ga0137361_100218608	3300012362	Vadose Zone Soil	DWPNGKSYPVTAAQLLPIRTGFLAPIHFFKLAKNCIQE*
Ga0137361_110371012	3300012362	Vadose Zone Soil	DWPSGKLYPVTAAQLLPILTGFLAPIHFSKLAKNWIED*
Ga0137358_101664083	3300012582	Vadose Zone Soil	FGDWPNGKSYPVTAAQLLPILTGFLAPIHFSKLAKNWLQK*
Ga0157308_103928682	3300012910	Soil	GKSYPVTAAQLLPILTGFLAPIHFSKLAKNRDED*
Ga0137395_101716871	3300012917	Vadose Zone Soil	GKSYPVTAAQLLPIRTGFLAPIHFFKLAKNWIEE*
Ga0137359_104146622	3300012923	Vadose Zone Soil	WPNGKSYPVTAAQLLPIRTGFLAPIHFSKLAKNWDDD*
Ga0137359_109129282	3300012923	Vadose Zone Soil	GKSYPVTAAQLLPIRTGFLAPIHFSKLAKNWMEK*
Ga0137419_105021172	3300012925	Vadose Zone Soil	DWPNGKLYPVTAAQLLPILTGFLAPIHFSKLAKNWNEE*
Ga0137419_112216752	3300012925	Vadose Zone Soil	GKSYPVTAAQLLPILTGFLAPIHFSKLAKNWIEK*
Ga0137419_113194681	3300012925	Vadose Zone Soil	GKLYPVTAAQLLPILTGFLAPIHFSKLAKNQNED*
Ga0137419_113608792	3300012925	Vadose Zone Soil	SGIGPIGKSYPVTAAQLLPILTGFLAPIHFSKLAKNWIQK*
Ga0137407_1000305712	3300012930	Vadose Zone Soil	PRKVFGDWPNGKSYPVTAAQLLPILTGFLAPIHFSKLAKNCLQK*
Ga0164300_104343512	3300012951	Soil	ACHYSDWPNGKSYPVTAAQLLPILTGFLAPIHFFKLAKNCAED*
Ga0164298_104136812	3300012955	Soil	PNGKLYPVTAAQLLPVRTGFLAPIHFSKLAKNRDED*
Ga0164301_102978493	3300012960	Soil	WPNGKSYPVTAAQLLPILTGFLAPIHFSKLAKNWIEK*
Ga0164301_107961462	3300012960	Soil	GDWPNGKSYPVTAAQLLPILTGFLAPIHFSKLAKNWFQN*
Ga0126369_115774162	3300012971	Tropical Forest Soil	GKSYPVTAAQLLPILTGFLAPIHFSKLAKNCDED*
Ga0134110_102522172	3300012975	Grasslands Soil	WPNGKSYPVTAAQLLPILTGFLAPIHFSKLAKNRDED*
Ga0164308_105576921	3300012985	Soil	WPNGKSYPVTAAQLLPILTGFLAPIHFFKLAKNCAED*
Ga0164305_102511131	3300012989	Soil	PRNAFDDWPNGKSYPVTAAQLLPILTGFLAPIHFFKLAKN*
Ga0157371_110228621	3300013102	Corn Rhizosphere	FDDWPNGKSYPVTAAQLLPILTGFLAPIHFPKLAKNRDED*
Ga0157374_102964971	3300013296	Miscanthus Rhizosphere	LKFSGIGPIGKSYPVTAAQLLPILTGFLAPIHFFKLAKN*
Ga0157372_106898411	3300013307	Corn Rhizosphere	PRLHLRNSFDDWPNGKSYPVTAAQLLPILTGFLAPIHFSKLAKNREED*
Ga0157372_112263621	3300013307	Corn Rhizosphere	HLRNSFDDWPNGKSYPVTAAQLLPILTGFLAPIHFSKLAKNRDED*
Ga0157372_126140861	3300013307	Corn Rhizosphere	PRNGFGDWPTGKSYPVTAAQLLPVLTGFLAPIHFSKLAKNWDED*
