| Basic Information | |
|---|---|
| Family ID | F031999 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 181 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MKNTKFVVKVNRGGTRATEYVQRIDLTPIQMTPNRKLALVMGRFTA |
| Number of Associated Samples | 161 |
| Number of Associated Scaffolds | 181 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 96.24 % |
| % of genes near scaffold ends (potentially truncated) | 67.40 % |
| % of genes from short scaffolds (< 2000 bps) | 64.64 % |
| Associated GOLD sequencing projects | 150 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (68.508 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (12.707 % of family members) |
| Environment Ontology (ENVO) | Unclassified (18.785 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (38.674 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 12.16% β-sheet: 0.00% Coil/Unstructured: 87.84% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 181 Family Scaffolds |
|---|---|---|
| PF00011 | HSP20 | 14.92 |
| PF11154 | DUF2934 | 2.76 |
| PF01165 | Ribosomal_S21 | 2.21 |
| PF08719 | NADAR | 1.10 |
| PF13545 | HTH_Crp_2 | 1.10 |
| PF00313 | CSD | 1.10 |
| PF00076 | RRM_1 | 1.10 |
| PF12840 | HTH_20 | 0.55 |
| PF13411 | MerR_1 | 0.55 |
| PF00753 | Lactamase_B | 0.55 |
| PF01649 | Ribosomal_S20p | 0.55 |
| PF00881 | Nitroreductase | 0.55 |
| PF07730 | HisKA_3 | 0.55 |
| PF01797 | Y1_Tnp | 0.55 |
| PF12867 | DinB_2 | 0.55 |
| PF00326 | Peptidase_S9 | 0.55 |
| PF00814 | TsaD | 0.55 |
| PF13424 | TPR_12 | 0.55 |
| PF01022 | HTH_5 | 0.55 |
| PF01926 | MMR_HSR1 | 0.55 |
| PF01471 | PG_binding_1 | 0.55 |
| PF07748 | Glyco_hydro_38C | 0.55 |
| PF13620 | CarboxypepD_reg | 0.55 |
| PF01588 | tRNA_bind | 0.55 |
| PF04542 | Sigma70_r2 | 0.55 |
| PF00873 | ACR_tran | 0.55 |
| PF16697 | Yop-YscD_cpl | 0.55 |
| PF00106 | adh_short | 0.55 |
| COG ID | Name | Functional Category | % Frequency in 181 Family Scaffolds |
|---|---|---|---|
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 14.92 |
| COG0828 | Ribosomal protein S21 | Translation, ribosomal structure and biogenesis [J] | 2.21 |
| COG3236 | N-glycosidase YbiA/RibX (riboflavin biosynthesis, damage control), NADAR superfamily | Defense mechanisms [V] | 1.10 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.55 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.55 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.55 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.55 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.55 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.55 |
| COG2517 | Predicted RNA-binding protein, contains C-terminal EMAP domain | General function prediction only [R] | 0.55 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.55 |
| COG1214 | tRNA A37 threonylcarbamoyladenosine modification protein TsaB | Translation, ribosomal structure and biogenesis [J] | 0.55 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.55 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.55 |
| COG0533 | tRNA A37 threonylcarbamoyltransferase TsaD | Translation, ribosomal structure and biogenesis [J] | 0.55 |
| COG0383 | Alpha-mannosidase | Carbohydrate transport and metabolism [G] | 0.55 |
| COG0268 | Ribosomal protein S20 | Translation, ribosomal structure and biogenesis [J] | 0.55 |
| COG0073 | tRNA-binding EMAP/Myf domain | Translation, ribosomal structure and biogenesis [J] | 0.55 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 69.06 % |
| Unclassified | root | N/A | 30.94 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001593|JGI12635J15846_10551662 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 674 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101088587 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 686 | Open in IMG/M |
| 3300002914|JGI25617J43924_10058834 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1402 | Open in IMG/M |
| 3300004082|Ga0062384_100857847 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
| 3300004635|Ga0062388_102908962 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300005406|Ga0070703_10410104 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
| 3300005434|Ga0070709_10145775 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1631 | Open in IMG/M |
| 3300005445|Ga0070708_100008193 | All Organisms → cellular organisms → Bacteria | 8385 | Open in IMG/M |
| 3300005445|Ga0070708_100864420 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 849 | Open in IMG/M |
| 3300005451|Ga0066681_10471024 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 772 | Open in IMG/M |
| 3300005467|Ga0070706_101119449 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 725 | Open in IMG/M |
| 3300005468|Ga0070707_100002424 | All Organisms → cellular organisms → Bacteria | 17773 | Open in IMG/M |
| 3300005471|Ga0070698_100010625 | All Organisms → cellular organisms → Bacteria | 9809 | Open in IMG/M |
