| Basic Information | |
|---|---|
| Family ID | F032486 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 180 |
| Average Sequence Length | 38 residues |
| Representative Sequence | QATLKEMQRLSREVLFETLPHPPRRKRLGKKVLGLM |
| Number of Associated Samples | 143 |
| Number of Associated Scaffolds | 180 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.12 % |
| % of genes near scaffold ends (potentially truncated) | 97.78 % |
| % of genes from short scaffolds (< 2000 bps) | 80.00 % |
| Associated GOLD sequencing projects | 136 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (66.667 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment (7.778 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.444 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (30.556 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.81% β-sheet: 0.00% Coil/Unstructured: 67.19% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 180 Family Scaffolds |
|---|---|---|
| PF01609 | DDE_Tnp_1 | 3.89 |
| PF01797 | Y1_Tnp | 1.67 |
| PF01408 | GFO_IDH_MocA | 1.11 |
| PF08308 | PEGA | 1.11 |
| PF07690 | MFS_1 | 1.11 |
| PF05050 | Methyltransf_21 | 1.11 |
| PF14294 | DUF4372 | 1.11 |
| PF06439 | 3keto-disac_hyd | 1.11 |
| PF13546 | DDE_5 | 1.11 |
| PF04542 | Sigma70_r2 | 1.11 |
| PF13542 | HTH_Tnp_ISL3 | 1.11 |
| PF00144 | Beta-lactamase | 1.11 |
| PF03825 | Nuc_H_symport | 1.11 |
| PF09195 | Endonuc-BglII | 0.56 |
| PF00583 | Acetyltransf_1 | 0.56 |
| PF01476 | LysM | 0.56 |
| PF00326 | Peptidase_S9 | 0.56 |
| PF08240 | ADH_N | 0.56 |
| PF01208 | URO-D | 0.56 |
| PF14410 | GH-E | 0.56 |
| PF16499 | Melibiase_2 | 0.56 |
| PF04972 | BON | 0.56 |
| PF02880 | PGM_PMM_III | 0.56 |
| PF03481 | Sua5_C | 0.56 |
| PF16363 | GDP_Man_Dehyd | 0.56 |
| PF01189 | Methyltr_RsmB-F | 0.56 |
| PF16576 | HlyD_D23 | 0.56 |
| PF02744 | GalP_UDP_tr_C | 0.56 |
| PF13817 | DDE_Tnp_IS66_C | 0.56 |
| PF00496 | SBP_bac_5 | 0.56 |
| PF00383 | dCMP_cyt_deam_1 | 0.56 |
| PF14237 | GYF_2 | 0.56 |
| PF07650 | KH_2 | 0.56 |
| PF09907 | HigB_toxin | 0.56 |
| PF13701 | DDE_Tnp_1_4 | 0.56 |
| PF13177 | DNA_pol3_delta2 | 0.56 |
| PF01936 | NYN | 0.56 |
| PF00722 | Glyco_hydro_16 | 0.56 |
| PF01695 | IstB_IS21 | 0.56 |
| PF13229 | Beta_helix | 0.56 |
| PF14499 | DUF4437 | 0.56 |
| PF00082 | Peptidase_S8 | 0.56 |
| PF01699 | Na_Ca_ex | 0.56 |
| PF02913 | FAD-oxidase_C | 0.56 |
| PF13419 | HAD_2 | 0.56 |
| PF13604 | AAA_30 | 0.56 |
| PF04055 | Radical_SAM | 0.56 |
| PF03462 | PCRF | 0.56 |
| PF07679 | I-set | 0.56 |
| PF11999 | Ice_binding | 0.56 |
| PF01053 | Cys_Met_Meta_PP | 0.56 |
| PF13884 | Peptidase_S74 | 0.56 |
| PF01161 | PBP | 0.56 |
| PF07505 | DUF5131 | 0.56 |
| PF08751 | TrwC | 0.56 |
| PF02371 | Transposase_20 | 0.56 |
| PF11897 | DUF3417 | 0.56 |
| PF00533 | BRCT | 0.56 |
| PF13602 | ADH_zinc_N_2 | 0.56 |
| PF00155 | Aminotran_1_2 | 0.56 |
| PF01979 | Amidohydro_1 | 0.56 |
| PF00873 | ACR_tran | 0.56 |
| PF13432 | TPR_16 | 0.56 |
| PF00400 | WD40 | 0.56 |
| PF00027 | cNMP_binding | 0.56 |
| PF12307 | DUF3631 | 0.56 |
| PF02541 | Ppx-GppA | 0.56 |
| PF12679 | ABC2_membrane_2 | 0.56 |
| PF07969 | Amidohydro_3 | 0.56 |
| PF10130 | PIN_2 | 0.56 |
| PF03741 | TerC | 0.56 |
| PF11903 | ParD_like | 0.56 |
| PF01745 | IPT | 0.56 |
| PF05345 | He_PIG | 0.56 |
| PF06283 | ThuA | 0.56 |
| PF07977 | FabA | 0.56 |
| PF00072 | Response_reg | 0.56 |
| PF04255 | DUF433 | 0.56 |
| COG ID | Name | Functional Category | % Frequency in 180 Family Scaffolds |
|---|---|---|---|
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 3.89 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 3.89 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 3.89 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 3.89 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 3.89 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 3.89 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 1.67 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 1.11 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 1.11 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 1.11 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 1.11 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 1.11 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 1.11 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 1.11 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 1.11 |
| COG0248 | Exopolyphosphatase/pppGpp-phosphohydrolase | Signal transduction mechanisms [T] | 1.11 |
| COG4422 | Bacteriophage protein gp37 | Mobilome: prophages, transposons [X] | 0.56 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.56 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.56 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.56 |
| COG0387 | Cation (Ca2+/Na+/K+)/H+ antiporter ChaA | Inorganic ion transport and metabolism [P] | 0.56 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.56 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.56 |
| COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 0.56 |
| COG2273 | Beta-glucanase, GH16 family | Carbohydrate transport and metabolism [G] | 0.56 |
| COG4706 | Predicted 3-hydroxylacyl-ACP dehydratase, HotDog domain | Lipid transport and metabolism [I] | 0.56 |
| COG4813 | Trehalose utilization protein | Carbohydrate transport and metabolism [G] | 0.56 |
| COG0216 | Protein chain release factor RF1 | Translation, ribosomal structure and biogenesis [J] | 0.56 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.56 |
| COG0144 | 16S rRNA C967 or C1407 C5-methylase, RsmB/RsmF family | Translation, ribosomal structure and biogenesis [J] | 0.56 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.56 |
| COG0407 | Uroporphyrinogen-III decarboxylase HemE | Coenzyme transport and metabolism [H] | 0.56 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.56 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.56 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.56 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.56 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.56 |
| COG1881 | Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) family | General function prediction only [R] | 0.56 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.56 |
| COG0033 | Phosphoglucomutase/phosphomannomutase | Carbohydrate transport and metabolism [G] | 0.56 |
| COG0530 | Ca2+/Na+ antiporter | Inorganic ion transport and metabolism [P] | 0.56 |
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.56 |
| COG1432 | NYN domain, predicted PIN-related RNAse, tRNA/rRNA maturation | General function prediction only [R] | 0.56 |
| COG1186 | Protein chain release factor PrfB | Translation, ribosomal structure and biogenesis [J] | 0.56 |
| COG1109 | Phosphomannomutase | Carbohydrate transport and metabolism [G] | 0.56 |
| COG0861 | Tellurite resistance membrane protein TerC | Inorganic ion transport and metabolism [P] | 0.56 |
| COG0764 | 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein) dehydratase | Lipid transport and metabolism [I] | 0.56 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 66.67 % |
| Unclassified | root | N/A | 33.33 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000787|JGI11643J11755_11521403 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales | 739 | Open in IMG/M |
| 3300001397|JGI20177J14857_1031044 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium | 611 | Open in IMG/M |
| 3300005332|Ga0066388_107180454 | Not Available | 560 | Open in IMG/M |
| 3300005365|Ga0070688_100154852 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1569 | Open in IMG/M |
| 3300005554|Ga0066661_10226946 | Not Available | 1157 | Open in IMG/M |
| 3300005662|Ga0078894_10279549 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1515 | Open in IMG/M |
| 3300005841|Ga0068863_100267038 | All Organisms → cellular organisms → Bacteria | 1655 | Open in IMG/M |
| 3300005986|Ga0075152_10306223 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 887 | Open in IMG/M |
| 3300005986|Ga0075152_10477280 | All Organisms → cellular organisms → Bacteria → PVC group | 682 | Open in IMG/M |
| 3300006056|Ga0075163_11625743 | Not Available | 620 | Open in IMG/M |
| 3300006795|Ga0075520_1062699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1753 | Open in IMG/M |
| 3300006796|Ga0066665_11319993 | Not Available | 554 | Open in IMG/M |
| 3300006864|Ga0066797_1303797 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300009137|Ga0066709_100901228 | Not Available | 1289 | Open in IMG/M |
| 3300009137|Ga0066709_104016454 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 535 | Open in IMG/M |
| 3300009167|Ga0113563_10298799 | Not Available | 1668 | Open in IMG/M |
| 3300009502|Ga0114951_10015352 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5498 | Open in IMG/M |
| 3300009597|Ga0105259_1006456 | All Organisms → cellular organisms → Bacteria | 2217 | Open in IMG/M |
| 3300009597|Ga0105259_1108125 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 663 | Open in IMG/M |
| 3300009629|Ga0116119_1064687 | All Organisms → cellular organisms → Bacteria → PVC group | 934 | Open in IMG/M |
| 3300009629|Ga0116119_1153610 | Not Available | 575 | Open in IMG/M |
| 3300009630|Ga0116114_1023367 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1851 | Open in IMG/M |
| 3300009630|Ga0116114_1152777 | Not Available | 589 | Open in IMG/M |
| 3300009630|Ga0116114_1156315 | Not Available | 580 | Open in IMG/M |
| 3300009637|Ga0116118_1227657 | Not Available | 577 | Open in IMG/M |
| 3300009640|Ga0116126_1174215 | Not Available | 706 | Open in IMG/M |
| 3300009641|Ga0116120_1099219 | Not Available | 962 | Open in IMG/M |
| 3300009678|Ga0105252_10039291 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1761 | Open in IMG/M |
| 3300009684|Ga0114958_10481224 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium VVV1 | 597 | Open in IMG/M |
| 3300009782|Ga0116157_10106362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 1659 | Open in IMG/M |
| 3300010339|Ga0074046_10649633 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 622 | Open in IMG/M |
| 3300010341|Ga0074045_10046261 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Roseibacillus → Roseibacillus ishigakijimensis | 3174 | Open in IMG/M |
| 3300010341|Ga0074045_10287308 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
| 3300010341|Ga0074045_10588776 | Not Available | 710 | Open in IMG/M |
| 3300010343|Ga0074044_10053564 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2763 | Open in IMG/M |
| 3300010355|Ga0116242_10078012 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3659 | Open in IMG/M |
| 3300010379|Ga0136449_100171340 | Not Available | 4201 | Open in IMG/M |
| 3300010379|Ga0136449_101271752 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1150 | Open in IMG/M |
| 3300010391|Ga0136847_11498499 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Fraserbacteria | 845 | Open in IMG/M |
| 3300010885|Ga0133913_11301157 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Opitutus → unclassified Opitutus → Opitutus sp. GAS368 | 1856 | Open in IMG/M |
| 3300011090|Ga0138579_1264620 | Not Available | 557 | Open in IMG/M |
| 3300011403|Ga0137313_1056826 | Not Available | 686 | Open in IMG/M |
| 3300011432|Ga0137428_1015110 | Not Available | 1942 | Open in IMG/M |
| 3300011442|Ga0137437_1271492 | Not Available | 583 | Open in IMG/M |
| 3300012038|Ga0137431_1001087 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 8714 | Open in IMG/M |
| 3300012129|Ga0137345_1050042 | Not Available | 539 | Open in IMG/M |
| 3300012133|Ga0137329_1033116 | All Organisms → cellular organisms → Bacteria → PVC group | 654 | Open in IMG/M |
| 3300012201|Ga0137365_10750318 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 713 | Open in IMG/M |
| 3300012202|Ga0137363_10239597 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1471 | Open in IMG/M |
| 3300012209|Ga0137379_11503008 | Not Available | 574 | Open in IMG/M |
| 3300012350|Ga0137372_10918087 | Not Available | 619 | Open in IMG/M |
| 3300012923|Ga0137359_10313392 | Not Available | 1396 | Open in IMG/M |
| 3300012929|Ga0137404_11180617 | Not Available | 704 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10001338 | All Organisms → cellular organisms → Bacteria | 36099 | Open in IMG/M |
| 3300013297|Ga0157378_12377012 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Gemmata | 582 | Open in IMG/M |
| 3300014156|Ga0181518_10408466 | Not Available | 655 | Open in IMG/M |
| 3300014159|Ga0181530_10377232 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 726 | Open in IMG/M |
| 3300014160|Ga0181517_10065972 | All Organisms → cellular organisms → Bacteria | 2178 | Open in IMG/M |
| 3300014161|Ga0181529_10119383 | All Organisms → cellular organisms → Bacteria | 1649 | Open in IMG/M |
| 3300014208|Ga0172379_10238022 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1252 | Open in IMG/M |
| 3300014312|Ga0075345_1134383 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300014491|Ga0182014_10047919 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2984 | Open in IMG/M |
| 3300014491|Ga0182014_10238244 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium ADurb.Bin006 | 962 | Open in IMG/M |
| 3300014491|Ga0182014_10592018 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium ADurb.Bin006 | 536 | Open in IMG/M |
| 3300014491|Ga0182014_10653406 | Not Available | 501 | Open in IMG/M |
| 3300014493|Ga0182016_10209267 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium ADurb.Bin006 | 1253 | Open in IMG/M |
| 3300014493|Ga0182016_10278123 | All Organisms → cellular organisms → Bacteria → PVC group | 1034 | Open in IMG/M |
| 3300014499|Ga0182012_10004026 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula | 15500 | Open in IMG/M |
| 3300014499|Ga0182012_10336433 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium ADurb.Bin006 | 1010 | Open in IMG/M |
| 3300014501|Ga0182024_11631319 | Not Available | 730 | Open in IMG/M |
| 3300014502|Ga0182021_11404997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 841 | Open in IMG/M |
| 3300014839|Ga0182027_11766126 | Not Available | 599 | Open in IMG/M |
| 3300015242|Ga0137412_10609937 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Brocadiaceae → Candidatus Brocadia → Candidatus Brocadia fulgida | 825 | Open in IMG/M |
| 3300015264|Ga0137403_10190174 | Not Available | 1992 | Open in IMG/M |
| 3300015264|Ga0137403_10422725 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula | 1210 | Open in IMG/M |
| 3300015360|Ga0163144_11195486 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Limisphaera → Limisphaera ngatamarikiensis | 699 | Open in IMG/M |
| 3300015360|Ga0163144_11397400 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 623 | Open in IMG/M |
| 3300015360|Ga0163144_11427312 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 614 | Open in IMG/M |
| 3300017935|Ga0187848_10085007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Citrobacter → unclassified Citrobacter → Citrobacter sp. AAK_AS5 | 1461 | Open in IMG/M |
| 3300017974|Ga0187777_10231764 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1250 | Open in IMG/M |
| 3300017988|Ga0181520_10221763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. | 1468 | Open in IMG/M |
| 3300017988|Ga0181520_10743530 | Not Available | 666 | Open in IMG/M |
| 3300018003|Ga0187876_1289954 | Not Available | 524 | Open in IMG/M |
| 3300018008|Ga0187888_1002160 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula | 17338 | Open in IMG/M |
| 3300018008|Ga0187888_1354683 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium ADurb.Bin006 | 557 | Open in IMG/M |
| 3300018014|Ga0187860_1414427 | Not Available | 502 | Open in IMG/M |
| 3300018016|Ga0187880_1358603 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300018017|Ga0187872_10065541 | All Organisms → cellular organisms → Bacteria | 1894 | Open in IMG/M |
| 3300018017|Ga0187872_10383562 | Not Available | 598 | Open in IMG/M |
| 3300018030|Ga0187869_10269580 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales | 822 | Open in IMG/M |
| 3300018035|Ga0187875_10585679 | Not Available | 589 | Open in IMG/M |
| 3300018038|Ga0187855_10873843 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300018042|Ga0187871_10513240 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 663 | Open in IMG/M |
| 3300018046|Ga0187851_10788641 | Not Available | 535 | Open in IMG/M |
| 3300018071|Ga0184618_10100894 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. ND1 | 1131 | Open in IMG/M |
| 3300019868|Ga0193720_1003886 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula | 2026 | Open in IMG/M |
| 3300020156|Ga0196970_1021973 | All Organisms → cellular organisms → Bacteria | 1571 | Open in IMG/M |
| 3300020213|Ga0163152_10138677 | Not Available | 1423 | Open in IMG/M |
| 3300020814|Ga0214088_1515275 | All Organisms → cellular organisms → Bacteria | 4693 | Open in IMG/M |
| 3300021064|Ga0206225_1056303 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 799 | Open in IMG/M |
| 3300021073|Ga0210378_10050621 | Not Available | 1638 | Open in IMG/M |
| 3300021081|Ga0210379_10177839 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300021090|Ga0210377_10749630 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 533 | Open in IMG/M |
| 3300022553|Ga0212124_10060355 | All Organisms → cellular organisms → Bacteria | 2207 | Open in IMG/M |
| 3300022555|Ga0212088_10135590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → unclassified Methylococcales → Methylococcales bacterium | 2126 | Open in IMG/M |
| 3300023068|Ga0224554_1047039 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
| 3300023068|Ga0224554_1098285 | Not Available | 677 | Open in IMG/M |
| 3300023068|Ga0224554_1102570 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium | 657 | Open in IMG/M |
| 3300023258|Ga0224535_1063629 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 829 | Open in IMG/M |
| 3300025324|Ga0209640_11223556 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria | 562 | Open in IMG/M |
| 3300025444|Ga0208189_1082561 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales | 574 | Open in IMG/M |
| 3300025498|Ga0208819_1132559 | Not Available | 508 | Open in IMG/M |
| 3300025836|Ga0209748_1285761 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium | 527 | Open in IMG/M |
| 3300025936|Ga0207670_10105892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2016 | Open in IMG/M |
| 3300026502|Ga0255350_1063908 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 849 | Open in IMG/M |
| 3300027513|Ga0208685_1060117 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300027573|Ga0208454_1003788 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 4602 | Open in IMG/M |
| 3300027777|Ga0209829_10003276 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 11844 | Open in IMG/M |
| 3300027815|Ga0209726_10126993 | All Organisms → cellular organisms → Bacteria | 1473 | Open in IMG/M |
| 3300027819|Ga0209514_10490497 | Not Available | 505 | Open in IMG/M |
| 3300028556|Ga0265337_1027824 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1701 | Open in IMG/M |
| 3300028800|Ga0265338_10045871 | Not Available | 4013 | Open in IMG/M |
| 3300028874|Ga0302155_10186994 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 906 | Open in IMG/M |
| 3300029799|Ga0311022_14988104 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300029911|Ga0311361_10047845 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales | 6956 | Open in IMG/M |
| 3300029922|Ga0311363_10030011 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula | 9142 | Open in IMG/M |
| 3300029951|Ga0311371_11646124 | All Organisms → cellular organisms → Bacteria → PVC group | 704 | Open in IMG/M |
| 3300029953|Ga0311343_10068081 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales | 4294 | Open in IMG/M |
| 3300029954|Ga0311331_10528071 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
| 3300029956|Ga0302150_10219741 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300029957|Ga0265324_10097722 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium ADurb.Bin006 | 998 | Open in IMG/M |
| 3300029994|Ga0302283_1178520 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300030041|Ga0302274_10255909 | Not Available | 833 | Open in IMG/M |
| 3300030688|Ga0311345_10282599 | All Organisms → cellular organisms → Bacteria | 1587 | Open in IMG/M |
| 3300031232|Ga0302323_101010282 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 924 | Open in IMG/M |
| 3300031234|Ga0302325_13001597 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium ADurb.Bin006 | 545 | Open in IMG/M |
| 3300031236|Ga0302324_100035861 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula | 9237 | Open in IMG/M |
| 3300031236|Ga0302324_100151217 | All Organisms → cellular organisms → Bacteria | 3804 | Open in IMG/M |
| 3300031236|Ga0302324_101338773 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300031249|Ga0265339_10017743 | Not Available | 4208 | Open in IMG/M |
| 3300031524|Ga0302320_10594633 | All Organisms → cellular organisms → Bacteria | 1296 | Open in IMG/M |
| 3300031524|Ga0302320_11117693 | Not Available | 819 | Open in IMG/M |
| 3300031525|Ga0302326_10034685 | All Organisms → cellular organisms → Bacteria | 9992 | Open in IMG/M |
| 3300031525|Ga0302326_12390993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales | 667 | Open in IMG/M |
| 3300031616|Ga0307508_10000112 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae | 95874 | Open in IMG/M |
| 3300031616|Ga0307508_10000449 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae | 49299 | Open in IMG/M |
| 3300031711|Ga0265314_10640729 | Not Available | 543 | Open in IMG/M |
| 3300031726|Ga0302321_102567215 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium | 595 | Open in IMG/M |
| 3300031746|Ga0315293_10786149 | Not Available | 698 | Open in IMG/M |
| 3300031902|Ga0302322_100463955 | All Organisms → cellular organisms → Bacteria → PVC group | 1467 | Open in IMG/M |
| 3300031947|Ga0310909_10506172 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1012 | Open in IMG/M |
| 3300031997|Ga0315278_10078575 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales | 3285 | Open in IMG/M |
| 3300031997|Ga0315278_10787359 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 961 | Open in IMG/M |
| 3300031997|Ga0315278_10996975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Oscillatoriaceae → Lyngbya → unclassified Lyngbya → Lyngbya sp. PCC 8106 | 834 | Open in IMG/M |
| 3300031997|Ga0315278_11315213 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 | 704 | Open in IMG/M |
| 3300031999|Ga0315274_11876097 | Not Available | 545 | Open in IMG/M |
| 3300032118|Ga0315277_11138984 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium ADurb.Bin006 | 698 | Open in IMG/M |
| 3300032143|Ga0315292_10643324 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 893 | Open in IMG/M |
| 3300032143|Ga0315292_11378061 | Not Available | 575 | Open in IMG/M |
| 3300032156|Ga0315295_10145256 | All Organisms → cellular organisms → Bacteria | 2353 | Open in IMG/M |
| 3300032275|Ga0315270_10421454 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 853 | Open in IMG/M |
| 3300032275|Ga0315270_11174545 | Not Available | 511 | Open in IMG/M |
| 3300032401|Ga0315275_11144792 | Not Available | 849 | Open in IMG/M |
| 3300032516|Ga0315273_12018778 | Not Available | 684 | Open in IMG/M |
| 3300032783|Ga0335079_11642405 | Not Available | 630 | Open in IMG/M |
| 3300032895|Ga0335074_10435071 | All Organisms → cellular organisms → Bacteria | 1400 | Open in IMG/M |
| 3300032896|Ga0335075_10006475 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula | 18097 | Open in IMG/M |
| 3300033402|Ga0326728_10052887 | All Organisms → cellular organisms → Bacteria | 5861 | Open in IMG/M |
| 3300033402|Ga0326728_10059420 | All Organisms → cellular organisms → Bacteria | 5336 | Open in IMG/M |
| 3300033402|Ga0326728_10360983 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1271 | Open in IMG/M |
| 3300033402|Ga0326728_11098634 | Not Available | 539 | Open in IMG/M |
| 3300033405|Ga0326727_10488828 | Not Available | 1077 | Open in IMG/M |
| 3300033405|Ga0326727_10921341 | Not Available | 650 | Open in IMG/M |
| 3300033488|Ga0316621_11374498 | Not Available | 539 | Open in IMG/M |
| 3300033513|Ga0316628_102966734 | Not Available | 621 | Open in IMG/M |
| 3300033521|Ga0316616_100673844 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 1232 | Open in IMG/M |
| 3300034126|Ga0370486_165484 | Not Available | 544 | Open in IMG/M |
| 3300034130|Ga0370494_202535 | Not Available | 516 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 7.78% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 7.22% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 6.11% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 5.56% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.00% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 5.00% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 4.44% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.89% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.33% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.33% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 3.33% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 3.33% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 3.33% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 2.78% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 2.78% |
| Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 2.22% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.67% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.67% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.67% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.67% |
| Wastewater Effluent | Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent | 1.67% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.11% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 1.11% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.11% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.11% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.11% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.11% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 1.11% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 1.11% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.56% |
| Freshwater Lake Hypolimnion | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion | 0.56% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.56% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.56% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.56% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.56% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.56% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.56% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.56% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.56% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.56% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.56% |
| Anaerobic Digester Digestate | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Digester Digestate | 0.56% |
| Granular Sludge | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Granular Sludge | 0.56% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300001397 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-072012 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005986 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 6/11/14 C2 DNA | Engineered | Open in IMG/M |
| 3300006056 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 10/23/14 1A DNA | Engineered | Open in IMG/M |
| 3300006795 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006864 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009502 | Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG | Environmental | Open in IMG/M |
| 3300009597 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT299 | Environmental | Open in IMG/M |
| 3300009629 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 | Environmental | Open in IMG/M |
| 3300009630 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 | Environmental | Open in IMG/M |
| 3300009637 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 | Environmental | Open in IMG/M |
| 3300009640 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 | Environmental | Open in IMG/M |
| 3300009641 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 | Environmental | Open in IMG/M |
| 3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
| 3300009684 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG | Environmental | Open in IMG/M |
| 3300009782 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC048_MetaG | Engineered | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010355 | AD_USDVca | Engineered | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011090 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 69 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011403 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT166_2 | Environmental | Open in IMG/M |
| 3300011432 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2 | Environmental | Open in IMG/M |
| 3300011442 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2 | Environmental | Open in IMG/M |
| 3300012038 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2 | Environmental | Open in IMG/M |
| 3300012129 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT530_2 | Environmental | Open in IMG/M |
| 3300012133 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT121_2 | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
| 3300014160 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaG | Environmental | Open in IMG/M |
| 3300014161 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaG | Environmental | Open in IMG/M |
| 3300014208 | Groundwater microbial communities from an aquifer near a municipal landfill in Southern Ontario, Canada - Groundwater well OW334 metaG | Environmental | Open in IMG/M |
| 3300014312 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D1 | Environmental | Open in IMG/M |
| 3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014499 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015360 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
| 3300018003 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40 | Environmental | Open in IMG/M |
| 3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
| 3300018014 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40 | Environmental | Open in IMG/M |
| 3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300019868 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s1 | Environmental | Open in IMG/M |
| 3300020156 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1+v_5-13C | Environmental | Open in IMG/M |
| 3300020213 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP8.IB-2 | Environmental | Open in IMG/M |
| 3300020814 | Granular sludge microbial community from anaerobic digester, University of Toronto, Ontario, Canada - UASBVu03_granules megahit | Engineered | Open in IMG/M |
| 3300021064 | Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos B2 | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
| 3300022553 | Powell_combined assembly | Environmental | Open in IMG/M |
| 3300022555 | Alinen_combined assembly | Environmental | Open in IMG/M |
| 3300023068 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 20-24 | Environmental | Open in IMG/M |
| 3300023258 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 30-34 | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025444 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025498 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025836 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 004-21A (SPAdes) | Environmental | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026502 | Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T-25.r1 | Environmental | Open in IMG/M |
| 3300027513 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 (SPAdes) | Environmental | Open in IMG/M |
| 3300027573 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027815 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027819 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW37 contaminated, 5.8 m (SPAdes) | Environmental | Open in IMG/M |
| 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Host-Associated | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028874 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_1 | Environmental | Open in IMG/M |
| 3300029799 | Metagenomes from anaerobic digester of solid waste, Toronto, Canda. Combined Assembly of Gp0238878, Gp0238879, Gp0242100, Gp0242119 | Engineered | Open in IMG/M |
| 3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029953 | II_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300029954 | I_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029956 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_2 | Environmental | Open in IMG/M |
| 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Host-Associated | Open in IMG/M |
| 3300029994 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_4 | Environmental | Open in IMG/M |
| 3300030041 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300030688 | II_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Host-Associated | Open in IMG/M |
| 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Host-Associated | Open in IMG/M |
| 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Host-Associated | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
| 3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
| 3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
| 3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300033488 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300034126 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_16 | Environmental | Open in IMG/M |
| 3300034130 | Peat soil microbial communities from wetlands in Alaska, United States - Collapse_03_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI11643J11755_115214031 | 3300000787 | Soil | AIANWRTVQSTLKSMQQLSRAVLFSTIPGTQRRKRLGKKVLGIT* |
| JGI20177J14857_10310442 | 3300001397 | Arctic Peat Soil | RQIQQTLKEMQRLSREVLFATVPHPPRRKRLGKKVLGLI* |
| Ga0066388_1071804541 | 3300005332 | Tropical Forest Soil | MGAKRRAQSTLKEMQRLSRRVLFETVPHPYRRKKLGKKVLGLM* |
| Ga0070688_1001548521 | 3300005365 | Switchgrass Rhizosphere | RTVQQTLREMQRLSREVLFATVPNPPRRKRLGKKTLGLG* |
| Ga0066661_102269462 | 3300005554 | Soil | TLKEMQKLSRQVLFATVPNPARRKHLGKKVLGLI* |
| Ga0078894_102795491 | 3300005662 | Freshwater Lake | IEQWKQVQATLKEMQRLSRQELFETMPNPNRRKPLAPEVLGTV* |
| Ga0068863_1002670383 | 3300005841 | Switchgrass Rhizosphere | QTLREMQRLSREVLFATVPNPPRRKRLGKKTLGLV* |
| Ga0075152_103062231 | 3300005986 | Wastewater Effluent | KTLKEMQKLSRLELFEKIPGPKRRKRLGKKVLGLI* |
| Ga0075152_104772801 | 3300005986 | Wastewater Effluent | TLKEMQKLSRLELFEKIPGPKRRKRLGKKVLGLI* |
| Ga0075163_116257432 | 3300006056 | Wastewater Effluent | TLKEMQRLSRQELFETMPNPNRRKPLSPEVLGTI* |
| Ga0075520_10626991 | 3300006795 | Arctic Peat Soil | ATLKEMQCLSRQVLFETVPHPQRRKRLAKKALGTM* |
| Ga0066665_113199932 | 3300006796 | Soil | ANWRLVQNTLRQMQRLSRLELFGTVPGPKRRKRLGKKVLGLI* |
| Ga0066797_13037972 | 3300006864 | Soil | QQNLKEMQRLSREVLFATVPHPPRRKRLSKKVLGLI* |
| Ga0066709_1009012281 | 3300009137 | Grasslands Soil | LQQKLRQMQQLSRRVIFQTLPNPPRRKRLGKKVLGLI* |
| Ga0066709_1040164542 | 3300009137 | Grasslands Soil | QTLREMQRLSRQVLFATVPNPPRRKRLGKKTLGLI* |
| Ga0113563_102987991 | 3300009167 | Freshwater Wetlands | AQEILQRMQALSRQVIFETLPGPPRRKRLGKKALGLI* |
| Ga0114951_100153521 | 3300009502 | Freshwater | EILRRLQVLSRQVIFETLPNPPRRKRLGKKVLGLN* |
| Ga0105259_10064564 | 3300009597 | Soil | IIKEMQRLSRRVLFETVPHPPRRKRLGKKVLGLI* |
| Ga0105259_11081252 | 3300009597 | Soil | VQQIIKEMQRLSRRVLFETVPHPPRRKRLGKKVLGLI* |
| Ga0116119_10646871 | 3300009629 | Peatland | TLKEMQRLSREVLFATVPHPPRSKRLSKKILGLI* |
| Ga0116119_11536101 | 3300009629 | Peatland | QDTLKEMQRLSRQVLFETMPHPKRRKCLGKKVLGLI* |
| Ga0116114_10233671 | 3300009630 | Peatland | MREAIANWRRLQDTLKEMQRLSRQVLFETMPHPKRRKCLGKKV |
| Ga0116114_11527771 | 3300009630 | Peatland | AIANWRRLQDTLKEMQRLSRQVLFETMPHPKRRKCLGKKVSGLI* |
| Ga0116114_11563151 | 3300009630 | Peatland | AIANWRRLQDTLKEMQRLSRQVLFETMPHPKRRKCLGKKVLGLI* |
| Ga0116118_12276571 | 3300009637 | Peatland | TLKEMQRLSRQVLFETMPHPKRRKCLGKKVSGLI* |
| Ga0116126_11742152 | 3300009640 | Peatland | LQDALKEMQRLSRQVLFETMPHPKRRKRLGKRVLGLI* |
| Ga0116120_10992191 | 3300009641 | Peatland | TLKEMQRLSRQVLFETMPHPKRRKCLGKKVLGLI* |
| Ga0105252_100392911 | 3300009678 | Soil | QIIKEMQRLSRRVLFETVPHPPRRKRLGKKVLGLI* |
| Ga0114958_104812241 | 3300009684 | Freshwater Lake | TVQTTLKALQRLSRTVLFTTVPGAPRRKRLGKRVLGLI* |
| Ga0116157_101063621 | 3300009782 | Anaerobic Digestor Sludge | QKVLEQMQRLSRQVLFETLPHPERRKRLGKKVLGLV* |
| Ga0074046_106496331 | 3300010339 | Bog Forest Soil | TQEILQRMQALSRHVIFEMLPNPPRRKRLGKRVLGLI* |
| Ga0074045_100462611 | 3300010341 | Bog Forest Soil | EILQRMQALSRHVIFEMLPNPPRRKRLGKRVLGLI* |
| Ga0074045_102873082 | 3300010341 | Bog Forest Soil | QAQEILRQMQTLSRQVIFQTLPSPPRRKRLGKRVLGLI* |
| Ga0074045_105887761 | 3300010341 | Bog Forest Soil | QEILQRMQALSRHVIFEMLPNPPRRKRLGKRVLGLI* |
| Ga0074044_100535647 | 3300010343 | Bog Forest Soil | AQEILQRMQALSRQFIFETLPSPPRRKRLGKKVLGLI* |
| Ga0116242_100780121 | 3300010355 | Anaerobic Digestor Sludge | VLEQMQRLSRQVLFETLPHPERRKRLGKKVLGLV* |
| Ga0136449_1001713405 | 3300010379 | Peatlands Soil | VQQNLKAMQRLSRAVLFATVPHPPRRKRLGKKVLGLI* |
| Ga0136449_1012717521 | 3300010379 | Peatlands Soil | EALKEMQRLSRQVLFETMPHPKRRKRLGKKVLGLI* |
| Ga0136847_114984991 | 3300010391 | Freshwater Sediment | STLREMQRFSRQVLFETLPHPPRRKKLGKKVLGTM* |
| Ga0133913_113011573 | 3300010885 | Freshwater Lake | QTTLKALQRLSRTVLFTTVPGAPRRKRLGKRVLGLI* |
| Ga0138579_12646201 | 3300011090 | Peatlands Soil | AVENWHHTKAILKEMQQLSRQVLFTTIPNPNRRKRLGKKVLGLI* |
| Ga0137313_10568261 | 3300011403 | Soil | VQQIIKELQRLSRRVLFETVPHPPRRKRLGKKVLGLI* |
| Ga0137428_10151102 | 3300011432 | Soil | QQIIKEMQRLSRRVLFETVPHPPRRKRLGKKVLGLI* |
| Ga0137437_12714922 | 3300011442 | Soil | QEILQRMQVLSREVIFGTLPHPSRRKRPGKKVLGLI* |
| Ga0137431_10010871 | 3300012038 | Soil | QVQQIIKEMQRLSRRVLFETVPHPPRRKRLGKKVLGLI* |
| Ga0137345_10500421 | 3300012129 | Soil | RQVQQIIKEMQRLSRRVLFETVPHPPRRKRLGKKVLGLI* |
| Ga0137329_10331161 | 3300012133 | Soil | WRQVQQIIKEMQRLSRRVLFETVPHPPRRKRLGKKVLGLI* |
| Ga0137365_107503181 | 3300012201 | Vadose Zone Soil | QYEGLREAIDTWRQVKQTIKEMQRLSRQVLFSTLPHPPRRKKLGKKVLGLI* |
| Ga0137363_102395972 | 3300012202 | Vadose Zone Soil | VQQTLKHMQQLSRKVLFETLPHPPRRKRLGKKVLGLI* |
| Ga0137379_115030081 | 3300012209 | Vadose Zone Soil | HTLKEMQKLSRQVLFTTVPNPTRRKHLGKKVLGLI* |
| Ga0137372_109180872 | 3300012350 | Vadose Zone Soil | AIANWRHVQQTLKEMQRLSRQVLFTTVPHPPRRKRLGKKVLGLI* |
| Ga0137359_103133921 | 3300012923 | Vadose Zone Soil | QTLKHMQQLSRKVLFETLPHPPRRKRLGKKVLGLI* |
| Ga0137404_111806171 | 3300012929 | Vadose Zone Soil | ATLKEMQRLSRQVLFETMPHPPRRKRLGKKVLGTM* |
| (restricted) Ga0172367_100013381 | 3300013126 | Freshwater | ATLREMQRLSRQVLFETVPNPPRRKRLGKKVLGIK* |
| Ga0157378_123770122 | 3300013297 | Miscanthus Rhizosphere | ILKEMQRLSRCVLFETLPHPPRRKKLGKKVLGLM* |
| Ga0181518_104084662 | 3300014156 | Bog | QDALKEMQRLSRQVLFETMPHPKRRKRLGKRVLGLI* |
| Ga0181530_103772321 | 3300014159 | Bog | AKAILKEMQQLSREVLFTTVPNPNRRKRLGKKVLGLI* |
| Ga0181517_100659721 | 3300014160 | Bog | AIAEWRRLQITLKKMQRLSRQVLFETVTHPPRRKSLSKKVLGTM* |
| Ga0181529_101193831 | 3300014161 | Bog | TLKEMRRLSRQVLFDTVPGPPRRKRLGKKVLGLM* |
| Ga0172379_102380222 | 3300014208 | Groundwater | ATLRRMQVLSREVIFRTLPHPPRRKRLGKRVLGLI* |
| Ga0075345_11343831 | 3300014312 | Natural And Restored Wetlands | ILRQMQALSREQIFNTLPHPPRRKRLGKRVLGLI* |
| Ga0182014_100479191 | 3300014491 | Bog | QILQRMQILSRTVIFGTLPNPPRRKRLGKKVLGLI* |
| Ga0182014_102382441 | 3300014491 | Bog | QQILQRMQILSRTVIFGTLPNPPRRKRLGKKVLGLI* |
| Ga0182014_105920181 | 3300014491 | Bog | QFEWLSQAIENWRQAKAILKEMQQLSRQVLFTTVPNPNRRNRLGKKVLGLI* |
| Ga0182014_106534062 | 3300014491 | Bog | ILARMQALSRQVIFETLPSPPRRKRLGKRVLGLI* |
| Ga0182016_102092671 | 3300014493 | Bog | QEILQQMQALSREVIFGTLPNPPRRKRLGKKVLGLN* |
| Ga0182016_102781231 | 3300014493 | Bog | ILQQMQALSREVIFGTLPNPPRRKRLGKKVLGLN* |
| Ga0182012_100040261 | 3300014499 | Bog | IQATLKEMQRLSRRVLFETVKNLKRRKRLGKKVLGLV* |
| Ga0182012_103364331 | 3300014499 | Bog | EILQQMQALSREVIFGTLPNPPRRKRLGKKVLGLN* |
| Ga0182024_116313191 | 3300014501 | Permafrost | EILKEMQQISREVLFKTVPNPPRRKRLGKRVLGLI* |
| Ga0182021_114049971 | 3300014502 | Fen | EILRQMQTLSRQVIFETLPNPPPRKRLGKRSLGLI* |
| Ga0182027_117661261 | 3300014839 | Fen | TIREMQRLSRQVLFETLPHPPRRKRLGKRVLGLM* |
| Ga0137412_106099371 | 3300015242 | Vadose Zone Soil | VQQTLKAMQRVSRQVLFSTVPHPPRRKKLGQKVLGLI* |
| Ga0137403_101901743 | 3300015264 | Vadose Zone Soil | ITNWRTVQQTLREMQRLSRQVLFATMPNPPRRKRLGKKTLGLI* |
| Ga0137403_104227253 | 3300015264 | Vadose Zone Soil | ITNWRTVQQTLREMQRLSRQVLFATVPNPPRRKRLGKKTLGLI* |
| Ga0163144_111954861 | 3300015360 | Freshwater Microbial Mat | MQQTIKEMQRLSRRVLFESLPHPPRRKKLGKKVLGLI* |
| Ga0163144_113974003 | 3300015360 | Freshwater Microbial Mat | QATLKEMQRLSRHVLFETVKNPPRRKRLGKKVLGLI* |
| Ga0163144_114273121 | 3300015360 | Freshwater Microbial Mat | QTIKEMQRLSRRVLFESLPHPPRRKKLGKKVLGLI* |
| Ga0187848_100850073 | 3300017935 | Peatland | QDALKEMQRLSRQVLFETMPHPKRRKRLGKRVLGLI |
| Ga0187777_102317641 | 3300017974 | Tropical Peatland | TIIKEMQQLSRRVLFETIPDPPRRKRLSKKVLGLK |
| Ga0181520_102217633 | 3300017988 | Bog | ATLKEMRRLSRQVLFDTVPGPPRRKRLGKKVLGLM |
| Ga0181520_107435302 | 3300017988 | Bog | QATLKEMRRLSRQVLFDTVPGPPRRKRLGKKVLGLM |
| Ga0187876_12899542 | 3300018003 | Peatland | EQIIRQMQTLSRQTLFETIPGVARRKRLGKKALGLI |
| Ga0187888_10021601 | 3300018008 | Peatland | AIANWRRLQDTLKEMQRLSRQVLFETMPHPKRRKCLGKKVSGLI |
| Ga0187888_13546832 | 3300018008 | Peatland | RDGKQILERMQTLSRQIIFQTLPNPPRRKRLSKRVLGTS |
| Ga0187860_14144273 | 3300018014 | Peatland | KAILKEMQRLSREVLFTTVPNPNRRKRLGKKVLGLI |
| Ga0187880_13586031 | 3300018016 | Peatland | RLQDTLKEMQRLSRQVLFETMPHPKRRKCLGKKVLGLI |
| Ga0187872_100655413 | 3300018017 | Peatland | QDTLKEMQRLSRQVLFETMPHPKRRKCLGKKVLGLI |
| Ga0187872_103835621 | 3300018017 | Peatland | NWRRLQDTLKEMQRLSRQVLFETMPHPKRRKCLGKKVSGLI |
| Ga0187869_102695801 | 3300018030 | Peatland | AIANWRRLQDTLKEMQRLSRQVLFETMPHPKRRKCLGKKVLGLI |
| Ga0187875_105856791 | 3300018035 | Peatland | RAILKEMQQLSRQVLFATIPNPSRRKRLGKKVLGLI |
| Ga0187855_108738431 | 3300018038 | Peatland | KAILKEMQHLSREVLFTTIPNPNRRKRLGKKVLGLI |
| Ga0187871_105132401 | 3300018042 | Peatland | EKILRQMQTLSRQNLFETVPGVARRKRLGKKVLGLI |
| Ga0187851_107886411 | 3300018046 | Peatland | VQWQEAQAIIKEMQRLSRQVLFETLPHPPRRKRLGKKVLGL |
| Ga0184618_101008943 | 3300018071 | Groundwater Sediment | YEWLREAIAQWRHLQATLRRMQRLSRQVLFASVRHPRRRKKLGKRTLGLI |
| Ga0193720_10038861 | 3300019868 | Soil | LQATIKQMQRLSRAVLFATVPHPPRRKRLSKKVLGLT |
| Ga0196970_10219733 | 3300020156 | Soil | QATLKEMQRLSRQVLFETLPHPPRRKRLGKKALGLM |
| Ga0163152_101386771 | 3300020213 | Freshwater Microbial Mat | EVQQTLKEMQRMSREVLFATVPHPPRRKRLGKRVLGLI |
| Ga0214088_15152751 | 3300020814 | Granular Sludge | ENWRSVQKVLEQMQRLSRQVLFETLPHPERRKRLGKKVLGLV |
| Ga0206225_10563032 | 3300021064 | Deep Subsurface Sediment | QATLQQMQRISREVLFATVPNPPRRKRLTKKTLGLI |
| Ga0210378_100506213 | 3300021073 | Groundwater Sediment | QEILQRMQAVSREAIFGTLPHPPRRKRLGKKVLGLI |
| Ga0210379_101778392 | 3300021081 | Groundwater Sediment | VQTTLKEMQRLSRQVLFATVPHPPRRKKLGKKALGLI |
| Ga0210377_107496302 | 3300021090 | Groundwater Sediment | QVQETLKAMQRLSRAVLFATVPHPPRRKKLGKKVLGLI |
| Ga0212124_100603553 | 3300022553 | Freshwater | QIQATLKEMQRLSRRVLFATVKNPPRRKRLGKKVLGLI |
| Ga0212088_101355901 | 3300022555 | Freshwater Lake Hypolimnion | QEILRRLQVLSRQVIFETLPNPPRRKRLGKKVLGLN |
| Ga0224554_10470393 | 3300023068 | Soil | VIANWRQAKAILKEMQQLSRQVLLTTIPNPNRRKRLGKKVLGLI |
| Ga0224554_10982853 | 3300023068 | Soil | AILKEMQQLSRQVLFTTIPNPNRRKRLGKKVLGLI |
| Ga0224554_11025702 | 3300023068 | Soil | QAKAILKEMQQLSRQVLFTTIPNPNRRKRLGKKVLGLI |
| Ga0224535_10636291 | 3300023258 | Soil | REAQQILQRMQILSRTVIFGTLPNPPRRKRLGKKVLGLI |
| Ga0209640_112235561 | 3300025324 | Soil | QQTLKAMKRLSRQVLFETVPHPPRRKKLSKKVLGLI |
| Ga0208189_10825612 | 3300025444 | Peatland | LQDTLKEMQRLSRQVLFETMPHPKRRKCLGKKVLGLI |
| Ga0208819_11325592 | 3300025498 | Peatland | DTLKEMQRLSRQVLFETMPHPKRRKCLGKKVLGLI |
| Ga0209748_12857611 | 3300025836 | Arctic Peat Soil | WRDAKQILERMQTLSRQIIFQTLPNPPRRKRWSKSVLGNI |
| Ga0207670_101058923 | 3300025936 | Switchgrass Rhizosphere | LQATLKEMQRLSRRVLFETLPHPPRRKKLGKKVLGLM |
| Ga0255350_10639081 | 3300026502 | Soil | KAILKEMQQLSRQVLFTTIPNPNRRKRLGKKVLGLI |
| Ga0208685_10601172 | 3300027513 | Soil | QVQQIIKEMQRLSRRVLFETVPHPPRRKRLGKKVLGLI |
| Ga0208454_10037881 | 3300027573 | Soil | NWRQVQQIIKEMQRLSRRVLFETVPHPPRRKRLGKKVLGLI |
| Ga0209829_100032761 | 3300027777 | Freshwater Lake | TTLKALQRLSRTVLFTTVPGAPRRKRLGKRVLGLI |
| Ga0209726_101269932 | 3300027815 | Groundwater | QTLRDMQRLSRTVLFETVPHPPRRKRLAKKTLGLI |
| Ga0209514_104904971 | 3300027819 | Groundwater | KLQETLREMQRLSRQVLFETLPNPKRRKRLGKKVLGLI |
| Ga0265337_10278241 | 3300028556 | Rhizosphere | QTQEILQRMQALSRHVIFEMLPNPPRRKRLGKRVLGLI |
| Ga0265338_100458711 | 3300028800 | Rhizosphere | AILKEMQQLSREVLFTTIPNPNRRKRLGKKVLGLI |
| Ga0302155_101869941 | 3300028874 | Bog | EVQATLKEMQRLSREVLFETLPHPPRRKRLGKKVLGLM |
| Ga0311022_149881041 | 3300029799 | Anaerobic Digester Digestate | VQKVLEQMQRLSRQVLFETLPHPERRKRLGKKVLGLV |
| Ga0311361_100478451 | 3300029911 | Bog | TIQATLKEMQRLSRRVLFETVKNLKRRKRLGKKVLGLV |
| Ga0311363_100300118 | 3300029922 | Fen | IQATLKEMQRLSRRVLFETVKNLKRRKRLGKKVLGLV |
| Ga0311371_116461241 | 3300029951 | Palsa | AKSVLKEMQQLSRQVLFTTIPNPNRRKRLGKKVLGLI |
| Ga0311343_100680815 | 3300029953 | Bog | ATLKEMQRLSRRVLFETVKNLKRRKRLGKKVLGLV |
| Ga0311331_105280711 | 3300029954 | Bog | ATLKEMQRLSREVLFETLPHPPRRKRLGKKVLGLM |
| Ga0302150_102197411 | 3300029956 | Bog | WLQDAIQNWRAIQATLKEMQRLSRRVLFETVKNPPRRKRLGKKVLGLI |
| Ga0265324_100977221 | 3300029957 | Rhizosphere | KAILKEMQQLSREVLFTTIPNPNRRKRLGKKVLGLI |
| Ga0302283_11785201 | 3300029994 | Fen | QEAIQNWRAIQATLKEMQRLSRRVLFETVKNPPRRKRLGKKVLGLI |
| Ga0302274_102559091 | 3300030041 | Bog | QATLKEMQRLSREVLFETLPHPPRRKRLGKKVLGLM |
| Ga0311345_102825991 | 3300030688 | Bog | VQATLKEMQRLSREVLFETLPHPPRRKRLGKKVLGLM |
| Ga0302323_1010102821 | 3300031232 | Fen | EIQEILQRMQALSREVIVTTLPNPPRRKRLSKLVLGTI |
| Ga0302325_130015971 | 3300031234 | Palsa | KSVLKEMQQLSRQVLFTTIPNPNRRKRLGKKVLGLI |
| Ga0302324_1000358611 | 3300031236 | Palsa | QAQAILKEMQQLSRRVLFTTVPNPNRRKRLGKKVLGLI |
| Ga0302324_1001512177 | 3300031236 | Palsa | AILKEMQQLSRRVLFTTVPNPNRRKRLGKKVLGLI |
| Ga0302324_1013387733 | 3300031236 | Palsa | QAILKEMQQLSRRVLFTTVPNPNRRKRLGKKVLGLI |
| Ga0265339_100177434 | 3300031249 | Rhizosphere | QAKAILKEMQQLSREVLFTTIPNPNRRKRLGKKVLGLI |
| Ga0302320_105946334 | 3300031524 | Bog | QFEWLSAAIENWRQAQATLKKMQQLSREVLFKTLPNPNRRKRLGKKVLGLI |
| Ga0302320_111176931 | 3300031524 | Bog | MQKTIKEMQRLSHRVLFTTVPHPARRKSLSRRALGLI |
| Ga0302326_100346859 | 3300031525 | Palsa | QAKSVLKEMQQLSRQVLFTTIPNPNRRKRLGKKVLGLI |
| Ga0302326_123909931 | 3300031525 | Palsa | AILKEMQQLSREVLFTTVPNPNRRKRLGKKVLGLI |
| Ga0307508_100001121 | 3300031616 | Ectomycorrhiza | TVQTTLKAMQQLSRTVLFTTVPGAPRRKRLGKRVLGMT |
| Ga0307508_1000044935 | 3300031616 | Ectomycorrhiza | VQTTLKAMQQLSRTVLFTTVPGAPRRKRLGKRVLGMT |
| Ga0265314_106407291 | 3300031711 | Rhizosphere | KEAIENWRHMQATLKEMQRLSRRVLFETVQNPPRRKRLGKRVLGLI |
| Ga0265342_104892671 | 3300031712 | Rhizosphere | ENWRAAQEILQRMQTLSREVIFGTLPDPPRRKRLGKKVLGLI |
| Ga0302321_1025672151 | 3300031726 | Fen | WRRVQATLKEMQRLSRRVLFETVKNPPRRKPLGKKVLGLI |
| Ga0315293_107861491 | 3300031746 | Sediment | EAIAHWRDLQQTLKAMQRLSRQVLFATVPHPRRRKRLGKKVLGLI |
| Ga0302322_1004639551 | 3300031902 | Fen | WQELKNILERMQALSRQIIFQSLPNPRRRKRLPKSVLGLN |
| Ga0302322_1011365021 | 3300031902 | Fen | WRQLQEILRRMQALSRQVIFETLPNHPRRKRLGKNVLGTN |
| Ga0310909_105061722 | 3300031947 | Soil | DLQETLERMQELSRAVIFGTLPNPPRRKRLGKRVLGLI |
| Ga0315278_100785751 | 3300031997 | Sediment | QATLKEMQRLSRQVLFETVPHPPRRKRLGKKVLGTM |
| Ga0315278_107873591 | 3300031997 | Sediment | VQSTLREMQRLSRQVLFTTVPHPPRRKRLGKRVLGLI |
| Ga0315278_109969752 | 3300031997 | Sediment | STLRDMQRLSREVLFTTVPHPPRRKRLGKKVLGLI |
| Ga0315278_113152131 | 3300031997 | Sediment | QVQQTLKVMQRLSRQVLFETVPHPPRRKRLGKRVLGLI |
| Ga0315274_118760972 | 3300031999 | Sediment | EWRRVQSVLKEMQRLSRQVLFETLPHPKRRKRLGKRVLGLK |
| Ga0315277_111389841 | 3300032118 | Sediment | LQKILKEMQQLSRQILFETLPNPNRRKRLGKRVLGLI |
| Ga0315292_106433241 | 3300032143 | Sediment | LWETVQHMERIARKILFETVPHARRRKRLSKKVLGLI |
| Ga0315292_113780611 | 3300032143 | Sediment | QAALKEMQRLSRQVLFETVPHPPRRKRLGKKVLGTM |
| Ga0315295_101452561 | 3300032156 | Sediment | QWRTVQSTLREMQRLSREVLFTTLPHPPRRKRLGKRVLGLI |
| Ga0315270_104214541 | 3300032275 | Sediment | AQEILQRMQALSRHVIFETLPSPPRRKRLGKKVLGLI |
| Ga0315270_111745451 | 3300032275 | Sediment | VQGTLKEMQRLSRQVLFETMPHPPRRKRLGKKVLGLM |
| Ga0315275_111447921 | 3300032401 | Sediment | KLQEILKEMQKLSRQVLFETLQNPKRRKRLGKKVLGLI |
| Ga0315273_120187781 | 3300032516 | Sediment | STLREMRRLSREVLFTTVPHPPRRKRLGKKVLGLI |
| Ga0335079_116424051 | 3300032783 | Soil | QSTLKEMQRLSRQVLFEMVPNPPRRKRLGKRVLGLM |
| Ga0335074_104350711 | 3300032895 | Soil | AQAILKEMQQLSREVLFQTLPHPSRRKQLGKNVLGLM |
| Ga0335075_100064751 | 3300032896 | Soil | DAQAILKEMQQLSREVLFQTLPHPSRRKQLGKNVLGLM |
| Ga0326728_100528871 | 3300033402 | Peat Soil | QLQDALKEMQRLSRQVLFETMPHPKRRKRLGKRVLGLI |
| Ga0326728_100594201 | 3300033402 | Peat Soil | KAILKDMQQLSRQVLFATIPNPSRRKRLGKKVLGLI |
| Ga0326728_103609831 | 3300033402 | Peat Soil | QAQEILQRMQALSRLVIFQTLPSPPRRKRLGKRVLGLI |
| Ga0326728_110986341 | 3300033402 | Peat Soil | AKAILKDMQQLSRQVLFATIPNPSRRKRLGKKVLGLI |
| Ga0326727_104888281 | 3300033405 | Peat Soil | LQDALKEMQRLSRQVLFETMPHPKRRKRLGKRVLGLI |
| Ga0326727_109213412 | 3300033405 | Peat Soil | LQATLKEMQRLSRQVLFETVPHPHRRKHLGKKVLGLM |
| Ga0316621_113744982 | 3300033488 | Soil | QGTLKEMQRLSRQVLFETVPHPPRRKRLGKKVLGTM |
| Ga0316628_1029667341 | 3300033513 | Soil | REAIAQWRTVQSTLREMQRLSRQVLFTTVPHPPRRKRLGKRVLGLI |
| Ga0316616_1006738441 | 3300033521 | Soil | AQAILQRMQALSREVIFRTLPSPPRRKRLTKKVLGLI |
| Ga0370486_165484_2_136 | 3300034126 | Untreated Peat Soil | AIEQWREVQATLKEMQRLSRQVMFETIPNPARRKRLGKKVLGLM |
| Ga0370494_202535_1_114 | 3300034130 | Untreated Peat Soil | LQKTLKEMQRLSREELFKTIAGPPRRKRLSKKVLGTN |
| ⦗Top⦘ |