Ga0134078_102904801	3300014157	Grasslands Soil	IGKSYPVTAAQLLPIRTGFLAPIHFSKLAKNWIEN*
Ga0134079_103421461	3300014166	Grasslands Soil	PAFTPEIFGDWPNGKSYPVTEAQLLPILTGFLAPIHFSKLAKNRDED*
Ga0132258_106191801	3300015371	Arabidopsis Rhizosphere	GKLYPVTAAQLLPILTGFLAPIHVFKLAKNRNED*
Ga0132256_1038795741	3300015372	Arabidopsis Rhizosphere	LRNAFDDWPNGKSYPVTAAQLLPILTGFLAPIHFSKLAKNRDDD*
Ga0132257_1008056731	3300015373	Arabidopsis Rhizosphere	DWPNGKSYPVTAAQLLPILTGFLAPIHFSKLAKNRDDD*
Ga0132257_1014553572	3300015373	Arabidopsis Rhizosphere	FGDWPNGKSYPVTAAQLLPILTGFLAPIHFSKLAKNWDEE*
Ga0132257_1015132211	3300015373	Arabidopsis Rhizosphere	NGLGDWPNGKSYPVTAAQLLTIRTGFLAPIHFSKLAKNWDDD*
Ga0132255_10002855310	3300015374	Arabidopsis Rhizosphere	DGKSYPVTAAQLLPIRTGFLAPIHDQNPFHNEFSKLAKNCCQK*
Ga0132255_1006807661	3300015374	Arabidopsis Rhizosphere	NAFDDWPNGKSYPVTAAQLLPILTGFLAPIHFSKLAKNRDDD*
Ga0132255_1011764761	3300015374	Arabidopsis Rhizosphere	PNGKSYPVTAAQLLPILTGFLAPIHFSKLAKNCAED*
Ga0132255_1031978521	3300015374	Arabidopsis Rhizosphere	DWPNGKSYPVTAAQLLPIRTGFLAPIHFSKLAKNRDDD*
Ga0132255_1037730852	3300015374	Arabidopsis Rhizosphere	DWPNGKSYPVTAAQLLPILTGFLAPIHFSKLAKNWDED*
Ga0182036_103965781	3300016270	Soil	DWPNGKSYPVTAAQLLPILTRFLAPIHFSKLAKNWDED
Ga0182041_100159206	3300016294	Soil	DDWPNGKSYPVTAAQLLPILTGFLAPIHFSKLAKN
Ga0182035_112696382	3300016341	Soil	GPIGKSYPVTAAQLLPILTGFLAPTHFSKLAKNWEED
Ga0182034_111410351	3300016371	Soil	NGFGDWPNGKSYPVTAAQLLPILTGFLAPIHFSKLAKNCDED
Ga0184624_103183521	3300018073	Groundwater Sediment	SDWPNGKSYPVTAAQLLPILTGFLAPIHFSKLAKNRDED
Ga0184625_105574992	3300018081	Groundwater Sediment	NGKSYPVTAAQLLPILTGFLAPIHFFKLAKNWDED
Ga0066662_105055911	3300018468	Grasslands Soil	LSGIGLGKSYPVTAAQLLPVCTGFLAPIHFFKLAKN
Ga0066669_114454412	3300018482	Grasslands Soil	PNGKSYPVTAAQLLPILTGFLAPIHFSKLAKNWHED
Ga0066669_122389792	3300018482	Grasslands Soil	HACHYSDWPNGKSYPVTAAQLLPILTGFLAPIHFSKLAKNRNED
Ga0193722_10096455	3300019877	Soil	LHPRNGFGDWPNGKSYPVTAAQLLPIRTGFLAPIHFSKLAKNWDDD
Ga0193723_10130501	3300019879	Soil	RNAFGDWPNGKSYPVTAAQLLPILTGFLAPIHFSKLAKNRDED
Ga0193729_11007672	3300019887	Soil	DWPNGKSYPVTAAQLLPIRTGFLAPIHFFKLAKNCIQE