| 3300005534|Ga0070735_10908004 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300005540|Ga0066697_10644488 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
| 3300005542|Ga0070732_10919011 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300005546|Ga0070696_100807344 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 773 | Open in IMG/M |
| 3300005552|Ga0066701_10354512 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 909 | Open in IMG/M |
| 3300005578|Ga0068854_100448634 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1077 | Open in IMG/M |
| 3300005895|Ga0075277_1036306 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300006041|Ga0075023_100050084 | Not Available | 1306 | Open in IMG/M |
| 3300006050|Ga0075028_100751392 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300006102|Ga0075015_100791520 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
| 3300006162|Ga0075030_101429420 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300006173|Ga0070716_100413342 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 973 | Open in IMG/M |
| 3300006176|Ga0070765_101336047 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
| 3300006804|Ga0079221_10487718 | Not Available | 795 | Open in IMG/M |
| 3300009029|Ga0066793_10596844 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300009088|Ga0099830_10512566 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 979 | Open in IMG/M |
| 3300009089|Ga0099828_10977746 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 754 | Open in IMG/M |
| 3300009137|Ga0066709_102601783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 678 | Open in IMG/M |
| 3300009148|Ga0105243_11954957 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300009522|Ga0116218_1118334 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1205 | Open in IMG/M |
| 3300009523|Ga0116221_1313781 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 679 | Open in IMG/M |
| 3300009632|Ga0116102_1006473 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4434 | Open in IMG/M |
| 3300009672|Ga0116215_1370315 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 621 | Open in IMG/M |
| 3300009698|Ga0116216_10451633 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 778 | Open in IMG/M |
| 3300009698|Ga0116216_10857381 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300009700|Ga0116217_11000023 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300009762|Ga0116130_1233833 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
| 3300009762|Ga0116130_1240369 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
| 3300010366|Ga0126379_10987862 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 946 | Open in IMG/M |
| 3300010379|Ga0136449_101441447 | Not Available | 1059 | Open in IMG/M |
| 3300010880|Ga0126350_11588788 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
| 3300011271|Ga0137393_10662214 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 895 | Open in IMG/M |
| 3300012201|Ga0137365_10900621 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 645 | Open in IMG/M |
| 3300012208|Ga0137376_11067200 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 691 | Open in IMG/M |
| 3300012209|Ga0137379_11536913 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
| 3300012210|Ga0137378_10062651 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3363 | Open in IMG/M |
| 3300012354|Ga0137366_10003751 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 11842 | Open in IMG/M |
| 3300012356|Ga0137371_10479249 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 961 | Open in IMG/M |
| 3300012357|Ga0137384_10528125 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 967 | Open in IMG/M |
| 3300012359|Ga0137385_10706673 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 842 | Open in IMG/M |
| 3300012361|Ga0137360_10029301 | All Organisms → cellular organisms → Bacteria | 3789 | Open in IMG/M |
| 3300012363|Ga0137390_10867672 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 858 | Open in IMG/M |
| 3300012930|Ga0137407_11157676 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 734 | Open in IMG/M |
| 3300012931|Ga0153915_12013304 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
| 3300014655|Ga0181516_10485440 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 634 | Open in IMG/M |
| 3300015371|Ga0132258_10232251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 4495 | Open in IMG/M |
| 3300017928|Ga0187806_1239856 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 625 | Open in IMG/M |
| 3300017934|Ga0187803_10002418 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7338 | Open in IMG/M |
| 3300017934|Ga0187803_10149931 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 917 | Open in IMG/M |
| 3300017941|Ga0187850_10042211 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2408 | Open in IMG/M |
| 3300017995|Ga0187816_10007035 | All Organisms → cellular organisms → Bacteria | 4014 | Open in IMG/M |
| 3300017995|Ga0187816_10540017 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300018001|Ga0187815_10128619 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1070 | Open in IMG/M |
| 3300018007|Ga0187805_10092740 | All Organisms → cellular organisms → Bacteria | 1364 | Open in IMG/M |
| 3300018014|Ga0187860_1029593 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3001 | Open in IMG/M |
| 3300018034|Ga0187863_10177520 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1187 | Open in IMG/M |
| 3300018038|Ga0187855_10626279 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 627 | Open in IMG/M |
| 3300018044|Ga0187890_10037570 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 2922 | Open in IMG/M |
| 3300018047|Ga0187859_10377588 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 775 | Open in IMG/M |
| 3300018431|Ga0066655_11290178 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300018468|Ga0066662_12986642 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300019878|Ga0193715_1024298 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1315 | Open in IMG/M |
| 3300019885|Ga0193747_1114399 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
| 3300020070|Ga0206356_10463800 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 735 | Open in IMG/M |
| 3300020580|Ga0210403_11017309 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 648 | Open in IMG/M |
| 3300020583|Ga0210401_10368512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1298 | Open in IMG/M |
| 3300020583|Ga0210401_10489840 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1092 | Open in IMG/M |
| 3300021088|Ga0210404_10319489 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 857 | Open in IMG/M |
| 3300021181|Ga0210388_10731274 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 861 | Open in IMG/M |
| 3300021402|Ga0210385_11556708 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300021403|Ga0210397_10341847 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1107 | Open in IMG/M |
| 3300021406|Ga0210386_10203489 | All Organisms → cellular organisms → Bacteria | 1677 | Open in IMG/M |
| 3300021420|Ga0210394_10260741 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1517 | Open in IMG/M |
| 3300021432|Ga0210384_10431352 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1187 | Open in IMG/M |
| 3300021433|Ga0210391_11303591 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
| 3300021478|Ga0210402_11199615 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300022523|Ga0242663_1123717 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
| 3300022533|Ga0242662_10284489 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
| 3300022712|Ga0242653_1110936 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300022724|Ga0242665_10070122 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 980 | Open in IMG/M |
| 3300023544|Ga0247542_102121 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 718 | Open in IMG/M |
| 3300025412|Ga0208194_1059675 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
| 3300025612|Ga0208691_1068337 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 802 | Open in IMG/M |
| 3300025905|Ga0207685_10781202 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300025906|Ga0207699_10943492 | Not Available | 637 | Open in IMG/M |
| 3300025915|Ga0207693_11390139 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300025922|Ga0207646_10202682 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1792 | Open in IMG/M |
| 3300025922|Ga0207646_10674192 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 925 | Open in IMG/M |
| 3300026551|Ga0209648_10507013 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 696 | Open in IMG/M |
| 3300026557|Ga0179587_10668939 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 684 | Open in IMG/M |
| 3300027546|Ga0208984_1049627 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 894 | Open in IMG/M |
| 3300027565|Ga0209219_1171860 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300027729|Ga0209248_10163521 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300027857|Ga0209166_10280414 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 879 | Open in IMG/M |
| 3300027875|Ga0209283_10372551 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 934 | Open in IMG/M |
| 3300027895|Ga0209624_10014184 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5089 | Open in IMG/M |
| 3300027908|Ga0209006_10100699 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2561 | Open in IMG/M |
| 3300028047|Ga0209526_10439391 | Not Available | 860 | Open in IMG/M |
| 3300028828|Ga0307312_10913529 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300030659|Ga0316363_10189882 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 861 | Open in IMG/M |
| 3300031057|Ga0170834_100171861 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1042 | Open in IMG/M |
| 3300031057|Ga0170834_105575626 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300031057|Ga0170834_109491173 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1371 | Open in IMG/M |
| 3300031099|Ga0308181_1064675 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 725 | Open in IMG/M |
| 3300031125|Ga0308182_1020697 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
| 3300031231|Ga0170824_116134703 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 640 | Open in IMG/M |
| 3300031474|Ga0170818_101572253 | Not Available | 943 | Open in IMG/M |
| 3300031474|Ga0170818_111499340 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 981 | Open in IMG/M |
| 3300031718|Ga0307474_10152978 | All Organisms → cellular organisms → Bacteria | 1742 | Open in IMG/M |
| 3300031754|Ga0307475_10477558 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1001 | Open in IMG/M |
| 3300031820|Ga0307473_10372623 | Not Available | 926 | Open in IMG/M |
| 3300031823|Ga0307478_10005922 | All Organisms → cellular organisms → Bacteria | 8531 | Open in IMG/M |
| 3300031891|Ga0316039_106302 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 753 | Open in IMG/M |
| 3300032174|Ga0307470_10181191 | All Organisms → Viruses → Predicted Viral | 1325 | Open in IMG/M |
| 3300032180|Ga0307471_102659757 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 634 | Open in IMG/M |
| 3300032739|Ga0315741_10919951 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 773 | Open in IMG/M |
| 3300032805|Ga0335078_10507781 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1547 | Open in IMG/M |
| 3300033806|Ga0314865_110600 | Not Available | 724 | Open in IMG/M |
| 3300034644|Ga0370548_065583 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 677 | Open in IMG/M |
| 3300034681|Ga0370546_017286 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 924 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.71% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.05% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 10.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.84% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.97% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.97% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.97% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.97% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 4.42% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.31% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.31% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.31% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.76% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.21% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.66% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.10% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.10% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.10% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.55% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.55% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.55% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.55% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.55% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.55% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.55% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.55% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.55% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.55% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.55% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.55% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.55% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.55% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.55% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.55% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.55% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.55% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.55% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.55% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005895 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_101 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018014 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019184 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSA2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019878 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2 | Environmental | Open in IMG/M |
| 3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300020010 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s2 | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022523 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022712 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022881 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 20-24 | Environmental | Open in IMG/M |
| 3300023544 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSU4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024041 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E3 1-5 | Environmental | Open in IMG/M |
| 3300025412 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025612 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027546 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300029981 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N2_2 | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031099 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031125 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_153 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031891 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLA3 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032739 | Forest Soil Metatranscriptomics Site 2 LB Combined Assembly | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300033806 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_20 | Environmental | Open in IMG/M |
| 3300034644 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_123 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034681 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_121 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12630J15595_100978581 | 3300001545 | Forest Soil | MKTTKFIVTVTRGGPHATEYVERIDLTPIQTTPDRKL |
| JGI12635J15846_105516623 | 3300001593 | Forest Soil | MKNIKFVVKVNRGGTSAPKYVQRVDPTHPDMITNRKVTL |
| JGIcombinedJ26739_1010885873 | 3300002245 | Forest Soil | MKNTKFVVKLNRGGNLVPEFVQRIDLTPIQTTTNR |
| C688J35102_1191040562 | 3300002568 | Soil | MKNTKFVVKVSRGGILKPEYVRRIDKTPMLMTSDRKLALLMGRLTAEDAVKSI |
| JGI25617J43924_100588341 | 3300002914 | Grasslands Soil | MKNIKFVVKVLRSGVRPPEYVQRIDKTPIQMTTNLKLALVMGKFTAEDAVKSIQN |
| Ga0062384_1008578472 | 3300004082 | Bog Forest Soil | MKTTKFVVKVNRGGTLAAQYVQRIDRTPIQTTTNRRLALVMGRFTAEDTAKSI |
| Ga0062387_1014875172 | 3300004091 | Bog Forest Soil | MKTTKFVVKLNRGGALAAQYIQRIDRTPIQTTTNRKLALI |
| Ga0062388_1029089621 | 3300004635 | Bog Forest Soil | MNNIKFVVKVTRGTRAPSYVQRVDPAPIQLTTNRQLALLMGRFTAEDAVKSL |
| Ga0070703_104101041 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MKNIKFVVKVNRRGTRAPEYVQRVDSTPVQMTTNRKLALLMGRFTAEDAVKSLEG |
| Ga0070709_101457751 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MKNIKFVVKVNRGSLIPAFVLRTDRTPIQMTTNRKLALIMGKLT |
| Ga0070713_1013609642 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MKNTKFVVKVNRGGTHTPEYVLRVDPTPIQMTTNRKLALVMGKFMAE |
| Ga0070705_1012889452 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MKNTKFVVKVNRGGTHAPEYVQRIDQTPILTTTSRKLALVMGRF |
| Ga0070708_10000819310 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MKNIKFVVNVNRGGSRAPKYVQRVDPTPIQMTTNPKLSLLMGRFTAVYPGVGIRKG* |
| Ga0070708_1008644202 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MKNIRFVVIVNHGDIRAPEYVQRIHRIPIQMTTNRKLALVMGRF |
| Ga0066681_104710243 | 3300005451 | Soil | MKNTKFVVKVNRRGAHAPVYVRRIDPTPIQTTTNRKLALAMGRFTAEDAV |
| Ga0070706_1011194491 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MKNIRFVVIVNHGDIRAPEYVQRIHRIPIQMTTNRKLALVMGRFTAEDAV |
| Ga0070707_1000024249 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MKNIKFVVKVNRGGSRAPKYVQRVDPTPIQMTTNPKLSLLMGRFTAVYPGVGVRKG* |
| Ga0070698_1000106251 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MKNIKFVVNVNRGGSRAPKYVQRVDPTPIQMTTNPKLSLLMGRFTAVYPGVG |
| Ga0070698_1013306611 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MKNTKFVVQVNRGGTHIPKYVQRIDRTPIQTTMNRKLALV |
| Ga0070735_109080041 | 3300005534 | Surface Soil | MKKIKFVVKVNRGGRAEYVRRVEPTPIHMTNNPKLALLMGRLTAEDAVESLQN |
| Ga0066697_106444881 | 3300005540 | Soil | MKNTKFIVKVNRGGTHVLQYVRRIDRTPIQTTINRKLALVMGRFTAEDAV |
| Ga0070732_109190112 | 3300005542 | Surface Soil | MTNTKFIVKVNRTGTCIVAYVQRVDATPIQTTTNRKLALVMGRWTAEDAVKSMQ |
| Ga0070696_1008073442 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | VKVNRSGTRPPEYVQRIDRTPIQTTTSRKLALVMAEGAVRSIQIPDAVRK* |
| Ga0066701_103545122 | 3300005552 | Soil | MKKIKFVVKLSRGDVRSPEYVQRIDRVPIQMTTNRKLALLMGRF |
| Ga0068854_1004486341 | 3300005578 | Corn Rhizosphere | MKNTKFLVKLSRSGMHAPAFVQRLDRTPIQTTTNRKLALLMGRLTAEDAI |
| Ga0075277_10363062 | 3300005895 | Rice Paddy Soil | MTNTKFIVKITRGGARMATYVQRIDATPIQTTTNRKLALVMGRWTAED |
| Ga0075023_1000500841 | 3300006041 | Watersheds | MKNTKFVVKVNRGGTHTPEYVQRIDPTLIQMTTNRKLALVM |
| Ga0075028_1007513921 | 3300006050 | Watersheds | MKNIKFVVKVNRSGGTHVPEYVQRIDLTPIQTTRDRKLALVMGRFTAEDAVK |
| Ga0075015_1001451343 | 3300006102 | Watersheds | MRTMNTKFVVKVNRGSTRATEYVQRVDPTPIQLTPTRKLALVMGRFTAEDAVKS |
| Ga0075015_1007915202 | 3300006102 | Watersheds | MKTTKFVVKVNRGGTRAPQYVRRIDRTPIQMILSRKLALIMGRFTAEDAVKSIQ |
| Ga0075030_1014294202 | 3300006162 | Watersheds | MKNIKFVVKVNRGGSRAAQYVLRVEPTPICMTSDRKLALLMGKFTAE |
| Ga0070716_1004133423 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTIKFVVKVNRGTRAPEYVQRVDPTPLHMTTNRKLALVMGRLTAEDAVKSLQN |
| Ga0070765_1013360471 | 3300006176 | Soil | MKNTKFIVKVNRGGTDTTEYVRRIDRTPIRTTPNRKLALVMGRFTVEDAVKST |
| Ga0079221_104877183 | 3300006804 | Agricultural Soil | MTNTKFVVKVNRGGSPQYVKRLDRTPIVMTSDRKLALLMGKLTAEDAVLAIQN |
| Ga0073928_110312812 | 3300006893 | Iron-Sulfur Acid Spring | MKNTKFVVKVNRGGTHAPEFVQRIDLTPIQTTTNRKLALVM |
| Ga0066793_105968441 | 3300009029 | Prmafrost Soil | MNVTKFVVKVNRGATRAPEYVQRVDSTPIHMTTSRKLALLMGKFTAEDA |
| Ga0099830_105125661 | 3300009088 | Vadose Zone Soil | MKNIKFVVKVNRGGTRAPEYVQRIDRAPIQTTTNR |
| Ga0099828_109777461 | 3300009089 | Vadose Zone Soil | MKNIKFVVKVLRSGLRPPEYVQRIDKTPIQMTTNLKLALVMGKFTAEDAVKSIQN |
| Ga0066709_1026017832 | 3300009137 | Grasslands Soil | MKNTKFIVKVNRGGTHVLEYVRRIDRTPIQTTINRKLALVMGRFTAEDAVKSLQ |
| Ga0105243_119549572 | 3300009148 | Miscanthus Rhizosphere | MNNTKFVVKVNRGGIHVAEYVQRIDPTPIQMTPNRKLALVMGRFTAED |
| Ga0116222_12738751 | 3300009521 | Peatlands Soil | MKNTKFVVKVNRTGTLPPQYVQRIDRKPVQMTPDRKLALVMGRF |
| Ga0116218_11183343 | 3300009522 | Peatlands Soil | MKNFRFVVKVKRGATRAPSYVQRIDPAPIQMTTNRKLALLMGRFTAE |
| Ga0116221_13137811 | 3300009523 | Peatlands Soil | MKNFRFVVKVKRGATRAPSYVQRIDPAPIQMTTNRKLALLMGR |
| Ga0116133_10243081 | 3300009623 | Peatland | MKTIKFVVKVNRGGTRVPEYVQRTDRAPIQTTTQRKLA |
| Ga0116102_10064731 | 3300009632 | Peatland | MKNTKFIVKVDRGGTHAAEYVQRIDRTPVKMTFNRKLALVMGR |
| Ga0116215_13703151 | 3300009672 | Peatlands Soil | MTNTKFIVKVDRGGTYVPKYVERIDRTPIRMTLNRKLALVMGKFTAED |
| Ga0116216_104516333 | 3300009698 | Peatlands Soil | MKNIKFMVKVNRGGTRAPAYVQRVDPTPIHMTTDRKLALVMGRFTAEDAIKSLQ |
| Ga0116216_108573812 | 3300009698 | Peatlands Soil | MKNFRFVVKVKRGATRAPSYVQRIDPAPIQMTTNRKLALLMGRFTAEDAV |
| Ga0116217_110000232 | 3300009700 | Peatlands Soil | MKNIRFVVKVNRGGTRVPEYVQRIDPTPIQMTTDRKLALLMGKFTAEDA |
| Ga0116130_12338331 | 3300009762 | Peatland | MKNTKFIVKVDRGGTHAAEYVQRIDRTPVQMTFNRKLALLIGRFTADDAV |
| Ga0116130_12403691 | 3300009762 | Peatland | MKNIKFVVKVNRGGTRSPEYVQRVDPTPMHMTTNRKLALVMGRFTAEDAVKSLQS |
| Ga0134084_103980421 | 3300010322 | Grasslands Soil | MKNTKFVVKVNRGGTRGAEYVQRADRRPVQTTLQPNLAL |
| Ga0126379_109878623 | 3300010366 | Tropical Forest Soil | MTNIKFVVKVNRGGCQQYVRRLDRTPIVMTTDRKLALLMGKLTAEDAVNAIQNSRC |
| Ga0136449_1014414473 | 3300010379 | Peatlands Soil | MTNTKFIVKVDRGDTHAAKYVRQIDRPLINMTLDRKLALLMG |
| Ga0134121_114756872 | 3300010401 | Terrestrial Soil | MKQTKFVVKVNRGGTRPAEYVQRIDRTPIQTTTSRKLALVMAEGAVRSIQIPDAVRK* |
| Ga0126350_115887882 | 3300010880 | Boreal Forest Soil | VKNTKFIVKVNRGGARVPEYVQRIDRAPMRMTTNPKLALLMGRFTAEDAV |
| Ga0137393_106622141 | 3300011271 | Vadose Zone Soil | MKNIKFVVKVLRSGVRPPEYVQRIDKIPIQMTTNLKLALVMGKFTAEDAVKSIQN |
| Ga0137365_107261411 | 3300012201 | Vadose Zone Soil | VKNIKFVVKVNHGDIRAAEYVQRIDRIPVQMTTNRKLALLMGRF |
| Ga0137365_109006212 | 3300012201 | Vadose Zone Soil | MKNIKFVVKVNRGGTRAPEYVQRVDSTPVQMTTNRKLALLMGGLTARR* |
| Ga0137380_116444191 | 3300012206 | Vadose Zone Soil | MKNTKFVVKVNRGGTRSPEYVLRIDRTPIRTTTNRKLALVMGRFTAE |
| Ga0137376_110672001 | 3300012208 | Vadose Zone Soil | MTNTKFVVKVNRGSIGAPEYVERVDPAPIHMTTNRKKALVMGKFMPEDAVNS |
| Ga0137379_115369131 | 3300012209 | Vadose Zone Soil | MKKAKFVVKVNRGGTRAPEYVQRIDSTPIQMTTNRKLASLM |
| Ga0137378_100626511 | 3300012210 | Vadose Zone Soil | MKNIKFVVKVNRGGTRAPKYVQRVDSTPVQMTTNRKRAL |
| Ga0137366_100037517 | 3300012354 | Vadose Zone Soil | MKNIKFVVKVNRGGTRAPECVQRVDSTPVQMTTNRKLALLMGGLTARR* |
| Ga0137371_104792491 | 3300012356 | Vadose Zone Soil | RKDKSSNKHMKNIKFVVKVNRGGTRAPECVQRVDSTPVQMTTNRKLALLMGGLTARR* |
| Ga0137384_105281251 | 3300012357 | Vadose Zone Soil | VKNIKFVVKVNHGDIRAAEYVQRIDRVPVQMTTNRKLALLMGRFTAEETARSIQN |
| Ga0137385_107066733 | 3300012359 | Vadose Zone Soil | MQNIKFVVKVNRGGTRVPEYVRRIDRTPIETTINRKL |
| Ga0137360_100293011 | 3300012361 | Vadose Zone Soil | MKNTKFIVRVNRGGTDTIEYVQRIDRTPIRTTPNPKLAL |
| Ga0137361_116446382 | 3300012362 | Vadose Zone Soil | MKNTKFVVKVNRGSTRATEYVQRIDLTPIQMTPNR |
| Ga0137390_108676721 | 3300012363 | Vadose Zone Soil | MKNTKFVVRVNRGGHASEYVQRIDRIPIQMTPNRKLALVMGRFTAEDAVKSIQ |
| Ga0137407_111576762 | 3300012930 | Vadose Zone Soil | MKNTKFIVRVNRGGTDTTEYVQRIDRTPIRTTSNPKLALVMGRFTAEDAVKSI |
| Ga0153915_120133042 | 3300012931 | Freshwater Wetlands | MNNTKFIVKVNRGGTRASEYVKRIDRSPIQTTRDRKLALVMGRFTAEDA |
| Ga0181516_104854401 | 3300014655 | Bog | METAISPKNTKFIVKVNRSGARASEYVQRIDRTPIQTTTNRKLALVMGRFTAEDTIK |
| Ga0157376_102385193 | 3300014969 | Miscanthus Rhizosphere | MTISKFVVKVNRSGSRVPEYVQQIDRTPIRTTKNRKLAL |
| Ga0137409_113057691 | 3300015245 | Vadose Zone Soil | MKNTKFVVKVNRGSTRATEYVQRIDLTPIQMTPNRKLALVMGRFTAEDAV |
| Ga0182006_13196642 | 3300015261 | Rhizosphere | MKVMKTTKFVVKVTRGGSPVPEYVQYIDRTPIVTTKNPKLALVMGKFTAE |
| Ga0132258_102322514 | 3300015371 | Arabidopsis Rhizosphere | MKNIKFVVKVHRRGARGLQYVQRVDPTPIQTTTNRKLALLMGRLTA |
| Ga0187818_105804481 | 3300017823 | Freshwater Sediment | MKNTKFVVKLSRGGTRAREFVQRIDRTPIQTTTNRKLA |
| Ga0187806_12398561 | 3300017928 | Freshwater Sediment | METGIATRNTKFIVKVNRNGARASEYVQRIDRTPIQTTTNRRLALVMGRFTA |
| Ga0187803_1000241810 | 3300017934 | Freshwater Sediment | MKNIKFVVKVNRGGTRAPEYVHRIDRTPIRMTTHRMLALVMGRFTA |
| Ga0187803_101499314 | 3300017934 | Freshwater Sediment | MKSIKFVVKVNRVGAHAAQYVKRIDRTPVEMTIHRKLALMMGRLT |
| Ga0187850_100422111 | 3300017941 | Peatland | MKNTKFIVKVDRGGTHAAEYVQRIDRTPVKMTFNRKLALVMGRFTAED |
| Ga0187816_100070351 | 3300017995 | Freshwater Sediment | METGIATRNTKFIVKVNRNGARASEYVQRIDRTPIQTTTNRRLALVMGRFTAEDAIKSIQ |
| Ga0187816_105400171 | 3300017995 | Freshwater Sediment | MTNTKFIVKVDRGGTHAPKYVQRVDPTPIHMTTNRKLALAMGKLTAEDAV |
| Ga0187815_101286192 | 3300018001 | Freshwater Sediment | MTNTKFIVKVDRGGTRAPEYVERIDRTPIRTTTDRKLALVMGKFAAED |
| Ga0187804_105457561 | 3300018006 | Freshwater Sediment | MKNTKFVVKVNRGGTRAPKYVQRIDRAPIQTTTNRKLA |
| Ga0187805_100927402 | 3300018007 | Freshwater Sediment | METGIATRNTKFIVKVNRSGARASEYVQRIDRTPIQTTTNRRLALVMGRFTAED |
| Ga0187860_10295931 | 3300018014 | Peatland | MKNTKFIVKVDRGGTHTAEYVQRIDRTPVKMTFNRKLALVMGR |
| Ga0187863_101775202 | 3300018034 | Peatland | MQNIKFVVRVNQGGTRAPKYVQRVDPTPIQMTTNRKMA |
| Ga0187855_106262792 | 3300018038 | Peatland | MQNIKFVVRVNQGGTRAPKYVQRVDPIPIQMTTNRKMALVM |
| Ga0187890_100375703 | 3300018044 | Peatland | MKNVRFVVKVNRGTRVTSYVQRVDPAPIQMTTNRKLALLMGTFTAAAAVMSQQ |
| Ga0187859_103775882 | 3300018047 | Peatland | MKNTKFIVKVDRGGTHAAEYVQRIDRTPVQMTFNRKLALLIGRF |
| Ga0066655_112901781 | 3300018431 | Grasslands Soil | MKNIKFVVKVNRGGCTPAYVQRVDPTPIQMTTNRKLALLMGRFTAEDAIKSL |
| Ga0066662_129866421 | 3300018468 | Grasslands Soil | MKNTKFVVKVNRGGAHPPVYVCRIDRTPIQTTTNRKLALAMGR |
| Ga0184590_1280871 | 3300019184 | Soil | MKNIKFVVKVNRGGTRVPEYVRRTDRAPMQTTTKRNL |
| Ga0193715_10242982 | 3300019878 | Soil | MKNTKFIVKVDRGGTRAPEYVQRIDLTPIQTTPNRKLALIMGRFTAEDAVKSLQN |
| Ga0193747_11143991 | 3300019885 | Soil | MKTTKFVVKVNRGGTDITEYVKRIDRTPIRTTSNPKLALVMGRFTAEDAVKSIQN |
| Ga0193755_11182381 | 3300020004 | Soil | MKNTKFVVKVNRGGTLKPEYVQRIDRTPIKMTFDRKLALLMGRLTAEDA |
| Ga0193735_10921401 | 3300020006 | Soil | MKNTKFIVKVDRGGAHVPVYVQRIDLTPIQTTPNRKLALVMGRF |
| Ga0193749_10376902 | 3300020010 | Soil | MKNIKFVVKVSRGDIRSAEYVRRIDRVPIQMTTNRKLA |
| Ga0206356_104638003 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MINTKFVVKVNRGGCQQYVRRLDRTPIVMTRDRKLALLMGKLTAED |
| Ga0210403_110173093 | 3300020580 | Soil | MKNTKFIVKVDRGGTHALDYVERIDMTPIQMIPNRKLALVMGRFTA |
| Ga0210401_103685121 | 3300020583 | Soil | MKNTKFIVKVNRGGTDTTEYVRRIDRTPIRTTPNRKLALVMGRFTVED |
| Ga0210401_104898401 | 3300020583 | Soil | MKNVRFVVKVNRGGSRAPTYVQRVDPAPIQMTTNRKLALLMGKFTAE |
| Ga0210401_112143701 | 3300020583 | Soil | MKNTKFVVKLNRGGTLAPEFVQRIDRTPIQTTTNRKLALVMGRFT |
| Ga0210404_103194891 | 3300021088 | Soil | MSVTKFVVKVNRRGTRAPEHLQRADSTLIQMTTNRKLALRMCRFT |
| Ga0210400_114859092 | 3300021170 | Soil | MRNTKFVVKVNRGSRVPEYVERIDRAPIQMTTNRKQAL |
| Ga0210408_105250254 | 3300021178 | Soil | VTNMKNTKFVVKVNRGGTDITEYVERVDRTPIRTTPNRKLALLMGRFTAEDAVKS |
| Ga0210388_107312741 | 3300021181 | Soil | MKNFKFLVRVNRGTRAPAYIQRVDSTPIQMTTNRKLALLMGKFTA |
| Ga0193719_101121183 | 3300021344 | Soil | MKTTKFVVKVNRGGTRAPEYVKRIDRTPIQMTTNRKLALVMGKFTAQDA |
| Ga0210385_115567082 | 3300021402 | Soil | MKKTKFIVKVNRGSIRAAEYVQRMDRASIRMTTDRKLALLMGRFTAE |
| Ga0210397_103418473 | 3300021403 | Soil | MKNIKFVVKVNRGGTRAPSYVQRVDPAPIHMTTDRKLALVMGRFTAEDAIKS |
| Ga0210397_105201602 | 3300021403 | Soil | MRNTKFVVKVNRGSRVPEYVERIDRAPIQMTTNRKQALLMGK |
| Ga0210386_101472205 | 3300021406 | Soil | MKNTKFVVKVNRGGIRKPEWVQRIDRVPIQMTPDRKLALVMGRFTAENAVKSIQN |
| Ga0210386_102034894 | 3300021406 | Soil | MKTIKFVVKVNRGGTRVPEYVQRTDRAPIQTTTQRKLALIMGRFTAED |
| Ga0210394_102607414 | 3300021420 | Soil | MENIKFVVKVNRGARAPEYVQRVDPTPIHMTTNRKLALVMGKFTAEDAIKSKRSGRNWRR |
| Ga0210384_104313521 | 3300021432 | Soil | MKNTKFVVKLNRGGTLAPEFVQRIDRTPIQTTTNRKLAL |
| Ga0210391_113035911 | 3300021433 | Soil | MKNIKFVVKVNRGGTRAPAYVQRVDPAPIHMTTDRKLALVMGRFTAE |
| Ga0210390_114657872 | 3300021474 | Soil | MKNTKFVVKLNRGGTLAPEFVQRIDRTPIQTTTNRK |
| Ga0210402_111996151 | 3300021478 | Soil | VKNTKFVVKVNRGGSRAPAYVLRIDKAPIQMTSNRKLALLMGRLTAEDTIASIQTS |
| Ga0242663_11237171 | 3300022523 | Soil | MKNIKFVVKVNRGGTRAPSYVQRVDPAPIHMTTDRKLALVMGRFTAEDAI |
| Ga0242662_102844891 | 3300022533 | Soil | MKTIKFVVKVNRGSRAPSYVLRVAPSPIQMTTDRKLALM |
| Ga0242653_11109361 | 3300022712 | Soil | VKNTKFVVKLNRGGIRAPEFVQRIDRIPIQMTTNRKLALVMGKFMAEDTIKSLQN |
| Ga0242665_100701222 | 3300022724 | Soil | METIKFVVKVSRGGTRAPEYVQRIDPTPIQMTTNRKLALIMGK |
| Ga0224545_10245251 | 3300022881 | Soil | MKNTKFVVKLNRGGKLVPEFVQRIDRTPIQMTTNRKLAI |
| Ga0247542_1021212 | 3300023544 | Soil | MKKTKFIVKVNRGGTRATEYVQRMDRAPIRMTTDR |
| Ga0224539_10016761 | 3300024041 | Soil | MTNTKFVVKVNLTGARSVEYVQRVDRTPILTTTNRK |
| Ga0208194_10596751 | 3300025412 | Peatland | MQNIKFVVRVNQGGTRAPKYVQRVDPTPIQMTTNRKMAVAMGRFTAEDA |
| Ga0208691_10683372 | 3300025612 | Peatland | MKNIRFVVKVVRTGTRAAEYVQRIDRTPIQMTPDRKRALTMGRFTAEDAVKS |
| Ga0207685_103229843 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MKNIKFVVRVNRRGARAAEFVQRIDRTPIQTTTNR |
| Ga0207685_107812022 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MKNIKFVVKVHRRGARGLQYVQRVDPTPIQTTTNRKLALLMGRLTAEDAVQSLQNLH |
| Ga0207699_109434921 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MNNTKFVVKVNRGGILATQYVRRLDHSPIVMTTDRKLALLMGKLTAEDAISAIQNS |
| Ga0207654_104423151 | 3300025911 | Corn Rhizosphere | MTNTKFVVKVNRGGSPQYVKRLDRTPIVMTSDRKLALLMGKL |
| Ga0207693_113901392 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MTISKFVVKVNRSGSRVPEYVQQIDRTPIRTTKNRKLALVMGRFTAEDVVDSLQHS |
| Ga0207646_102026824 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MKNIKFVVNVNRGGSRAPKYVQRVDPTPIQMTTNPKLSLLMGRFTAVYPGVGVRKG |
| Ga0207646_106741921 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MKNTKFVVKVNRGGTHAPEYVQRIDRTPILTTTSRKLALGY |
| Ga0207700_110839221 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MTNTKFVVKVNRGGTHTPEYVLRVDPTPIQMTTNRKLALVMGK |
| Ga0209648_105070132 | 3300026551 | Grasslands Soil | MQNIKFIVKVNRGGNRSPEYVQRVDPTPIHMTTNRKLALVMGKFTAEDAIKSL |
| Ga0179587_106689391 | 3300026557 | Vadose Zone Soil | MKNTKFIVKVNRGGTDITEYVQRIDRTPIRTTPNPK |
| Ga0208984_10496273 | 3300027546 | Forest Soil | MNNIKFVVKVNRRGTRAPEYVRRVDSIPVQMTTNRKLALLMGRFTAEDAVKSLE |
| Ga0209219_11718601 | 3300027565 | Forest Soil | MKTIKFVVKVKRGGTRAPEYVQRVDPARIHMTTNRKLALVMGRLTAEDAVESLQ |
| Ga0209248_101635212 | 3300027729 | Bog Forest Soil | MKTIKFVVKVNRGGTRVPEYVQRTDRAPIQTTTQRKLALIMGRFTAEDA |
| Ga0209166_102804142 | 3300027857 | Surface Soil | VIVKNIKFVVKVNRGGSRATQYVQRVNSTPIQMTTNRKLALAMGRFTAEDAVKLL |
| Ga0209283_103725511 | 3300027875 | Vadose Zone Soil | MKNIKFVVKVLRSGLRPPEYVQRIDKTPIQMTTNLKLALVMGKFTAEDAV |
| Ga0209169_105384101 | 3300027879 | Soil | MKTTKFVVKLNRGGTLAAQYVQRIDRIPIQTTTNRKLALVM |
| Ga0209624_100141841 | 3300027895 | Forest Soil | MKNIKFVVKVNRGGTRAPQYVQRVNPTPFHMAIDRKLALIMGRFTAEDAI |
| Ga0209006_101006991 | 3300027908 | Forest Soil | VKTTKFVVKLNRGGTLAPEFVQRTDPTPIRMTTNRKLALVMGRF |
| Ga0209006_103616572 | 3300027908 | Forest Soil | MKNTKFVVKLNRGGNLVPEFVQRIDLTPIQTTTHRKLALVMGGFT |
| Ga0209698_108794741 | 3300027911 | Watersheds | MKNIKFVVKVNRSGGTHVPEYVQRIDLTPIQTTRDRKLALVMGRF |
| Ga0209526_104393911 | 3300028047 | Forest Soil | MKTTKFIVTVTRGGPHATEYVERIDLTPIQTTPNRKLAL |
| Ga0307312_109135292 | 3300028828 | Soil | MSNTEFIVKVDRGSTRAPEYVQRIDVTPVQTTPQP |
| Ga0302293_101714811 | 3300029981 | Fen | MTNTKFVVKVNRTGARSVEYVQRVDRTPILTTTNRKLALVMGRFT |
| Ga0316363_101898821 | 3300030659 | Peatlands Soil | MKNFRFVVKVKRGATRAPSYVQRIDPAPIQMTTNRKLALL |
| Ga0073994_121743541 | 3300030991 | Soil | VKNTKFVVQLNRGGNLVPEFVQRIDRIPIQTTTNRKLAL |
| Ga0170834_1001718612 | 3300031057 | Forest Soil | MKNIKFAVKVQGGTRAPKYVQGVDPTPIQTTTNPKLALLMGRFTAV |
| Ga0170834_1055756262 | 3300031057 | Forest Soil | MKNTKFIVRVNRGGTRAPEYVQRIDRAPMRMTTNRKLALLM |
| Ga0170834_1094911731 | 3300031057 | Forest Soil | VKNTKFIVRVNRGGTRAPEYVQRIDRAPMRMTTNRK |
| Ga0308181_10646751 | 3300031099 | Soil | MKNIKFVVKVNRGTGAAEYVKRIDRTLVQTTTNRKLALTMGRFTAEDAAKSLQNS |
| Ga0308182_10206971 | 3300031125 | Soil | MNNTKFVVKVNRGGTHVAEYVQRIDPTPIQMTPNRRLALVMGRFTAEDAIKS |
| Ga0170823_171096651 | 3300031128 | Forest Soil | MKNTKFVVKVNRGSTRATEYVQRIDLTPIQMTPNRKLALAMGRFTA |
| Ga0170824_1161347031 | 3300031231 | Forest Soil | MEIIKFLVRVNRGGVRPAEYVQQLDRTPIRMTTDRKLALLMGRLTAEEA |
| Ga0170818_1015722533 | 3300031474 | Forest Soil | MKNIKFVVKVNRGTRATQYVHRMDRTPIQMTPNRKLALIMGRFTA |
| Ga0170818_1114993401 | 3300031474 | Forest Soil | MKNIKFVVKVNRGGTRAPKCVQRVDPTPIQMTTNPKLALLMGRFPAV |
| Ga0307474_101529781 | 3300031718 | Hardwood Forest Soil | MKNIKFVVKVNRGGARGPAYVQSIDRTPLQMTTNRKLALLMGRFTAEDAIKSLEN |
| Ga0307474_112050603 | 3300031718 | Hardwood Forest Soil | MRNTKFVVKVNRGGTLKPEYVRRIDRIPIQMTSDRKLALLMGRL |
| Ga0307475_104775581 | 3300031754 | Hardwood Forest Soil | MKNTKFVVKVNRGDTHAPEYVQRVDPTPIHMTTNRKRALVMGKFMAEDALKSLE |
| Ga0307473_103726231 | 3300031820 | Hardwood Forest Soil | MKSIKFVVRVNRRGARAAEFVRRIDRTPIQTTTNRKLALAM |
| Ga0307478_100059221 | 3300031823 | Hardwood Forest Soil | MKNVRFVVKVNRGGTRVPTYVQRVDPAPIQMTTNRKLALLM |
| Ga0316039_1063021 | 3300031891 | Soil | MKKTKFIVKVNRGGTRATEYVQRMDRAPIRMTTDRKLALLMGRFTAEDAVRSIHN |
| Ga0307479_106899434 | 3300031962 | Hardwood Forest Soil | MKNTKFVVKVNRGGTHTPEYVLRVDPTPIQMTTNRKLALVMGKFM |
| Ga0307470_101811914 | 3300032174 | Hardwood Forest Soil | MKNIKFAVKVQGDTRAPKYVQGVDPTPIQTTTNPKLALLMGRFTAV |
| Ga0307471_1026597572 | 3300032180 | Hardwood Forest Soil | MKTTKFVVKVNRGSTRATEYVQRIDLTPIQMTPNRRLALVMGRFTAEDA |
| Ga0307472_1026289392 | 3300032205 | Hardwood Forest Soil | MKNTKFVVKVNRGGTRATEYVQRIDLTPIQMTPNRKLALVMGRFTA |
| Ga0315741_109199512 | 3300032739 | Forest Soil | MKTTKFIVKVNRGGTRRPEYVQRIDRAPFLTTTNRKLALLMGRFTA |
| Ga0335078_105077811 | 3300032805 | Soil | MKNIKFIVKVNRGGTRAPQYVQRVDRTPIHMTTDRKLALLMGKFTAEDAAK |
| Ga0335081_115050111 | 3300032892 | Soil | MKNTKFVVKVNRGGTHAPEYVQWIDRTPIQTTTKRKLALVM |
| Ga0310811_108290432 | 3300033475 | Soil | MKNTKFVVKVNRGGTHAAEYVKRIDRTPIQTTTNRKLA |
| Ga0314865_110600_1_153 | 3300033806 | Peatland | MMNTKFVVKVNRVGRRTVEYVQRIDATPLRTTTNLKLALVMGKFTAEDVIK |
| Ga0370548_040680_692_796 | 3300034644 | Soil | MKTTKVVVKVNRGGTRAPEYVKRIDRTPIQMTTNR |
| Ga0370548_065583_561_677 | 3300034644 | Soil | MKNIKFVVKVNRGTGAAEYVKRIDRTPVQTTTNRKLALT |
| Ga0370546_017286_806_922 | 3300034681 | Soil | MKNTKFIVRVNRGGTDTTEYVQRIDRTPIRTTPNPKLAL |
| ⦗Top⦘ |