Metagenome / Metatranscriptome Family F032469

Overview

Basic Information

• Family ID: F032469
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 180
• Average Sequence Length: 38 residues
• Representative Sequence: MRAFDRDLIRGGHYGQRPCEPHLKAEHMAAPTNAA
• Number of Associated Samples: 157
• Number of Associated Scaffolds: 180

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Bacteria
• % of genes with valid RBS motifs: 27.37 %
• % of genes near scaffold ends (potentially truncated): 81.67 %
• % of genes from short scaffolds (< 2000 bps): 94.44 %
• Associated GOLD sequencing projects: 151
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.15

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Bacteria (59.444 % of family members)
• NCBI Taxonomy ID: 2
• Taxonomy: All Organisms → cellular organisms → Bacteria

Most Common Ecosystem

• GOLD Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (10.556 % of family members)
• Environment Ontology (ENVO): Unclassified (21.667 % of family members)
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Soil (non-saline) (48.889 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 0.00%
  β-sheet: 0.00%
  Coil/Unstructured: 100.00%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 180 Family Scaffolds
PF02371	Transposase_20	71.11
PF04392	ABC_sub_bind	2.22
PF01548	DEDD_Tnp_IS110	1.11
PF03401	TctC	0.56
PF13467	RHH_4	0.56
PF13531	SBP_bac_11	0.56
PF00596	Aldolase_II	0.56
PF10011	DUF2254	0.56
PF00582	Usp	0.56
PF03924	CHASE	0.56
PF09209	CecR_C	0.56
PF07366	SnoaL	0.56
PF02743	dCache_1	0.56
PF08031	BBE	0.56

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 180 Family Scaffolds
COG3547	Transposase	Mobilome: prophages, transposons [X]	72.22
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	2.22
COG0277	FAD/FMN-containing lactate dehydrogenase/glycolate oxidase	Energy production and conversion [C]	0.56
COG2972	Sensor histidine kinase YesM	Signal transduction mechanisms [T]	0.56
COG3181	Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC	Energy production and conversion [C]	0.56
COG3452	Extracellular (periplasmic) sensor domain CHASE (specificity unknown)	Signal transduction mechanisms [T]	0.56
COG3614	Extracytoplasmic sensor domain CHASE1 (specificity unknown)	Signal transduction mechanisms [T]	0.56

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	59.44 %
Unclassified	root	N/A	40.56 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	59.44 %
Unclassified	root	N/A	40.56 %

Level 3

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	59.44 %
Unclassified	root	N/A	40.56 %

Level 4

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	53.33 %
Unclassified	root	N/A	40.56 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	40.56 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	30.56 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.56 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	40.56 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	27.78 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.56 %
unclassified Betaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria	0.56 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	40.56 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	15.56 %
Hyphomicrobiales incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis	10.56 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13b	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13b	0.56 %
Acetobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae	0.56 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	40.56 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	12.78 %
Nordella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella	10.56 %
Acidisphaera	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera	0.56 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13b	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13b	0.56 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	40.56 %
unclassified Nordella	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella	10.56 %
unclassified Bradyrhizobium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium	2.22 %
Acidisphaera rubrifaciens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → Acidisphaera rubrifaciens	0.56 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13b	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13b	0.56 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	40.56 %
Nordella sp. HKS 07	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07	10.56 %
Bradyrhizobium sp. 174	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 174	1.11 %
Bradyrhizobium sp. BR 10261	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. BR 10261	0.56 %
Bradyrhizobium sp. WYCCWR 12678	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. WYCCWR 12678	0.56 %
Acidisphaera rubrifaciens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → Acidisphaera rubrifaciens	0.56 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13b	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13b	0.56 %

Associated Scaffolds

Scaffold	Taxonomy	Length
2088090014|GPIPI_16871531	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1825
3300000546|LJNas_1011815	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07	930
3300000567|JGI12270J11330_10063455	All Organisms → cellular organisms → Bacteria → Proteobacteria	1888
3300000567|JGI12270J11330_10086679	Not Available	1442
3300000567|JGI12270J11330_10188954	All Organisms → cellular organisms → Bacteria → Proteobacteria	717
3300000567|JGI12270J11330_10205410	Not Available	668
3300000597|AF_2010_repII_A1DRAFT_10074355	Not Available	857
3300000597|AF_2010_repII_A1DRAFT_10158012	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	543
3300000650|AP72_2010_repI_A1DRAFT_1007346	Not Available	841
3300000702|JGI12537J11925_100417	All Organisms → cellular organisms → Bacteria → Proteobacteria	1581
3300000710|JGI12294J11894_104961	Not Available	500
3300000723|JGI12372J11909_104850	Not Available	643
3300000912|JGI12032J12867_1001220	All Organisms → cellular organisms → Bacteria → Proteobacteria	1339
3300001075|JGI12453J13212_103091	Not Available	632
3300001394|JGI20191J14862_1015898	Not Available	1448
3300001545|JGI12630J15595_10046705	Not Available	871
3300001545|JGI12630J15595_10048808	Not Available	848
3300001641|JGI20238J16299_100345	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07	1384
3300001867|JGI12627J18819_10027854	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2329
3300001867|JGI12627J18819_10073575	All Organisms → cellular organisms → Bacteria → Proteobacteria	1420
3300002162|JGI24139J26690_1025478	Not Available	1111
3300002239|JGI24034J26672_10007126	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1621
3300002245|JGIcombinedJ26739_100307814	All Organisms → cellular organisms → Bacteria → Proteobacteria	1468
3300002347|JGIcombinedJ26865_1013451	All Organisms → cellular organisms → Bacteria → Proteobacteria	1353
3300005269|Ga0065706_1007913	Not Available	1366
3300005332|Ga0066388_100222543	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2517
3300005332|Ga0066388_104070206	All Organisms → cellular organisms → Bacteria	745
3300005564|Ga0070664_100367613	All Organisms → cellular organisms → Bacteria → Proteobacteria	1311
3300005618|Ga0068864_100346068	All Organisms → cellular organisms → Bacteria → Proteobacteria	1401
3300005719|Ga0068861_102574464	Not Available	512
3300005764|Ga0066903_102378672	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07	1024
3300005764|Ga0066903_106630924	Not Available	602
3300005764|Ga0066903_108203853	All Organisms → cellular organisms → Bacteria → Proteobacteria	534
3300005841|Ga0068863_102350142	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	543
3300005937|Ga0081455_10028456	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	5107
3300005937|Ga0081455_10212913	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1439
3300005938|Ga0066795_10247680	Not Available	527
3300005983|Ga0081540_1007087	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	8054
3300006028|Ga0070717_10235724	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1612
3300006028|Ga0070717_10983083	All Organisms → cellular organisms → Bacteria → Proteobacteria	768
3300006041|Ga0075023_100029852	All Organisms → cellular organisms → Bacteria → Proteobacteria	1593
3300006041|Ga0075023_100170610	Not Available	818
3300006042|Ga0075368_10134820	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1027
3300006047|Ga0075024_100303456	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	784
3300006047|Ga0075024_100634594	Not Available	578
3300006050|Ga0075028_100312555	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	879
3300006052|Ga0075029_100608660	All Organisms → cellular organisms → Bacteria → Proteobacteria	730
3300006057|Ga0075026_100620454	All Organisms → cellular organisms → Bacteria	637
3300006058|Ga0075432_10538543	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	526
3300006059|Ga0075017_100304645	All Organisms → cellular organisms → Bacteria → Proteobacteria	1177
3300006086|Ga0075019_10886112	Not Available	572
3300006102|Ga0075015_100404751	Not Available	771
3300006163|Ga0070715_10085543	All Organisms → cellular organisms → Bacteria → Proteobacteria	1440
3300006172|Ga0075018_10034304	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2044
3300006173|Ga0070716_100994936	Not Available	663
3300006174|Ga0075014_100730980	All Organisms → cellular organisms → Bacteria	578
3300006176|Ga0070765_100979319	Not Available	799
3300006176|Ga0070765_102087536	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	529
3300006177|Ga0075362_10492641	Not Available	626
3300006237|Ga0097621_101783575	Not Available	586
3300006795|Ga0075520_1203009	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	840
3300006806|Ga0079220_10329701	Not Available	959
3300006846|Ga0075430_100413397	All Organisms → cellular organisms → Bacteria → Proteobacteria	1114
3300006904|Ga0075424_100193615	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2158
3300006914|Ga0075436_100218390	Not Available	1352
3300006917|Ga0075472_10551169	Not Available	576
3300007258|Ga0099793_10424187	All Organisms → cellular organisms → Bacteria	656
3300009088|Ga0099830_10473009	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07	1020
3300009093|Ga0105240_12691500	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	513
3300009094|Ga0111539_11675019	Not Available	738
3300009147|Ga0114129_11209749	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07	941
3300009522|Ga0116218_1074895	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1542
3300009624|Ga0116105_1056854	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07	910
3300009660|Ga0105854_1236186	Not Available	618
3300009698|Ga0116216_10454376	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13b	776
3300009700|Ga0116217_10942026	All Organisms → cellular organisms → Bacteria	529
3300009824|Ga0116219_10201145	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07	1140
3300010047|Ga0126382_10620795	Not Available	893
3300010047|Ga0126382_10986306	Not Available	737
3300010047|Ga0126382_12435963	All Organisms → cellular organisms → Bacteria → Proteobacteria	509
3300010343|Ga0074044_10802584	All Organisms → cellular organisms → Bacteria → Proteobacteria	615
3300010358|Ga0126370_11704612	All Organisms → cellular organisms → Bacteria → Proteobacteria	607
3300010376|Ga0126381_104591872	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	532
3300010397|Ga0134124_10788737	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 174	948
3300010398|Ga0126383_11925068	Not Available	679
3300010398|Ga0126383_12512815	Not Available	599
3300010868|Ga0124844_1235948	All Organisms → cellular organisms → Bacteria	651
3300012514|Ga0157330_1048069	Not Available	596
3300012923|Ga0137359_10519100	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1050
3300012941|Ga0162652_100021493	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07	906
3300013308|Ga0157375_13497748	Not Available	523
3300013831|Ga0120126_1000300	All Organisms → cellular organisms → Bacteria → Proteobacteria	1724
3300014156|Ga0181518_10021182	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4472
3300015087|Ga0167637_1029359	Not Available	769
3300015203|Ga0167650_1028459	All Organisms → cellular organisms → Bacteria → Proteobacteria	1497
3300016341|Ga0182035_10959453	Not Available	756
3300016371|Ga0182034_11864133	Not Available	530
3300016422|Ga0182039_10484586	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07	1066
3300016422|Ga0182039_11270159	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → Acidisphaera rubrifaciens	666
3300016422|Ga0182039_11423240	Not Available	630
3300017792|Ga0163161_11503216	Not Available	591
3300017926|Ga0187807_1095164	Not Available	935
3300017943|Ga0187819_10530900	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 174	670
3300017946|Ga0187879_10071869	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2008
3300017946|Ga0187879_10660770	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	581
3300017947|Ga0187785_10045885	All Organisms → cellular organisms → Bacteria → Proteobacteria	1626
3300017959|Ga0187779_10207169	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07	1229
3300017966|Ga0187776_10152656	All Organisms → cellular organisms → Bacteria → Proteobacteria	1422
3300017974|Ga0187777_11407180	Not Available	515
3300017995|Ga0187816_10475933	All Organisms → cellular organisms → Bacteria	561
3300018025|Ga0187885_10219191	All Organisms → cellular organisms → Bacteria	876
3300018043|Ga0187887_10613499	Not Available	642
3300018057|Ga0187858_10697500	Not Available	606
3300018062|Ga0187784_10711370	Not Available	803
3300018067|Ga0184611_1181020	Not Available	749
3300019787|Ga0182031_1321858	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07	1300
3300019885|Ga0193747_1047792	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07	1064
3300020579|Ga0210407_10737137	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. WYCCWR 12678	763
3300021168|Ga0210406_10846844	Not Available	692
3300021401|Ga0210393_11318336	Not Available	578
3300021406|Ga0210386_11584105	Not Available	544
3300021415|Ga0193694_1027415	Not Available	797
3300021559|Ga0210409_10819828	All Organisms → cellular organisms → Bacteria → Proteobacteria	803
3300022756|Ga0222622_10451386	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07	912
3300023056|Ga0233357_1035723	Not Available	625
3300024227|Ga0228598_1044466	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07	878
3300025885|Ga0207653_10372385	Not Available	559
3300025911|Ga0207654_10248994	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. BR 10261	1190
3300025925|Ga0207650_10279060	All Organisms → cellular organisms → Bacteria → Proteobacteria	1360
3300025931|Ga0207644_10830047	Not Available	773
3300025935|Ga0207709_10372092	Not Available	1085
3300025938|Ga0207704_10909744	Not Available	740
3300025940|Ga0207691_10293946	All Organisms → cellular organisms → Bacteria → Proteobacteria	1397
3300025972|Ga0207668_10468488	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1078
3300026271|Ga0209880_1090189	All Organisms → cellular organisms → Bacteria	629
3300026277|Ga0209350_1042390	All Organisms → cellular organisms → Bacteria → Proteobacteria	1332
3300026800|Ga0207742_116331	All Organisms → cellular organisms → Bacteria → Proteobacteria	547
3300026819|Ga0207765_107070	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07	960
3300026887|Ga0207805_1021588	Not Available	646
3300026894|Ga0207980_1006359	Not Available	742
3300027039|Ga0207855_1004595	All Organisms → cellular organisms → Bacteria → Proteobacteria	2112
3300027625|Ga0208044_1113621	Not Available	778
3300027629|Ga0209422_1030317	All Organisms → cellular organisms → Bacteria → Proteobacteria	1332
3300027629|Ga0209422_1073478	Not Available	804
3300027641|Ga0208827_1064312	All Organisms → cellular organisms → Bacteria → Proteobacteria	1181
3300027641|Ga0208827_1077764	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07	1034
3300027648|Ga0209420_1041985	All Organisms → cellular organisms → Bacteria → Proteobacteria	1397
3300027662|Ga0208565_1186636	Not Available	594
3300027884|Ga0209275_10113662	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1400
3300027907|Ga0207428_10259444	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1295
3300028023|Ga0265357_1002648	All Organisms → cellular organisms → Bacteria → Proteobacteria	1485
3300028379|Ga0268266_10725500	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07	958
3300028807|Ga0307305_10147446	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1086
3300028811|Ga0307292_10062700	All Organisms → cellular organisms → Bacteria → Proteobacteria	1410
3300028884|Ga0307308_10100259	All Organisms → cellular organisms → Bacteria → Proteobacteria	1378
3300029636|Ga0222749_10711778	Not Available	549
3300030618|Ga0311354_11889716	Not Available	516
3300030967|Ga0075399_10008621	Not Available	860
3300031231|Ga0170824_122602706	Not Available	513
3300031366|Ga0307506_10037968	All Organisms → cellular organisms → Bacteria → Proteobacteria	1333
3300031446|Ga0170820_12503073	All Organisms → cellular organisms → Bacteria	581
3300031538|Ga0310888_10617627	Not Available	659
3300031545|Ga0318541_10093311	Not Available	1607
3300031572|Ga0318515_10137501	All Organisms → cellular organisms → Bacteria → Proteobacteria	1298
3300031573|Ga0310915_10307822	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1120
3300031740|Ga0307468_100799041	Not Available	804
3300031765|Ga0318554_10382311	Not Available	799
3300031805|Ga0318497_10410462	Not Available	758
3300031823|Ga0307478_10624845	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07	901
3300031859|Ga0318527_10500224	Not Available	518
3300031879|Ga0306919_11314316	Not Available	547
3300031946|Ga0310910_10153587	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1762
3300031947|Ga0310909_11022273	All Organisms → cellular organisms → Bacteria → Proteobacteria	674
3300031947|Ga0310909_11129676	All Organisms → cellular organisms → Bacteria	636
3300032035|Ga0310911_10135946	Not Available	1375
3300032059|Ga0318533_10152031	All Organisms → cellular organisms → Bacteria → Proteobacteria	1638
3300032770|Ga0335085_11510774	Not Available	699
3300033888|Ga0334792_052857	All Organisms → cellular organisms → Bacteria → Proteobacteria	1254
3300034820|Ga0373959_0048554	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07	910

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	81.67%
Host-Associated	Host-Associated	18.33%

Class

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	67.78%
Plants	Host-Associated → Plants	18.33%
Aquatic	Environmental → Aquatic	13.89%

Category

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	66.11%
Rhizosphere	Host-Associated → Plants → Rhizosphere	11.11%
Sediment	Environmental → Aquatic → Sediment	7.78%
Freshwater	Environmental → Aquatic → Freshwater	5.56%
Rhizoplane	Host-Associated → Plants → Rhizoplane	5.56%
Roots	Host-Associated → Plants → Roots	1.67%
Peat	Environmental → Terrestrial → Peat	1.11%
Marine	Environmental → Aquatic → Marine	0.56%
Agricultural Field	Environmental → Terrestrial → Agricultural Field	0.56%

Type

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	41.67%
Loam	Environmental → Terrestrial → Soil → Loam	18.33%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	7.78%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	6.67%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	6.11%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	5.56%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	5.00%
Soil	Host-Associated → Plants → Rhizosphere → Soil	4.44%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	1.11%
Bulk Soil	Host-Associated → Plants → Roots → Bulk Soil	1.11%
Coastal	Environmental → Aquatic → Marine → Coastal	0.56%
Unclassified	Environmental → Terrestrial → Agricultural Field → Unclassified	0.56%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.56%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.56%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	18.89%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	17.78%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	15.00%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	7.78%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	6.67%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	5.00%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	4.44%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	3.89%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	3.33%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	3.33%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	2.78%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	2.22%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	1.67%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	1.11%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	1.11%
Unclassified	Host-Associated → Plants → Roots → Bulk Soil → Unclassified	1.11%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	0.56%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	0.56%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.56%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.56%
Unclassified	Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified	0.56%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.56%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.56%

Habitat

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	10.56%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	7.78%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	6.67%
Peatlands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil	6.67%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	5.56%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	3.89%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	3.89%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	3.89%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	3.33%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland	2.78%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	2.78%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	2.78%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	2.78%
Arctic Peat Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil	2.22%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	2.22%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	1.67%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	1.67%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	1.67%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	1.67%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.67%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	1.11%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	1.11%
Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil	1.11%
Populus Endosphere	Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere	1.11%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.11%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog	0.56%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland	0.56%
Aqueous	Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous	0.56%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.56%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.56%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.56%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.56%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere	0.56%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.56%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost	0.56%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	0.56%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.56%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.56%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.56%
Bog Forest Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil	0.56%
Permafrost Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil	0.56%
Bog	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog	0.56%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.56%
Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil	0.56%
Palsa	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa	0.56%
Soil	Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil	0.56%
Quercus Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere	0.56%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.56%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.56%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.56%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.56%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.56%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.56%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.56%
Rhizosphere Soil	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil	0.56%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere	0.56%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.56%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.56%

Associated Samples

Taxon OID	Sample Name	Habitat Type
2088090014	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental
3300000546	Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled	Host-Associated
3300000567	Peat soil microbial communities from Weissenstadt, Germany - SII-2010	Environmental
3300000597	Forest soil microbial communities from Amazon forest - 2010 replicate II A1	Environmental
3300000650	Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A1	Environmental
3300000702	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 77	Environmental
3300000710	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 67	Environmental
3300000723	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 72	Environmental
3300000912	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3	Environmental
3300001075	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 63	Environmental
3300001394	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 deep-092012	Environmental
3300001545	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1	Environmental
3300001641	Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004	Environmental
3300001867	Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)	Environmental
3300002162	Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 002-21A	Environmental
3300002239	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2	Host-Associated
3300002245	Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)	Environmental
3300002347	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-072012 (NGEE Surface samples 415 (1, 2, 3 deep-072012) AP id is 1030520, ASSEMBLY_DATE=20131219)	Environmental
3300005269	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 Bulk Soil	Environmental
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated
3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated
3300005938	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191	Environmental
3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Host-Associated
3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Environmental
3300006041	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014	Environmental
3300006042	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Host-Associated
3300006047	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013	Environmental
3300006050	Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014	Environmental
3300006052	Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013	Environmental
3300006057	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012	Environmental
3300006058	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Host-Associated
3300006059	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012	Environmental
3300006086	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013	Environmental
3300006102	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013	Environmental
3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Environmental
3300006172	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014	Environmental
3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Environmental
3300006174	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014	Environmental
3300006176	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5	Environmental
3300006177	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Host-Associated
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated
3300006795	Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B	Environmental
3300006806	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100	Environmental
3300006846	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Host-Associated
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated
3300006914	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Host-Associated
3300006917	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA	Environmental
3300007258	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3	Environmental
3300009088	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG	Environmental
3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Host-Associated
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated
3300009522	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG	Environmental
3300009624	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10	Environmental
3300009660	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-058	Environmental
3300009698	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG	Environmental
3300009700	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG	Environmental
3300009824	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG	Environmental
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental
3300010343	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1	Environmental
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental
3300010868	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction)	Environmental
3300012514	Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.old.130510	Environmental
3300012923	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG	Environmental
3300012941	Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015	Environmental
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated
3300013831	Permafrost microbial communities from Nunavut, Canada - A21_5cm_6M	Environmental
3300014156	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG	Environmental
3300015087	Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6A, Proglacial plain, adjacent to northern proglacial tributary)	Environmental
3300015203	Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3c, vegetated patch on medial moraine)	Environmental
3300016341	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170	Environmental
3300016371	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172	Environmental
3300016422	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111	Environmental
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated
3300017926	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2	Environmental
3300017943	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4	Environmental
3300017946	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10	Environmental
3300017947	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG	Environmental
3300017959	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG	Environmental
3300017966	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG	Environmental
3300017974	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG	Environmental
3300017995	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1	Environmental
3300018025	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100	Environmental
3300018043	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10	Environmental
3300018057	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150	Environmental
3300018062	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG	Environmental
3300018067	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex	Environmental
3300019787	Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction)	Environmental
3300019885	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2	Environmental
3300020579	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M	Environmental
3300021168	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M	Environmental
3300021401	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O	Environmental
3300021406	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O	Environmental
3300021415	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s1	Environmental
3300021559	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M	Environmental
3300022756	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1	Environmental
3300023056	Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS2	Environmental
3300024227	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4	Host-Associated
3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)	Environmental
3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)	Host-Associated
3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)	Host-Associated
3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)	Host-Associated
3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)	Host-Associated
3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)	Environmental
3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)	Host-Associated
3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)	Host-Associated
3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)	Host-Associated
3300026271	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 (SPAdes)	Environmental
3300026277	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes)	Environmental
3300026800	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 43 (SPAdes)	Environmental
3300026819	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 59 (SPAdes)	Environmental
3300026887	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 49 (SPAdes)	Environmental
3300026894	Soil and rhizosphere microbial communities from Laval, Canada - mgLPA (SPAdes)	Environmental
3300027039	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 14 (SPAdes)	Environmental
3300027625	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes)	Environmental
3300027629	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes)	Environmental
3300027641	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes)	Environmental
3300027648	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes)	Environmental
3300027662	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes)	Environmental
3300027884	Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)	Environmental
3300027907	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)	Host-Associated
3300028023	Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5	Host-Associated
3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)	Host-Associated
3300028807	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186	Environmental
3300028811	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149	Environmental
3300028884	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195	Environmental
3300029636	Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)	Environmental
3300030618	II_Palsa_E3 coassembly	Environmental
3300030967	Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA11 Emin (Eukaryote Community Metatranscriptome)	Environmental
3300031231	Coassembly Site 11 (all samples) - Champenoux / Amance forest	Environmental
3300031366	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S	Environmental
3300031446	Fir Summer Coassembly Site 11 - Champenoux / Amance forest	Environmental
3300031538	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1	Environmental
3300031545	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26	Environmental
3300031572	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19	Environmental
3300031573	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111	Environmental
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental
3300031765	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22	Environmental
3300031805	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23	Environmental
3300031823	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05	Environmental
3300031859	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25	Environmental
3300031879	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)	Environmental
3300031946	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172	Environmental
3300031947	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H	Environmental
3300032035	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170	Environmental
3300032059	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27	Environmental
3300032770	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5	Environmental
3300033888	Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-3-X1	Environmental
3300034820	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
GPIPI_03176080	2088090014	Soil	MRAFDRDLIRGGHYGQRSCGPHLKAEHMAAPTQACYV
LJNas_10118151	3300000546	Quercus Rhizosphere	MREFDRDLIRGGHYGQRSYEPRQKAGHMAAPTNAAKREE
JGI12270J11330_100634554	3300000567	Peatlands Soil	MRVFDRDLIRGEHYGQRSCEPHSKAEHMAAPTKPAT*
JGI12270J11330_100866791	3300000567	Peatlands Soil	MRAIDRDLIRGGHYGQRSREPRSKAEHMAAPTNAAYV
JGI12270J11330_101889541	3300000567	Peatlands Soil	MRASDRDLIRGGHYGQRSREPRSKAEHMAAPTNAAYV
JGI12270J11330_102054101	3300000567	Peatlands Soil	MRAVDRDLIRGGHYGQRSCEPRLKAEHMGAPTNAAYVK
AF_2010_repII_A1DRAFT_100743551	3300000597	Forest Soil	MRGFDRDLTRGEHYGQRSYEPHLKAEHMAAPTKPAT*
AF_2010_repII_A1DRAFT_101580123	3300000597	Forest Soil	MRVIDRDLIRGGHYGQRSREPHLKAEHMAAPTSPAT*
AP72_2010_repI_A1DRAFT_10073461	3300000650	Forest Soil	MRAFDRDLIRGGHYGQRPCVPREQAEHMAAPTSLQT*
JGI12537J11925_1004171	3300000702	Tropical Forest Soil	MRSFDRDLIRGGHYGQRSCEPHLKAEHMAAPTKPAT*
JGI12294J11894_1049612	3300000710	Tropical Forest Soil	MRPFDRDLIRGEHYGQRSCEPHLKAEHMXAPTKTVT*
JGI12372J11909_1048501	3300000723	Tropical Forest Soil	MRPFDRDLIRGEHYGQRSCEPHLKAEHMGAPTKTVT*
JGI12032J12867_10012202	3300000912	Forest Soil	MRAFDRDLIRGGHYGQRPCEPHLKAEHMAAPTNAA
JGI12453J13212_1030912	3300001075	Tropical Forest Soil	MRPFDRDLIRGEHYGQRSCEPHLKAEHMAAPTKTVT
JGI20191J14862_10158981	3300001394	Arctic Peat Soil	MRVYDRDLIREGHYGQRPRVPRLKAEHMAAPTNAA
JGI12630J15595_100467052	3300001545	Forest Soil	MRGFDRDLIRGGHYGQRSYEPHLKAEHMAAPTSNAM*
JGI12630J15595_100488081	3300001545	Forest Soil	MREFDRDLIRGGHYGQRSYEPRQKAGHMAAPTNAAKREESPC
JGI20238J16299_1003453	3300001641	Forest Soil	MRGFDRDLIRGEHYGQRSCEPHSKAEHMAAPTKPAT*
JGI12627J18819_100278543	3300001867	Forest Soil	MRVVDRDLIRGGHYGQRSCEPQLKAEHMAAPTKPAT*
JGI12627J18819_100735751	3300001867	Forest Soil	MRESDRDLIRGGHYGQRSCEPHSKAEHMAAPIKPAT*
JGI24139J26690_10254782	3300002162	Arctic Peat Soil	MRAIDRDLIRGGHYGQRPCVPHLKAEHMAAPTNAAYV
JGI24034J26672_100071262	3300002239	Corn, Switchgrass And Miscanthus Rhizosphere	MRAFXRDLIRGGHYGQRSXXPRXXAEHMAAPTNAAK*
JGIcombinedJ26739_1003078141	3300002245	Forest Soil	MRAFDRDLIRGGHYGQRSREPRSKAEHMAAPTNAALVKKVLA
JGIcombinedJ26865_10134512	3300002347	Arctic Peat Soil	MREFDRDLIRGGHYGQRSREPRQQAGHMAAPTNAA
Ga0065706_10079132	3300005269	Switchgrass Rhizosphere	MRAIDRDLIREGHYGQRSCEPRKQAEHMAAPTKLHTFKKVL
Ga0066388_1002225434	3300005332	Tropical Forest Soil	HLRMRAFDRDLIRGGHYGQRSGEPRKQAEHMAAPTNAAT*
Ga0066388_1040702062	3300005332	Tropical Forest Soil	MRAIDRDLIRGGHYGQRSCEPHAKAEHMAAPTKPAFVKKL
Ga0070664_1003676131	3300005564	Corn Rhizosphere	MRQFDWDLIRGGHYGQRSCEPHLKAEHMAAPTNAA
Ga0068864_1003460683	3300005618	Switchgrass Rhizosphere	MRAIDRDLIRGGHYGQRSCEPHLKAEHMAAPTNAAYV
Ga0068861_1025744641	3300005719	Switchgrass Rhizosphere	MRVFDRDLIRGGHYGQRSCEPHLKAEHMAAPTMLQT*
Ga0066903_1023786721	3300005764	Tropical Forest Soil	MRPFDRDLIRGRHYGQRSRVPRSKAEHMAAPTNAAFVK*
Ga0066903_1066309242	3300005764	Tropical Forest Soil	MRPFDWDLIRGGHYGQRSCEPRKQAEHMAAPTKLQRED
Ga0066903_1082038532	3300005764	Tropical Forest Soil	MRVFDRDLIRGGHYGQRSCEPRKKAEHMAAPTKPCYVKILL
Ga0068863_1023501421	3300005841	Switchgrass Rhizosphere	MRAFDRDLIRGGHYGQRSREPRKQAEHMAAPTNAAK*
Ga0081455_100284563	3300005937	Tabebuia Heterophylla Rhizosphere	MRAFDRDLIRGGHYGQRSWVPHSKAEHMAAPTNAAT*
Ga0081455_102129133	3300005937	Tabebuia Heterophylla Rhizosphere	MRAFDRDLIRGGHYGQRSWVPHSKAEHMAAPTNAA
Ga0066795_102476801	3300005938	Soil	MRAIDRDLIRGGHYGQRPCVPHLKAEHMAAPTNAAYVK
Ga0081540_10070877	3300005983	Tabebuia Heterophylla Rhizosphere	MRGFDRDLIRGEHYGQRSCEPHQKAEHMAALTSLRA*
Ga0070717_102357242	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MRPFDRDLIRGGHYGQRSCEPHAKAEHMAAPTKPAT*
Ga0070717_109830832	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MRAFDRDLIRGGHYGQRPCVPREQAEHMAAPTSNAT*
Ga0075023_1000298522	3300006041	Watersheds	MRVSDRDLIRGEHYGQRSCEPHSKAEHMAAPTKPAT*
Ga0075023_1001706102	3300006041	Watersheds	MRAFDRDLIRAGHYGQRSCEPHAKAEHMAAPTNAAREE*
Ga0075368_101348202	3300006042	Populus Endosphere	MRAIDRDLIRGGHYGQRSCVPRRKAEHMAAPTNAAK*
Ga0075024_1003034562	3300006047	Watersheds	MRVFDRDLIRGEHYGQRSCEPHSKAEHMAASTNPAT*
Ga0075024_1006345941	3300006047	Watersheds	MREIDRDLIRGEHYGQRSCEPHSKAEHMAAPTNSAT*
Ga0075028_1003125552	3300006050	Watersheds	MRAFDRDLIRGGHYGQRSCEPHLKAEHMAAPTKPAT*
Ga0075029_1006086602	3300006052	Watersheds	MRAFDRDLIRGGHYGQRSRVPRKQAEHMAAPTNAAT*
Ga0075026_1006204541	3300006057	Watersheds	MRGFDRDLIRGGHYGQRSCEPHLKAEHMAAPTKPAT*
Ga0075432_105385432	3300006058	Populus Rhizosphere	MRGVDRDLIRGGHYGQRSCGPRKQAEHMAAPTNAAK*
Ga0075017_1003046452	3300006059	Watersheds	MRGFDRDLIRGGHYGQRSCEPHLKAEHMAAPTKPA
Ga0075019_108861121	3300006086	Watersheds	MRTFDWDLIRGGHYGQRPGVQHSKAEHMAAPTNAAF
Ga0075015_1004047512	3300006102	Watersheds	VPTHGRMRAIDRDLIRGGHYGQRPDVPRLKAEHMAAPTNA
Ga0070715_100855433	3300006163	Corn, Switchgrass And Miscanthus Rhizosphere	MRANDRDLIRGGHYGQRSCEPHLKAEHMAAPTNAAYVKK
Ga0075018_100343041	3300006172	Watersheds	MRGFDRDLIRGGHYGQRPCEPHLKAEHMAAPTNAA
Ga0070716_1009949362	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	MRVFDRDLIRGGHHGQRSSEPRKQAEHMAAPTKSAT*
Ga0075014_1007309801	3300006174	Watersheds	THMGHSIIVRAFDRDLIRGGHYGQRSREPHKQAEHMAAPTNAAK*
Ga0070765_1009793192	3300006176	Soil	MRVFDRDLIRGEHYGQRSCEPHSKAEHMAAPTKPAT
Ga0070765_1020875362	3300006176	Soil	VFDRDLIRGEHYGQRSCEPHSKAEHMAAPTKPAT*
Ga0075362_104926412	3300006177	Populus Endosphere	MRAIDRDLIREGHYGQRSCEPRKQAEHMAAPTNAAN
Ga0097621_1017835752	3300006237	Miscanthus Rhizosphere	MRQFDWDLIRGGHYGQRSCEPHLKAEHMAAPTNAANV
Ga0075520_12030092	3300006795	Arctic Peat Soil	MRAFDRDLIRGGHYGQRLRMPRLKAEHMAAPTNAA*
Ga0079220_103297012	3300006806	Agricultural Soil	MRAIDRDLIREGHYGQRSCEPHLKAEHMAAPTPPAT*
Ga0075430_1004133973	3300006846	Populus Rhizosphere	MRAFDRDPIRGGHYGQRSCEPHKQAEHMAAPTKPA
Ga0075424_1001936152	3300006904	Populus Rhizosphere	MRAFDRDLIRGGHYGQRSRVPRTKAEHMAAPTNAAK*
Ga0075436_1002183902	3300006914	Populus Rhizosphere	MRGFDRDLIRGEHYGQRPSVPRSKAEHMAAPTNAAGVKKALA
Ga0075472_105511692	3300006917	Aqueous	RVVDRDLIGGWHYGQRSCEPHQKAEHIMAAPIRR*
Ga0099793_104241871	3300007258	Vadose Zone Soil	MRGFDRDLIRGGHYGQRSREPHLQAEHMAAPTNAANVKK
Ga0099830_104730092	3300009088	Vadose Zone Soil	MREFDRDRLRGGHYGQRPCEPHLQAEHMAAPTKPAT
Ga0105240_126915001	3300009093	Corn Rhizosphere	VPQHGRVRVFDRDLIRGGHYGQRSWVPHEKAEHMA
Ga0111539_116750191	3300009094	Populus Rhizosphere	RGIDRDLIRGGHYGQRSYEPHTKAEHMPAPTKAATL*
Ga0114129_112097491	3300009147	Populus Rhizosphere	MRAIDRDLIRGGHYGQRPRVPHEQAEHMAAPTKAANVKK
Ga0116218_10748951	3300009522	Peatlands Soil	MRAIDRDLIRGGYYGQRSREPRSKAEHMAAPTNAAYVKK
Ga0116105_10568542	3300009624	Peatland	MRPFDRDLIRRKRYGQRSHVPRLKAERMPAPTNAAVVKKPLP
Ga0105854_12361862	3300009660	Permafrost Soil	MRLFDRDLIRGGHYGQRSREPHQKAEHMAAPTNAAKKVKKA
Ga0116216_104543762	3300009698	Peatlands Soil	MRVVYRDLIRGKHYGQRSREPHSKADTMAAPTNAGRVKKVLA
Ga0116217_109420261	3300009700	Peatlands Soil	MRASDRDLIRGGHYGQRSREPRSKAEHMAAPTNAAY
Ga0116219_102011452	3300009824	Peatlands Soil	MRLIDRDLIRGGHYGQRSREPRSKAEHMAAPTNAA
Ga0126382_106207952	3300010047	Tropical Forest Soil	MRAFDRDLIRGGHYGQWSREPHQQAEHMAAPTTAAHVEKVLA
Ga0126382_109863062	3300010047	Tropical Forest Soil	VPLHSRMRASDRDLIREGHYGQRSCEPRKQAEHMAA
Ga0126382_124359632	3300010047	Tropical Forest Soil	RAFDRDLIRGGHYGQRSWVPRKQAEHMAAPTIAAK*
Ga0074044_108025841	3300010343	Bog Forest Soil	AHNRMRAFDRDLIRGGHYGQRPCVPHKQAEQMAAPTSDAT*
Ga0126370_117046121	3300010358	Tropical Forest Soil	MCAIDRDLIRGGHYGQRSREPHEQAEHMAAPTSAAS*
Ga0126381_1045918721	3300010376	Tropical Forest Soil	MRGFDRDLIRGEHYGQRSCEPHQKAEHMAAPTSLR
Ga0134124_107887374	3300010397	Terrestrial Soil	MRACDRDLIRGGHSGQRPGVPHSKAEHMAAPTNAVG
Ga0126383_119250682	3300010398	Tropical Forest Soil	MRGFDRDLIRGRHYGQRPCVPREQAEHMAAPTSLQT*
Ga0126383_125128151	3300010398	Tropical Forest Soil	RMRGFDRDLIRGTHYGQRPCVPREQAENMAAPTSLQT*
Ga0124844_12359483	3300010868	Tropical Forest Soil	MRAFDQDLIRGGHYGQQSYEPHQQAKHMAAPTQSCDVKNVL
Ga0157330_10480691	3300012514	Soil	MRGFDRDLIRGGHYGQRPGAPRSKAEHMAAPTNAAGV
Ga0137359_105191002	3300012923	Vadose Zone Soil	YDRDLIRGGHYGQRSCEPHLQAEHMAAPTNAAKREESY*
Ga0162652_1000214931	3300012941	Soil	MREFDRDLIRGGHYGQRSYEPRQKAGHMAAPTNAANVK
Ga0157375_134977482	3300013308	Miscanthus Rhizosphere	VPTHYCRMRAIERDLIRGRHYGQRSSEPHLKAEHMAAPTN
Ga0120126_10003001	3300013831	Permafrost	MRAIDRDLIRGGHYGQRSCEPHLKAEHMAAPTKPANVKKALAN
Ga0181518_100211821	3300014156	Bog	GFDRDLIRGEHYGQRSCEPHSKAEHMAAPTKPAT*
Ga0167637_10293591	3300015087	Glacier Forefield Soil	MRAFDRDLIRGGHYGQRPCVPRLKAEHMAAPTKAAANVK
Ga0167650_10284591	3300015203	Glacier Forefield Soil	MRVFGRDLIRGGHYGQRSCEPHLKAEHMAAPTNAAKREK
Ga0182035_109594532	3300016341	Soil	MRGFDRDLIRGGHYGQRSREPREQAEHMAAPTTAARVKK
Ga0182034_118641331	3300016371	Soil	MRVIDRDLIRGGHYGQRSYEPHKQAEHMAAPTNSANVKI
Ga0182039_104845861	3300016422	Soil	MRVFDRDLIRGGHYGQRSCEPHLKAEHMAAPTKPAYVKKA
Ga0182039_112701591	3300016422	Soil	LCQCISNASFDRDLIREGHYSQRSCEPHKQAEHMAAPTSDAT
Ga0182039_114232401	3300016422	Soil	MRVIDRDLIRGGHYGQRSCEPRKQAEHMGAPTKPA
Ga0163161_115032161	3300017792	Switchgrass Rhizosphere	MRQFDWDLIRGGHYGQRSCEPHLKAEHMAAPTNAANVKK
Ga0187807_10951642	3300017926	Freshwater Sediment	MRAFDRDLIPGGHYGQRSGIPRSKAEHMAAPTNAALVKKV
Ga0187819_105309002	3300017943	Freshwater Sediment	MRAFDRDLIRGGHYGQRSGVPRSKAEHMAAPTNAALVKKV
Ga0187879_100718692	3300017946	Peatland	MRPFDRDLIRGGHYGQRSREPRSKAEHMAAPTNPAPV
Ga0187879_106607701	3300017946	Peatland	MRAFDRDLIRGGHYGQRSREPRSKAEHMAAPTNPAPVKKTLAN
Ga0187785_100458852	3300017947	Tropical Peatland	MGHSIIEMRVFDRDLIRGGHYGQRSRVPRKQAEHMAAPTNAAA
Ga0187779_102071691	3300017959	Tropical Peatland	MGHSIIEMRVFDRDLIRGGHYGQRSRVPRKQAEHMAAPTNAAT
Ga0187776_101526563	3300017966	Tropical Peatland	VPEHCRMRAFDRDLIRGGHYGQRPCVPRQKAEHMAAPTKPVTCRFSLP
Ga0187777_114071802	3300017974	Tropical Peatland	MREIDRDLIRGGHYGQRSREPHQQAEHMAAPTTAAHVKKAL
Ga0187816_104759332	3300017995	Freshwater Sediment	MRPFDRDLIRGGHYGQRSREPHSKAEHMAAPTNAALV
Ga0187885_102191911	3300018025	Peatland	MRAFDRDLIRGGHYGQRLCEPRLKAEHTGAPTNSVSVKK
Ga0187887_106134991	3300018043	Peatland	MRPIDRDLIRGGHYGQRSCEPHSKAEHMAAPTNAA
Ga0187858_106975001	3300018057	Peatland	MRPIDRDLIRGGHYGQRSCEPHAKAEHMAAPTNAAFVKKV
Ga0187784_107113701	3300018062	Tropical Peatland	LHSRMRGFDRDLIREGHYGQRSCEPHAKAEHMAAPTKPAT
Ga0184611_11810201	3300018067	Groundwater Sediment	MRDIDRDLIRGGHYGQRSCEPHLKAEHMAAPTNAANVKK
Ga0182031_13218581	3300019787	Bog	VPAHCRMRPNDRDLIRGGHYGQWPRVPHLKAEHMAAPTKAAA
Ga0193747_10477921	3300019885	Soil	MRAFDRDLIRGGHYGQRPCEPHLKAEHMAAPTNAAHVKKV
Ga0210407_107371372	3300020579	Soil	RMRVVDRDLIRGGHYGQRSCEPHLKAEHMAALTKPAT
Ga0210406_108468441	3300021168	Soil	MRLVDRDLIRGGHYGQRSCEPRSEAEHMAAPTNAALLQKVLA
Ga0210393_113183362	3300021401	Soil	MRANDRDLIRGGHYGQRSCKPHSKAEHMAAPTNTANVKIALP
Ga0210386_115841051	3300021406	Soil	MRVFDRDLIRGEHYGQRSCEPHPKAEHMAAPTNPAT
Ga0193694_10274152	3300021415	Soil	MRAVDRDLIRGGHYGQRSCEPHLQAEHMAALTKPA
Ga0210409_108198282	3300021559	Soil	MREFDRDLIRGGHYGQRSYQPRQKAGHMAAPTNAAKREESP
Ga0222622_104513861	3300022756	Groundwater Sediment	MRVIDRDLIRGGHYGQRPRVPHTQAEHMGAPTNAANV
Ga0233357_10357231	3300023056	Soil	MRVVGRDLIRGGHYGQRSCEPHQKAEHMAAPTNAANVKKALA
Ga0228598_10444661	3300024227	Rhizosphere	MRAFDRDLIRGGHYGQRLCEPHTKAEHMAAPTNAALVKK
Ga0207653_103723851	3300025885	Corn, Switchgrass And Miscanthus Rhizosphere	VPLHGRVRGIDRDLIRGGHYGRRSYEPHTKAEHMPAP
Ga0207654_102489942	3300025911	Corn Rhizosphere	MASRMRAFDRDLIRGGHYGQRTRVPREKAEHMAAPTQPCSVKI
Ga0207650_102790601	3300025925	Switchgrass Rhizosphere	MRAIDRDLIRAGHYGQRPGVPHSKAEHMAAPTKAAKREESS
Ga0207644_108300471	3300025931	Switchgrass Rhizosphere	MRAIDRDLIRAGHYGQRPGVPHSKAEHMAAPTKAAKREES
Ga0207709_103720921	3300025935	Miscanthus Rhizosphere	VPSHYYRMRVFGRDLIREGHYGQRSCEPQLKAEHMA
Ga0207670_109346592	3300025936	Switchgrass Rhizosphere	MRVFGRDLIREGHYGQRSCEPQLKAEHMAAPTNPAKREESS
Ga0207704_109097441	3300025938	Miscanthus Rhizosphere	MRANDRDLIRGGHYGQRSCEPHLKAEHMAAPTNAAYVKKVLAN
Ga0207691_102939461	3300025940	Miscanthus Rhizosphere	MRAYDRDLIRGEHYGQRSCEPRTKAEHMAAPTKPA
Ga0207668_104684881	3300025972	Switchgrass Rhizosphere	MREFDRDLIRGGHYGQRSYETASKAGHMAAPTNAAKRE
Ga0209880_10901892	3300026271	Soil	MRAIDRDLIRGGHYGQRPCVPHLKAEHMAAPTNAAY
Ga0209350_10423901	3300026277	Grasslands Soil	MRANDRDLIRGGHYGQRSCEPHSKAEHMAAPTNAALVK
Ga0207742_1163311	3300026800	Tropical Forest Soil	MRAFDRDLIREGHYGQRPGVPHSKAEHMAAPTNAAT
Ga0207765_1070701	3300026819	Tropical Forest Soil	VPLHSRMRGFDRDLIRGGHYGQRSCEPHLKAEHMA
Ga0207805_10215881	3300026887	Tropical Forest Soil	RAFDRDLIREGHYGQRPGVPHSKAEHMAAPTNAAT
Ga0207980_10063591	3300026894	Soil	MRANDRDLIRGGHYGQRSCEPHLKAEHMAAPTNAAYVK
Ga0207855_10045951	3300027039	Tropical Forest Soil	VPAHHRMRSFDRDLIRGGHYGQRSCEPHLKAEHMA
Ga0208044_11136211	3300027625	Peatlands Soil	MRAFDRDLIRGGHYGQRSREPHSKAEHMAAPTDAALVKKV
Ga0209422_10303171	3300027629	Forest Soil	MRAFDRDLIRGGHYGQRSREPRSKAEHMAAPTNTALVK
Ga0209422_10734781	3300027629	Forest Soil	MREFDRDLIRGGHYGQRSHEPRQKAGHMAAPTNPAKRE
Ga0208827_10643122	3300027641	Peatlands Soil	MRAFDRDLIRGGHYGLRSCEPHSKAEHMAAPTNAALV
Ga0208827_10777641	3300027641	Peatlands Soil	MRPFDRDLIRGGHYGQRSREPRSKAEHMAAPTNPALVKK
Ga0209420_10419851	3300027648	Forest Soil	MRVFDRDLIRGKHYGQRSCEPLSKAEHMAASTQACDVKI
Ga0208565_11866362	3300027662	Peatlands Soil	MRPIDRDLIRGGHYGQRSCEPHAKAEHMAAPTNAAFVKKT
Ga0209275_101136621	3300027884	Soil	MRAIDRDLIRGGHYGQRSREPRSKAEHMAAPTNAANVKKAL
Ga0207428_102594441	3300027907	Populus Rhizosphere	MRAIDRDLIREGHYGQRSCEPRKQAEHMAAPTNAA
Ga0265357_10026481	3300028023	Rhizosphere	MRANDRDLIRGGHYGQRSCKPHSKAEHMAAPTNTANVKIA
Ga0268266_107255002	3300028379	Switchgrass Rhizosphere	MRAFDRDLIRGGHYGQRSREPRKQAEHMAAPTNAAK
Ga0307305_101474462	3300028807	Soil	MRVVGRDLIRGGHYGQRSSEPHQKAEHMAATTNAAKP
Ga0307292_100627001	3300028811	Soil	MRVIDRDLIRGGHYGQRPRVPHTQAEHMGAPTNAA
Ga0307308_101002591	3300028884	Soil	MRAIDRDLIRGGHYGQRPRVPHTQAEHMGAPTNAANVKKV
Ga0222749_107117781	3300029636	Soil	MRVVDRDLIRGGHYGQRSYEPRLKAGHMAAPTNAAKREES
Ga0311354_118897162	3300030618	Palsa	MRPIDRDLIRGGHYGQRSCEPHLKAEHMAAPTNAATLQK
Ga0075399_100086211	3300030967	Soil	MRAFDRDLIRGGHYGQRSYEPHQQAEHMAAPTNAAFVKKVL
Ga0170824_1226027062	3300031231	Forest Soil	MRVSDRDLIRGEHYGQRSCEPHSKAEHMAAPTKPAT
Ga0307506_100379681	3300031366	Soil	MRAFDRDLIRGGHYGQRPCEPHLKAEHMAAPTNAANVKK
Ga0170820_125030731	3300031446	Forest Soil	MRAFDRDLIRGGHYGRSCEPRKQAEHMAAPTHAAKREESP
Ga0310888_106176272	3300031538	Soil	MRAFDWDLIRGGHYGQRSCEPHLKAEHMAAPTNAA
Ga0318541_100933111	3300031545	Soil	MRGFDRDLIRGEHYGQRSCEPHQKAEHMAAPTSLRREE
Ga0318515_101375011	3300031572	Soil	MRPFDRDLIREGHYGQRTCDPRKQAEHMAAPTSSAREENPC
Ga0310915_103078221	3300031573	Soil	MRAFDQDLIRGGHYGQRSWVPREQAEHMAAPTNAAK
Ga0307468_1007990411	3300031740	Hardwood Forest Soil	MRAIDRDLIRAGHYGQRPGVPHSKAEHMAAPTKAANVKKVL
Ga0318554_103823112	3300031765	Soil	MRGFDRDLIRGEHYGQRSCEPHQKAEHMAAPTSLRREES
Ga0318497_104104621	3300031805	Soil	MRVFDRDLIRGGHYGQRSCEPHLKAEHMAAPTKPAYVKKAL
Ga0307478_106248451	3300031823	Hardwood Forest Soil	VPSHSRMREIDRDLIRAGHYGQRSCKPHLKAEHMAA
Ga0318527_105002242	3300031859	Soil	MRVFDRDLIRGGHYGQRSCEPHLKAEHMAAPTKPAY
Ga0306919_113143161	3300031879	Soil	MRAFDRDLVRKGHYGQRSCEPRKKAEHMAATDYLHR
Ga0310910_101535871	3300031946	Soil	HHRMRAFDRDLIRGGHYGQRSWVPREQAEQMAAPTNAAK
Ga0310909_110222731	3300031947	Soil	NAGNDRDLIRGGHYGQRSCEPQQQAEHMAAPTSNAT
Ga0310909_111296762	3300031947	Soil	MRAFDRDLIRGGHYGQRSGEPRKQAEHMAAPTNAAT
Ga0310911_101359462	3300032035	Soil	MRGFDRDLIRGEHYGQRSCEPHQKAEHMAAPTSLRRE
Ga0318533_101520312	3300032059	Soil	MRDIDRDLISGGHYGQRSCEPREQAEYMAAPTNAA
Ga0335085_115107741	3300032770	Soil	MRGIDRDLIRGGHYGQRSSVPRLKAEHMAAPTNAAGVKKVL
Ga0334792_052857_1138_1254	3300033888	Soil	MRACDRDLIRGGHYGQRPCVPHLKAEHMAAPTNAANVKK
Ga0373959_0048554_3_116	3300034820	Rhizosphere Soil	MPLHGRVRGIDRDLIRGGHYGQRSYEPHTKAELMAAPT