Ga0193751_10168421	3300019888	Soil	PNGKLYPVTAAQLLPIRTGFLAPIHFFKLAKNWIEE
Ga0193735_10199853	3300020006	Soil	FGDWPTGKLYPVTAAQLLPIRTGFLAPIHFFKLAKNWIEE
Ga0193735_10711161	3300020006	Soil	CHYNDWPSGKSYPVTAAQLLPILTGFLAPIHFFKLAKNWIEK
Ga0210382_102753612	3300021080	Groundwater Sediment	LGDWPNGKSYPVTAAQLLPIRTGFLAPIHFFKLAKNCIQE
Ga0210406_104634491	3300021168	Soil	PGIFGDWPNGKSYPVTAAQLLPILTGFLAPIHFFKLAKN
Ga0193719_102839852	3300021344	Soil	LYNDWPIGKLYPVTAAQLLPVLTGFLAPIHFFKLAKNWIEK
Ga0193750_10237991	3300021413	Soil	GDWPNGKLYPVTAAQLLPILTGFLAPIHFFKLAKNCFEN
Ga0247677_10641521	3300024245	Soil	NDFRDWPNGKLYPVTAAQLLPVLTGFLAPIHFFKLAKNWDEE
Ga0247687_10745451	3300024286	Soil	LRNDFGDWPNGKSYPVTAAQLLPILTGFLAPIHFSKLAKN
Ga0207659_101527951	3300025926	Miscanthus Rhizosphere	DDWPNGKSYPVTAAQLLPILTGFLAPIHFSKLAKNREED
Ga0207701_103607472	3300025930	Corn, Switchgrass And Miscanthus Rhizosphere	WPNGKSYPVTAAQLLPILTGFLAPIHFSKLAKNRDED
Ga0207706_102219271	3300025933	Corn Rhizosphere	WPNGKSYPVTAAQLLPILTGFLAPIHFSKLAKNCAED
Ga0207669_119206601	3300025937	Miscanthus Rhizosphere	LRNSFDDWPNGKSYPVTAAQLLPILTGFLAPIHFSKLAKNRDED
Ga0207704_113738382	3300025938	Miscanthus Rhizosphere	GDWPNGKSYPVTAAQLLPILTGFLAPIHFSKLAKNRDED
Ga0207661_111843371	3300025944	Corn Rhizosphere	NGKLYPVTAAQLLPVLTGFLAPIHFFKLAKNWDEE
Ga0207651_116200211	3300025960	Switchgrass Rhizosphere	NGKSYPVTAAQLLPILTGFLAPIHFPKLAKNRDED
Ga0209686_10678961	3300026315	Soil	MLSGIGLGKSYPVTAAQLLPVCTGFLAPIHFFKLAKN
Ga0209471_10330121	3300026318	Soil	LSGIGLGKSYPVTAAQLLPVCTGFLAPIHFFKLAKNCCQD
Ga0209801_10700541	3300026326	Soil	GIGHGKSYPVTAAQLLPICTRFLAPIHFFKLAKNCLEN
Ga0209473_13083171	3300026330	Soil	PPGVFGDWPNGKSYPVTAAQLLPILTGFLAPIHFSKLAKNWDED
Ga0209803_10755921	3300026332	Soil	FGGRLADGKLYPVTAAQLLPIFTGFLAPIHFLKLAKNWIEE
Ga0209690_10042851	3300026524	Soil	RMLSGIGLGKSYPVTAAQLLPVCTGFLAPIHFFKLAKNCCQD
Ga0209807_11259631	3300026530	Soil	HPRKISRIGPIGKSYPVTAAQLLPIRTGFLAPTHFSKLAKNWMEK
Ga0209056_104589071	3300026538	Soil	NGKSYPVTAAQLLPILTGFLAPIHFSKLAKNWHED
Ga0179587_110944321	3300026557	Vadose Zone Soil	LHPLKSSGIGPIGKSYPVTAAQLLPILTGFLAPIHFSKLAKNWIEK
Ga0207602_1017231	3300027458	Soil	TPENSGDWPNGKSYPVTAAQLHRLHTGFLAPIHCFKLAKN
Ga0209328_100034441	3300027727	Forest Soil	GPGKSYPVTAAQLLPVCTGFLAPIHFFKLAKNWNQN
Ga0268266_101584421	3300028379	Switchgrass Rhizosphere	PGNDFRDWPNGKLYPVTAAQLLPVLTGFLAPIHFFKLAKNWDEE
Ga0307313_101114241	3300028715	Soil	LHPRKLFGDWPNGKSYPVTAAQLLPILTGFLAPIHFSKLAKNRDED
Ga0307313_101389562	3300028715	Soil	TIGPIGKSYPVTAAQLLPILTGFLAPIHFFKLAKNWIQK
Ga0307282_102549741	3300028784	Soil	RHACLYNDWPNGKSYPVTAAQLLPIRTGFLAPIHFFKLAKNWIEE
Ga0307283_100317591	3300028790	Soil	RNAFDDWPNGKSYPVTAAQLLPVLTGFLAPIHFSKLAKNRNED
Ga0307290_100356031	3300028791	Soil	IGPIGKSYPVTAAQLLPILTGFLAPIHFFKLAKNWIQK
Ga0307292_103644592	3300028811	Soil	IFGDWPNGKSYPVTAAQLLPILTGFLAPIHFSKLAKNRDED
Ga0075386_100126841	3300030916	Soil	PIGKSYPVTAAQLLPILTGFLAPIHFSKLAKNWIEK
Ga0075386_100277752	3300030916	Soil	ACHYNDWPNGKSYPVTAAQLLPILTGFLAPIHFSKLAKNWNED
Ga0075386_100350331	3300030916	Soil	DWPNGKSYPVTAAQLLPILTGFLAPIHFSKLAKNRDED
Ga0170823_142826082	3300031128	Forest Soil	PIGKSYPVTAAQLLPIRTGFLAPIHFSKLAKNWIEK
Ga0307499_102626942	3300031184	Soil	CSGPNDWPNGKSYPVTAAQLLSVLTRFLAPIHFSKLAKNRNED
Ga0170820_113015791	3300031446	Forest Soil	IGKSYPVTAAQLLPILTGFLAPIHFSKLAKNWIEK
Ga0170820_173485511	3300031446	Forest Soil	LHLRNAFDDWPNGKSYPVTAAQLLPILTGFLAPIHFSKLAKNRDEH
Ga0306918_100656335	3300031744	Soil	GDWPNGKSYPVTAAQLLPILTGFLAPIHFSKLAKNWNED
Ga0306925_100896215	3300031890	Soil	NGKSYPVTAAQLLPILTGFLAPIHFSKLAKNWNED
Ga0306925_112811432	3300031890	Soil	PNGKSYPVTAAQLLPILTGFLAPIHFSKLAKNWKED
Ga0310909_105348401	3300031947	Soil	HAYHYNDWPNGKSYPVTAAQLLPILTGFLAPIHFSKLAKNWNED
Ga0306926_100621226	3300031954	Soil	PNGKSYPVTAAQLLPILTGFLAPIHFSKLAKNWNED
Ga0306922_102198904	3300032001	Soil	WFGDWPNGKSYPVTAAQLLPILTGFLAPIHFSKLAKNWNED
Ga0310889_107678122	3300032179	Soil	LHPQTGFGDWPNGKSYPVTAAQLLPILTGFLAPIHFSKLAKNWDEE
Ga0307471_1007231131	3300032180	Hardwood Forest Soil	FGDWPNGKLYPVTAAQLLPIRTGFLAPIHFFKLAKNWIEE
Ga0307471_1007690971	3300032180	Hardwood Forest Soil	NGKSYPVTAAQLLPILTGFLAPIHFFKLAKNRDED
Ga0307471_1034085072	3300032180	Hardwood Forest Soil	KLSGIGLGKSYPVTAAQLLPVYTGFLAPIHFFKLAKN

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F032746

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences