| Basic Information | |
|---|---|
| Family ID | F031688 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 182 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MKTYIVYVDGDEVGYIKAGSHNAAEKKAQAKYPGKQVSVAYTEV |
| Number of Associated Samples | 132 |
| Number of Associated Scaffolds | 181 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 72.47 % |
| % of genes near scaffold ends (potentially truncated) | 14.29 % |
| % of genes from short scaffolds (< 2000 bps) | 65.93 % |
| Associated GOLD sequencing projects | 126 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.69 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (68.681 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment (23.626 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.923 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (35.714 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 15.28% β-sheet: 29.17% Coil/Unstructured: 55.56% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.69 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 181 Family Scaffolds |
|---|---|---|
| PF13671 | AAA_33 | 2.76 |
| PF06067 | DUF932 | 2.76 |
| PF13203 | DUF2201_N | 1.10 |
| PF02768 | DNA_pol3_beta_3 | 1.10 |
| PF11171 | DUF2958 | 1.10 |
| PF10263 | SprT-like | 1.10 |
| PF02767 | DNA_pol3_beta_2 | 0.55 |
| PF04002 | RadC | 0.55 |
| PF03692 | CxxCxxCC | 0.55 |
| PF00656 | Peptidase_C14 | 0.55 |
| PF03796 | DnaB_C | 0.55 |
| PF03412 | Peptidase_C39 | 0.55 |
| PF08410 | DUF1737 | 0.55 |
| PF00004 | AAA | 0.55 |
| PF01503 | PRA-PH | 0.55 |
| PF01510 | Amidase_2 | 0.55 |
| PF07669 | Eco57I | 0.55 |
| PF13240 | zinc_ribbon_2 | 0.55 |
| PF07508 | Recombinase | 0.55 |
| PF03747 | ADP_ribosyl_GH | 0.55 |
| PF13365 | Trypsin_2 | 0.55 |
| PF03819 | MazG | 0.55 |
| PF00271 | Helicase_C | 0.55 |
| PF07275 | ArdA | 0.55 |
| PF07460 | NUMOD3 | 0.55 |
| PF01966 | HD | 0.55 |
| PF13589 | HATPase_c_3 | 0.55 |
| PF00156 | Pribosyltran | 0.55 |
| PF13476 | AAA_23 | 0.55 |
| PF03167 | UDG | 0.55 |
| PF02945 | Endonuclease_7 | 0.55 |
| PF01743 | PolyA_pol | 0.55 |
| PF08281 | Sigma70_r4_2 | 0.55 |
| PF01078 | Mg_chelatase | 0.55 |
| PF08401 | ArdcN | 0.55 |
| PF00072 | Response_reg | 0.55 |
| COG ID | Name | Functional Category | % Frequency in 181 Family Scaffolds |
|---|---|---|---|
| COG0592 | DNA polymerase III sliding clamp (beta) subunit, PCNA homolog | Replication, recombination and repair [L] | 1.66 |
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 0.55 |
| COG0617 | tRNA nucleotidyltransferase/poly(A) polymerase | Translation, ribosomal structure and biogenesis [J] | 0.55 |
| COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.55 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 0.55 |
| COG1397 | ADP-ribosylglycohydrolase | Posttranslational modification, protein turnover, chaperones [O] | 0.55 |
| COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.55 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.55 |
| COG2003 | DNA repair protein RadC, contains a helix-hairpin-helix DNA-binding motif | Replication, recombination and repair [L] | 0.55 |
| COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 0.55 |
| COG4227 | Antirestriction protein ArdC | Replication, recombination and repair [L] | 0.55 |
| COG4249 | Uncharacterized conserved protein, contains caspase domain | General function prediction only [R] | 0.55 |
| COG4734 | Antirestriction protein ArdA | Defense mechanisms [V] | 0.55 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 68.68 % |
| All Organisms | root | All Organisms | 31.32 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352024|deeps_contig01453.1033 | All Organisms → cellular organisms → Bacteria | 17340 | Open in IMG/M |
| 3300000553|TBL_comb47_HYPODRAFT_10032727 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Flaumdravirus | 3613 | Open in IMG/M |
| 3300003393|JGI25909J50240_1088041 | Not Available | 620 | Open in IMG/M |
| 3300003404|JGI25920J50251_10101134 | Not Available | 663 | Open in IMG/M |
| 3300003465|P52013CM_1019434 | All Organisms → Viruses → Predicted Viral | 2338 | Open in IMG/M |
| 3300004091|Ga0062387_100287625 | Not Available | 1051 | Open in IMG/M |
| 3300004092|Ga0062389_101062712 | Not Available | 995 | Open in IMG/M |
| 3300004152|Ga0062386_100520904 | Not Available | 967 | Open in IMG/M |
| 3300004153|Ga0063455_100071390 | Not Available | 1299 | Open in IMG/M |
| 3300004775|Ga0007798_10043704 | Not Available | 994 | Open in IMG/M |
| 3300005222|Ga0073351_123596 | Not Available | 767 | Open in IMG/M |
| 3300005295|Ga0065707_10946645 | Not Available | 553 | Open in IMG/M |
| 3300005444|Ga0070694_100034865 | All Organisms → cellular organisms → Bacteria | 3322 | Open in IMG/M |
| 3300005468|Ga0070707_100860169 | Not Available | 871 | Open in IMG/M |
| 3300005607|Ga0070740_10022112 | All Organisms → Viruses → Predicted Viral | 3864 | Open in IMG/M |
| 3300005664|Ga0073685_1153699 | Not Available | 587 | Open in IMG/M |
| 3300005836|Ga0074470_11169158 | All Organisms → cellular organisms → Bacteria → Synergistetes → unclassified Synergistota → Synergistetes bacterium ADurb.BinA166 | 10262 | Open in IMG/M |
| 3300005918|Ga0075116_10042429 | All Organisms → cellular organisms → Bacteria | 1898 | Open in IMG/M |
| 3300006102|Ga0075015_100822455 | Not Available | 559 | Open in IMG/M |
| 3300006111|Ga0007848_1000628 | Not Available | 10848 | Open in IMG/M |
| 3300006163|Ga0070715_10022072 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Puniceicoccales → Puniceicoccaceae → Ruficoccus | 2478 | Open in IMG/M |
| 3300006163|Ga0070715_10242091 | Not Available | 938 | Open in IMG/M |
| 3300006237|Ga0097621_100565235 | Not Available | 1036 | Open in IMG/M |
| 3300006237|Ga0097621_102161682 | Not Available | 532 | Open in IMG/M |
| 3300006354|Ga0075021_10102762 | Not Available | 1699 | Open in IMG/M |
| 3300006969|Ga0075419_10201117 | Not Available | 1319 | Open in IMG/M |
| 3300007516|Ga0105050_10763631 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 553 | Open in IMG/M |
| 3300007619|Ga0102947_1000768 | All Organisms → cellular organisms → Bacteria | 11278 | Open in IMG/M |
| 3300008107|Ga0114340_1036022 | Not Available | 2897 | Open in IMG/M |
| 3300008110|Ga0114343_1200928 | Not Available | 576 | Open in IMG/M |
| 3300009039|Ga0105152_10062782 | All Organisms → Viruses → Predicted Viral | 1493 | Open in IMG/M |
| 3300009085|Ga0105103_10033656 | Not Available | 2557 | Open in IMG/M |
| 3300009094|Ga0111539_12108459 | Not Available | 654 | Open in IMG/M |
| 3300009149|Ga0114918_10434400 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula → unclassified Rhodopirellula → Rhodopirellula sp. | 711 | Open in IMG/M |
| 3300009149|Ga0114918_10725780 | Not Available | 520 | Open in IMG/M |
| 3300009149|Ga0114918_10725780 | Not Available | 520 | Open in IMG/M |
| 3300009161|Ga0114966_10194623 | Not Available | 1288 | Open in IMG/M |
| 3300009181|Ga0114969_10170077 | Not Available | 1356 | Open in IMG/M |
| 3300009502|Ga0114951_10031564 | Not Available | 3384 | Open in IMG/M |
| 3300009506|Ga0118657_10002837 | Not Available | 28813 | Open in IMG/M |
| 3300009537|Ga0129283_10221963 | Not Available | 795 | Open in IMG/M |
| 3300009678|Ga0105252_10590231 | Not Available | 512 | Open in IMG/M |
| 3300010233|Ga0136235_1006284 | All Organisms → Viruses → Predicted Viral | 3549 | Open in IMG/M |
| 3300010354|Ga0129333_10395942 | Not Available | 1223 | Open in IMG/M |
| 3300010371|Ga0134125_12183349 | Not Available | 602 | Open in IMG/M |
| 3300010391|Ga0136847_11642227 | Not Available | 580 | Open in IMG/M |
| 3300010391|Ga0136847_12192421 | Not Available | 1553 | Open in IMG/M |
| 3300010397|Ga0134124_10089477 | All Organisms → Viruses → Predicted Viral | 2661 | Open in IMG/M |
| 3300012682|Ga0136611_10469916 | Not Available | 797 | Open in IMG/M |
| 3300012985|Ga0164308_10233984 | Not Available | 1422 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10352310 | Not Available | 848 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10030919 | Not Available | 5160 | Open in IMG/M |
| 3300013232|Ga0170573_10497613 | Not Available | 4031 | Open in IMG/M |
| 3300014169|Ga0181531_10034924 | Not Available | 2908 | Open in IMG/M |
| 3300014494|Ga0182017_10003404 | All Organisms → cellular organisms → Bacteria | 11876 | Open in IMG/M |
| 3300014502|Ga0182021_10260449 | Not Available | 2034 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10014986 | Not Available | 7397 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10039787 | Not Available | 3902 | Open in IMG/M |
| 3300014838|Ga0182030_10024964 | Not Available | 10927 | Open in IMG/M |
| 3300015360|Ga0163144_10012322 | Not Available | 17968 | Open in IMG/M |
| 3300017723|Ga0181362_1014169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus | 1715 | Open in IMG/M |
| 3300017736|Ga0181365_1000335 | Not Available | 10433 | Open in IMG/M |
| 3300017780|Ga0181346_1018330 | Not Available | 2953 | Open in IMG/M |
| 3300017780|Ga0181346_1335623 | Not Available | 504 | Open in IMG/M |
| 3300017785|Ga0181355_1083570 | Not Available | 1332 | Open in IMG/M |
| 3300017788|Ga0169931_10011063 | Not Available | 12788 | Open in IMG/M |
| 3300018481|Ga0190271_10000012 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 179934 | Open in IMG/M |
| 3300018481|Ga0190271_12907297 | Not Available | 575 | Open in IMG/M |
| 3300019784|Ga0181359_1059891 | Not Available | 1458 | Open in IMG/M |
| 3300019784|Ga0181359_1188451 | Not Available | 674 | Open in IMG/M |
| 3300019872|Ga0193754_1021523 | Not Available | 694 | Open in IMG/M |
| 3300020146|Ga0196977_1001442 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8848 | Open in IMG/M |
| 3300020157|Ga0194049_1113266 | Not Available | 728 | Open in IMG/M |
| 3300020711|Ga0214237_1023723 | Not Available | 721 | Open in IMG/M |
| 3300021057|Ga0196981_1001049 | Not Available | 6486 | Open in IMG/M |
| 3300021519|Ga0194048_10004114 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 7062 | Open in IMG/M |
| 3300022222|Ga0226658_10082514 | All Organisms → Viruses → Predicted Viral | 1492 | Open in IMG/M |
| 3300022555|Ga0212088_10041533 | Not Available | 5191 | Open in IMG/M |
| 3300022555|Ga0212088_10859187 | Not Available | 515 | Open in IMG/M |
| 3300022591|Ga0236341_1028858 | All Organisms → Viruses → Predicted Viral | 1586 | Open in IMG/M |
| 3300023088|Ga0224555_1003830 | Not Available | 14670 | Open in IMG/M |
| 3300023095|Ga0247736_10174596 | Not Available | 732 | Open in IMG/M |
| 3300024219|Ga0247665_1002365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1915 | Open in IMG/M |
| 3300024426|Ga0196960_10286620 | Not Available | 545 | Open in IMG/M |
| 3300025015|Ga0209210_1003052 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11661 | Open in IMG/M |
| 3300025164|Ga0209521_10182392 | Not Available | 1273 | Open in IMG/M |
| 3300025167|Ga0209642_10306430 | Not Available | 902 | Open in IMG/M |
| 3300025289|Ga0209002_10564373 | Not Available | 618 | Open in IMG/M |
| 3300025736|Ga0207997_1111288 | Not Available | 903 | Open in IMG/M |
| 3300025838|Ga0208872_1000516 | Not Available | 27808 | Open in IMG/M |
| 3300026144|Ga0209954_1012461 | Not Available | 1486 | Open in IMG/M |
| 3300027706|Ga0209581_1243760 | Not Available | 553 | Open in IMG/M |
| 3300027721|Ga0209492_1089390 | Not Available | 1086 | Open in IMG/M |
| 3300027754|Ga0209596_1237924 | Not Available | 754 | Open in IMG/M |
| 3300027824|Ga0209040_10376127 | Not Available | 667 | Open in IMG/M |
| 3300027850|Ga0209591_10703831 | Not Available | 605 | Open in IMG/M |
| (restricted) 3300027868|Ga0255053_10005641 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Candidatus Troglogloeales → Candidatus Manganitrophaceae → Candidatus Manganitrophus → Candidatus Manganitrophus noduliformans | 6423 | Open in IMG/M |
| 3300027880|Ga0209481_10132663 | Not Available | 1221 | Open in IMG/M |
| 3300027894|Ga0209068_10070211 | Not Available | 1807 | Open in IMG/M |
| 3300027896|Ga0209777_10132945 | All Organisms → Viruses → Predicted Viral | 2073 | Open in IMG/M |
| 3300027896|Ga0209777_10320065 | Not Available | 1192 | Open in IMG/M |
| 3300027897|Ga0209254_10118609 | All Organisms → cellular organisms → Bacteria | 2199 | Open in IMG/M |
| 3300028176|Ga0268284_1178017 | Not Available | 508 | Open in IMG/M |
| 3300028191|Ga0265595_1079949 | All Organisms → Viruses → Predicted Viral | 1099 | Open in IMG/M |
| 3300028283|Ga0268283_1025531 | All Organisms → cellular organisms → Bacteria | 1953 | Open in IMG/M |
| 3300028293|Ga0247662_1006431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1790 | Open in IMG/M |
| 3300028293|Ga0247662_1013913 | All Organisms → Viruses → Predicted Viral | 1298 | Open in IMG/M |
| 3300028298|Ga0268280_1057455 | All Organisms → Viruses → Predicted Viral | 1109 | Open in IMG/M |
| 3300028800|Ga0265338_10647726 | Not Available | 732 | Open in IMG/M |
| 3300029171|Ga0168034_104315 | Not Available | 1072 | Open in IMG/M |
| 3300029174|Ga0168029_103242 | Not Available | 1311 | Open in IMG/M |
| 3300029288|Ga0265297_10000396 | All Organisms → cellular organisms → Bacteria | 134037 | Open in IMG/M |
| 3300029288|Ga0265297_10021262 | All Organisms → cellular organisms → Bacteria | 6817 | Open in IMG/M |
| 3300029288|Ga0265297_10036517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 4607 | Open in IMG/M |
| 3300029288|Ga0265297_10372533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter alpinus | 967 | Open in IMG/M |
| 3300029288|Ga0265297_10529836 | Not Available | 763 | Open in IMG/M |
| 3300029636|Ga0222749_10298300 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 832 | Open in IMG/M |
| 3300030860|Ga0074000_10711484 | Not Available | 529 | Open in IMG/M |
| 3300031236|Ga0302324_103107174 | Not Available | 549 | Open in IMG/M |
| 3300031539|Ga0307380_10027185 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula → unclassified Rhodopirellula → Rhodopirellula sp. | 6685 | Open in IMG/M |
| 3300031539|Ga0307380_10060589 | All Organisms → Viruses → Predicted Viral | 4095 | Open in IMG/M |
| 3300031539|Ga0307380_10153911 | Not Available | 2279 | Open in IMG/M |
| 3300031539|Ga0307380_10305087 | Not Available | 1475 | Open in IMG/M |
| 3300031539|Ga0307380_10803951 | Not Available | 776 | Open in IMG/M |
| 3300031566|Ga0307378_11235869 | Not Available | 588 | Open in IMG/M |
| 3300031578|Ga0307376_10564325 | Not Available | 729 | Open in IMG/M |
| 3300031673|Ga0307377_10013876 | All Organisms → cellular organisms → Bacteria | 7682 | Open in IMG/M |
| 3300031673|Ga0307377_10293706 | Not Available | 1233 | Open in IMG/M |
| 3300031673|Ga0307377_11162455 | Not Available | 507 | Open in IMG/M |
| 3300031707|Ga0315291_10627358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → Sphingobium estronivorans | 969 | Open in IMG/M |
| 3300031707|Ga0315291_10721532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. SRL28 | 881 | Open in IMG/M |
| 3300031707|Ga0315291_10748090 | Not Available | 860 | Open in IMG/M |
| 3300031707|Ga0315291_11030747 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Peregrinibacteria → Candidatus Peribacteria → Candidatus Peribacterales → Candidatus Peribacteraceae → unclassified Candidatus Peribacteraceae → Candidatus Peribacteraceae bacterium | 689 | Open in IMG/M |
| 3300031746|Ga0315293_10125737 | All Organisms → Viruses → Predicted Viral | 2156 | Open in IMG/M |
| 3300031746|Ga0315293_10646844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 794 | Open in IMG/M |
| 3300031746|Ga0315293_11096873 | Not Available | 560 | Open in IMG/M |
| 3300031772|Ga0315288_10023997 | Not Available | 7524 | Open in IMG/M |
| 3300031772|Ga0315288_10064293 | Not Available | 4315 | Open in IMG/M |
| 3300031772|Ga0315288_10078976 | Not Available | 3822 | Open in IMG/M |
| 3300031772|Ga0315288_10144523 | All Organisms → cellular organisms → Bacteria | 2655 | Open in IMG/M |
| 3300031772|Ga0315288_10230859 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1984 | Open in IMG/M |
| 3300031772|Ga0315288_10471847 | All Organisms → Viruses → Predicted Viral | 1248 | Open in IMG/M |
| 3300031772|Ga0315288_11070192 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Peregrinibacteria → Candidatus Peribacteria → Candidatus Peribacterales → Candidatus Peribacteraceae → unclassified Candidatus Peribacteraceae → Candidatus Peribacteraceae bacterium | 709 | Open in IMG/M |
| 3300031772|Ga0315288_11385752 | Not Available | 590 | Open in IMG/M |
| 3300031873|Ga0315297_10336575 | All Organisms → Viruses → Predicted Viral | 1262 | Open in IMG/M |
| 3300031873|Ga0315297_10585712 | Not Available | 937 | Open in IMG/M |
| 3300031885|Ga0315285_10456801 | Not Available | 892 | Open in IMG/M |
| 3300031885|Ga0315285_10570256 | Not Available | 758 | Open in IMG/M |
| 3300031952|Ga0315294_10452592 | All Organisms → Viruses → Predicted Viral | 1187 | Open in IMG/M |
| 3300031963|Ga0315901_10233941 | Not Available | 1565 | Open in IMG/M |
| 3300031997|Ga0315278_10254186 | Not Available | 1814 | Open in IMG/M |
| 3300032053|Ga0315284_10038621 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6648 | Open in IMG/M |
| 3300032053|Ga0315284_10111045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3652 | Open in IMG/M |
| 3300032053|Ga0315284_10135224 | Not Available | 3260 | Open in IMG/M |
| 3300032053|Ga0315284_11382199 | Not Available | 757 | Open in IMG/M |
| 3300032053|Ga0315284_11496542 | Not Available | 717 | Open in IMG/M |
| 3300032053|Ga0315284_11525770 | All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica → unclassified Candidatus Omnitrophica → Candidatus Omnitrophica bacterium | 707 | Open in IMG/M |
| 3300032118|Ga0315277_11228203 | Not Available | 663 | Open in IMG/M |
| 3300032163|Ga0315281_10045359 | Not Available | 5410 | Open in IMG/M |
| 3300032163|Ga0315281_10076181 | Not Available | 3959 | Open in IMG/M |
| 3300032163|Ga0315281_10610835 | Not Available | 1146 | Open in IMG/M |
| 3300032163|Ga0315281_12313405 | Not Available | 506 | Open in IMG/M |
| 3300032173|Ga0315268_10182950 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 1999 | Open in IMG/M |
| 3300032177|Ga0315276_12270457 | Not Available | 548 | Open in IMG/M |
| 3300032205|Ga0307472_100712499 | Not Available | 904 | Open in IMG/M |
| 3300032342|Ga0315286_10214792 | Not Available | 2053 | Open in IMG/M |
| 3300032342|Ga0315286_10969517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 848 | Open in IMG/M |
| 3300032401|Ga0315275_11982357 | Not Available | 614 | Open in IMG/M |
| 3300032516|Ga0315273_10011833 | Not Available | 11168 | Open in IMG/M |
| 3300032516|Ga0315273_10849358 | Not Available | 1184 | Open in IMG/M |
| 3300032516|Ga0315273_11363492 | Not Available | 881 | Open in IMG/M |
| 3300032516|Ga0315273_11529155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 819 | Open in IMG/M |
| 3300032516|Ga0315273_12248799 | Not Available | 638 | Open in IMG/M |
| 3300032516|Ga0315273_12508917 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 594 | Open in IMG/M |
| 3300032782|Ga0335082_11207099 | Not Available | 624 | Open in IMG/M |
| 3300033402|Ga0326728_10351338 | Not Available | 1299 | Open in IMG/M |
| 3300033891|Ga0334811_183782 | Not Available | 509 | Open in IMG/M |
| 3300034358|Ga0370485_0001814 | Not Available | 3722 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 23.63% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 5.49% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 5.49% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.75% |
| Landfill Leachate | Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate | 2.75% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.20% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 2.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.20% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.20% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.65% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.65% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.65% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 1.65% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.65% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 1.65% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.65% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.10% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.10% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 1.10% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.10% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 1.10% |
| Freshwater Lake Hypolimnion | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion | 1.10% |
| Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 1.10% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.10% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 1.10% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 1.10% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 1.10% |
| Aquarium Water | Environmental → Aquatic → Aquaculture → Unclassified → Unclassified → Aquarium Water | 1.10% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.10% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.10% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.10% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.10% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.10% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.10% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.55% |
| Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment | 0.55% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.55% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.55% |
| Aquatic | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Aquatic | 0.55% |
| Contaminated Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Contaminated Groundwater | 0.55% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.55% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.55% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.55% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.55% |
| Mangrove Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment | 0.55% |
| Hotspring | Environmental → Aquatic → Thermal Springs → Tepid (25-34C) → Unclassified → Hotspring | 0.55% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.55% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.55% |
| Beach Aquifer Porewater | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Beach Aquifer Porewater | 0.55% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.55% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.55% |
| Ore Pile And Mine Drainage Contaminated Soil | Environmental → Terrestrial → Soil → Unclassified → Mine Drainage → Ore Pile And Mine Drainage Contaminated Soil | 0.55% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.55% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.55% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.55% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.55% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.55% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.55% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.55% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.55% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.55% |
| Sediment | Engineered → Wastewater → Industrial Wastewater → Mine Water → Unclassified → Sediment | 0.55% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 3300000553 | Trout Bog Lake May 28 2007 Hypolimnion (Trout Bog Lake Combined Assembly 47 Hypolimnion Samples, Aug 2012 Assem) | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300003404 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD | Environmental | Open in IMG/M |
| 3300003465 | Ore pile and mine drainage contaminated soil microbial communities from Mina do Sossego, Brazil - P5 sample | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004775 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA17M | Environmental | Open in IMG/M |
| 3300005222 | Norris Geyser Basin Perpetual Spouter 2 - Microbial communities from the Yellowstone National Park, bulk metagenomes as controls for mini-metagenomic methods | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005607 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 | Environmental | Open in IMG/M |
| 3300005664 | Freshwater viral communities from Emiquon reservoir, Havana, Illinois, USA | Environmental | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005918 | Saline lake microbial communities from Ace Lake, Antarctica- Antarctic Ace Lake Metagenome 02UKC | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006111 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Jul08 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007516 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 | Environmental | Open in IMG/M |
| 3300007619 | Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_D2_MG | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300009039 | Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cm | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009502 | Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG | Environmental | Open in IMG/M |
| 3300009506 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8 | Environmental | Open in IMG/M |
| 3300009537 | Microbial community of beach aquifer porewater from Cape Shores, Lewes, Delaware, USA - D-2W | Environmental | Open in IMG/M |
| 3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
| 3300010233 | Filterable freshwater microbial communities from Conwy River, North Wales, UK. Fraction, filtered through 0.2 um filter. After WGA. | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300012682 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ223 (23.06) | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300013232 | Sediment microbial communities from Acid Mine Drainage holding pond in Pittsburgh, PA, USA ? S1 | Engineered | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014494 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaG | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015360 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1 | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300019872 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a1 | Environmental | Open in IMG/M |
| 3300020146 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_10-13C | Environmental | Open in IMG/M |
| 3300020157 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L224-25m | Environmental | Open in IMG/M |
| 3300020711 | Freshwater microbial communities from Trout Bog Lake, WI - 29JUL2008 hypolimnion | Environmental | Open in IMG/M |
| 3300021057 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S3_20-13C | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300022222 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1 (v2) | Environmental | Open in IMG/M |
| 3300022555 | Alinen_combined assembly | Environmental | Open in IMG/M |
| 3300022591 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S2 | Environmental | Open in IMG/M |
| 3300023088 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 30-34 | Environmental | Open in IMG/M |
| 3300023095 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L193-509B-2 | Environmental | Open in IMG/M |
| 3300024219 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK06 | Environmental | Open in IMG/M |
| 3300024426 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_5 | Environmental | Open in IMG/M |
| 3300025015 | Contaminated groundwater microbial communities from Rifle, Colorado, USA - Rifle Groundwater A1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025164 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 4 | Environmental | Open in IMG/M |
| 3300025167 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025289 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 2 | Environmental | Open in IMG/M |
| 3300025736 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKN (SPAdes) | Environmental | Open in IMG/M |
| 3300025838 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug08 (SPAdes) | Environmental | Open in IMG/M |
| 3300026144 | Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_D2_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027850 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01 (SPAdes) | Environmental | Open in IMG/M |
| 3300027868 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_22 | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| 3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
| 3300028176 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_06_06_40m | Environmental | Open in IMG/M |
| 3300028191 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_06_06_50m | Environmental | Open in IMG/M |
| 3300028283 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_06_06_36m | Environmental | Open in IMG/M |
| 3300028293 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK03 | Environmental | Open in IMG/M |
| 3300028298 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_40m | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300029171 | Aquariaum water viral communities from Chicago, USA - Great Lakes - GLA2 | Environmental | Open in IMG/M |
| 3300029174 | Aquariaum water viral communities from Chicago, USA - Amazon Rising - AZ1 | Environmental | Open in IMG/M |
| 3300029288 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 137-91 | Engineered | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030860 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Litter GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033891 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-1-D | Environmental | Open in IMG/M |
| 3300034358 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_01D_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deeps_01858620 | 2199352024 | Soil | MNVYIVYLEGVEVCTIKAASHNAAEAKAKKVFPGRQVSVCYTEL |
| TBL_comb47_HYPODRAFT_100327271 | 3300000553 | Freshwater | MKDYIVYVDGIEVGYIKAGSHNSAEKKAQKRYPNREVSVEYTEL* |
| JGI25909J50240_10880411 | 3300003393 | Freshwater Lake | MKTYIIYVKGIEKGYLKAPNHNAAEKKAQKKHSEVKATEVSVSYTEL* |
| JGI25920J50251_101011341 | 3300003404 | Freshwater Lake | MKTYIIYVKGIEKGYLKAANHNAAEKKAQKKYSEVKASEVSVAYTEL* |
| P52013CM_10194345 | 3300003465 | Ore Pile And Mine Drainage Contaminated Soil | MKVYIVYVDGNELPRSQWVKAANHNAAEKKAKAKFPDKQVSVAYTEV* |
| Ga0062387_1002876251 | 3300004091 | Bog Forest Soil | MKTYIVYLDGEELPRDKWIKAGSHNAAEKKAKGKYPDKQVSVAYTEV* |
| Ga0062389_1010627122 | 3300004092 | Bog Forest Soil | MKTYIVYVDGNEVGMIKAGSHNAAEKKAQALYPLQRVCVAYTEV* |
| Ga0062386_1005209041 | 3300004152 | Bog Forest Soil | MKVYIVYLNGQELPRSQWIKAGSHNAAEKKAQAKYPGQSVSVAYTEV* |
| Ga0063455_1000713904 | 3300004153 | Soil | VKTYIVFVDGNEVGLIKAKGHNAAEKKAQAKYPGRSVSVAYTEV* |
| Ga0007798_100437042 | 3300004775 | Freshwater | MKTYIIYVDGIERGYIKAGSHNAAERKAKKKYPTANNVSVAYTEL* |
| Ga0073351_1235962 | 3300005222 | Hotspring | MKTYIVYVDGEEKGTIKAGSHNAAEKKAQAKYPGRQVSVAYTEV* |
| Ga0065707_109466452 | 3300005295 | Switchgrass Rhizosphere | MKTYIVYVDGEELPRDKWIKAGGHNAAEKKAQAKYPGKQVSVAYTEV* |
| Ga0070694_1000348655 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTYILYIDGEEKGYIKAGSHNAAEKKAKKKYPNNNVMVVYTEI* |
| Ga0070707_1008601692 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTYIVYVNGVETPPYIKAGSHNAAEKKAQKRHPKQNVSVAYTEV* |
| Ga0049081_100155192 | 3300005581 | Freshwater Lentic | MKTYIVYINGEEVGTIKAGNHNSAERKARAKYSDEPPHAVSVVYTEI* |
| Ga0070740_100221121 | 3300005607 | Surface Soil | VNVKTYIVYVDGNELPRDKWIKAGSHNAAEKKAKAKYPNQQVSVAYTEV* |
| Ga0073685_11536991 | 3300005664 | Aquatic | MKTYIVIVDGVELPRSQWIKASGHNAAEKKAQAKYPGRNVSVEYTEV* |
| Ga0074470_1116915815 | 3300005836 | Sediment (Intertidal) | MKVYIVYVDGNEAGTIRAASHNAAEKKAQKKYPGKHVSVEYTEL* |
| Ga0075116_100424291 | 3300005918 | Saline Lake | MKTYIVYVDGNEAGYIKAGSHNAAEKKAQKKYPGKNVMVTYTEL* |
| Ga0075015_1008224552 | 3300006102 | Watersheds | GCLGCSECMKIYRVYVEGVEVGIIKAVSHNAAEKKAQAKYPGKNVSVEYTEV* |
| Ga0007848_100062826 | 3300006111 | Freshwater | MKSYIVYVNGDEVCIIKASSHNAAEKKAQAKFPGKHVSVAYTEV* |
| Ga0070715_100220726 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTYIVYVDGVELPRSQWIKAGGHNAAEKKAKAKYPGQQVSVAYTEV* |
| Ga0070715_102420912 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTYIVHVDGEEVGLIKAGSQKTAEKKAQKKYPDRNVSVVYTEV* |
| Ga0097621_1005652351 | 3300006237 | Miscanthus Rhizosphere | DGVEVGLIKAASHNAAEKKAQKKHPGRAVSVAYTEV* |
| Ga0097621_1021616822 | 3300006237 | Miscanthus Rhizosphere | VKTYVVFVDGIERGLIKAASHNAAEKKAAKQYPGRSV |
| Ga0075021_101027621 | 3300006354 | Watersheds | MKTYIVYVDGEERGMIKAWSHNAAEKKAQAKYPGKSVSVAYTEV* |
| Ga0075419_102011173 | 3300006969 | Populus Rhizosphere | MKTYIVYVDGDELPRDKWVKAGSHNAAEKKAKAKYPGKQVSVAYTEV* |
| Ga0105050_107636311 | 3300007516 | Freshwater | MKFYIVYVDGEEVDMLKAGSHNEAEKKAQKKYPGKNISVAYTEV* |
| Ga0102947_100076813 | 3300007619 | Soil | MKTYIIYVKGYEKGVIKAASHNAAEKKAWKKFSDYPREQISVAYTEV* |
| Ga0114340_10360224 | 3300008107 | Freshwater, Plankton | MKTFIVYLKGIEVGYIKAKGHNEAEKKAQKKYSNYKSYEVSVSYTEL* |
| Ga0114343_12009283 | 3300008110 | Freshwater, Plankton | MKTFIVYLKGIEAGYIKAANHNAAEKKAQKKYLKN* |
| Ga0105152_100627821 | 3300009039 | Lake Sediment | MKTYIVYVDGIEVGYIKAASHNAAEKKAQKKYTGRQVSVVYTEI* |
| Ga0105103_100336561 | 3300009085 | Freshwater Sediment | MKTYIVYVDGIEAGIVKASGHNAAEKKAQAKYPGRQVAVAYTEV* |
| Ga0111539_121084592 | 3300009094 | Populus Rhizosphere | MKTYIVYVKGAEQPGYIKAGSHNAAEKKAQKKYPHVKPHEVSVAYTEI* |
| Ga0114918_104344001 | 3300009149 | Deep Subsurface | MKVYIVYVDGEEVGYIKAKDHNTAEKKAQKQYPGKNIMVC |
| Ga0114918_107257801 | 3300009149 | Deep Subsurface | MKVYIVYVDGEEVGYIKAKDHNTAEKKAQKQYPGKN |
| Ga0114918_107257803 | 3300009149 | Deep Subsurface | DGEEVGYIKAKDHNTAEKKAQKQYPGKNIMVCYTEL* |
| Ga0114966_101946233 | 3300009161 | Freshwater Lake | MKTYIIYVKGIEKGYLKAANHNAAEKKAQKKYSEVKASEVSVSYTEL* |
| Ga0114969_101700774 | 3300009181 | Freshwater Lake | MKTYIIYVKGIEKGYIKAASHNAAEKKAQKKYSECKPFEVSVAYTEL* |
| Ga0114951_100315649 | 3300009502 | Freshwater | MKTYIVYVDGNEAGYIKAGSHNAAEKKAKKKYPNANDVSVAYTEI* |
| Ga0118657_1000283711 | 3300009506 | Mangrove Sediment | MKTYIVYTGNGDPVGFVKAGSHNAAEKKAKKKYGEQAIVAYTEV* |
| Ga0129283_102219631 | 3300009537 | Beach Aquifer Porewater | MKVYIVYVDGVEVGMIRASGHNAAERKAARKYPGRHVSVAYTEI* |
| Ga0105252_105902312 | 3300009678 | Soil | MKTYIVYVDGEELPRDKWVKASGHNAAEKKAQAKYPGKQVSVAYTEV* |
| Ga0136235_10062848 | 3300010233 | Freshwater | MKTYIVYVDGNELPRDKWIKAASMNAAEKKAQAKHPGKNIQVAYTEV* |
| Ga0129333_103959422 | 3300010354 | Freshwater To Marine Saline Gradient | MKVFIVYVDGEEVGKIKAKNHNAAEEKAWKMYPNKDKWSVSVAYTEI* |
| Ga0134125_121833492 | 3300010371 | Terrestrial Soil | MKRELMKVYIVFVEGEEKGKVKAASHNAAEKKAQKLYPGKNVSVEYTEV* |
| Ga0136847_116422272 | 3300010391 | Freshwater Sediment | MKLYIIYVDGEERGTIRAGSHNAAERKAQARYPGRNVSVAYTEV* |
| Ga0136847_121924214 | 3300010391 | Freshwater Sediment | MKVYIVYVDGVEVEGYIRAGSHNAAEKKAKKKYPHAKDVSVAYTEI* |
| Ga0134124_100894772 | 3300010397 | Terrestrial Soil | MKTYIVYVDGEELPRDKWVKAGSHNAAEKKAQAKYPGKQVSVAYTEV* |
| Ga0136611_104699162 | 3300012682 | Polar Desert Sand | MRSYIVYVDGEEVEIIKAGSHNAAEKKAQKKYPGRFVVVEYTEV* |
| Ga0164308_102339842 | 3300012985 | Soil | MKRTRSYIVYVDGIETEIISAPSHNAAEAKAQKKYPGKNVSVAYTEV* |
| (restricted) Ga0172367_103523102 | 3300013126 | Freshwater | MKMFIVYLKGIEVGYINAKSHNEAENIAQKKYNNYKPYEVSVAYTEL* |
| (restricted) Ga0172373_100309192 | 3300013131 | Freshwater | MKTYIIYVNGIEVGTCKAASHNAAEKKAQKMYPGHNVCVTYTEI* |
| Ga0170573_104976131 | 3300013232 | Sediment | IVYVDGREVGMIKAGSHNAAEKKAKAKYPTGNVMVAYTEV* |
| Ga0181531_100349243 | 3300014169 | Bog | MKTYIVYVNGNEVGMIKAASHNAAEKKAQAKYPTVPKFHVSVAYTEV* |
| Ga0182017_1000340412 | 3300014494 | Fen | MKTYIVYIDGNEVGYIKAGSHNSAEKKAQKKYPGKNVTVVYTEI* |
| Ga0182021_102604491 | 3300014502 | Fen | MKAYIVYVDGKEVGVIRAGSHNAAERKAQTKYKCPHGEAFHVSVAYTEL* |
| (restricted) Ga0172376_1001498617 | 3300014720 | Freshwater | TYIIYVNGIEVGTCKAASHNAAEKKAQKMYPGHNVCVTYTEI* |
| (restricted) Ga0172376_100397871 | 3300014720 | Freshwater | MKTYIIYVDGIEVGTCKAASHNAAEKKAQKMYPGHN |
| Ga0182030_1002496415 | 3300014838 | Bog | MKTYIVYVDGVEQAQYVRAGSHNAAEKKAKKKYPNKDVSVTYTEI* |
| Ga0163144_1001232230 | 3300015360 | Freshwater Microbial Mat | MKTYIVYVDGVEVGMIKAANHNAAERKAQAKYVGRNVMVAYTEA* |
| Ga0181362_10141691 | 3300017723 | Freshwater Lake | MKTYIIYVKGIEKGYLKAPNHIAAEKKAQKKHSEVKATEVSVSYTEL |
| Ga0181365_100033516 | 3300017736 | Freshwater Lake | MKTYIVYVKGVEASFYIKATSHNSAEKKAQKKFPHLKPTEVSVSYTEI |
| Ga0181346_10183306 | 3300017780 | Freshwater Lake | YIVYVKGVEASFYIKATSHNSAEKKAQKKFPHLKPTEVSVSYTEI |
| Ga0181346_13356232 | 3300017780 | Freshwater Lake | MKTYIIYVKGIEKGYLNSPNHTAAEKKAQKKHSEVKATEVSVSYTEL |
| Ga0181348_11874502 | 3300017784 | Freshwater Lake | GAMKTYIVYINGEEVGTIKAGNHNSAERKARAKYSDEPPHAVSVVYTEI |
| Ga0181355_10835703 | 3300017785 | Freshwater Lake | MKTYIVYVDGVELGYIKAGSHNAAEAKAQKRHPGRQVMVAYTEL |
| Ga0169931_1001106330 | 3300017788 | Freshwater | MKMFIVYLKGIEVGYINAKSHNEAENIAQKKYNNYKPYEVSVAYTEL |
| Ga0190271_1000001274 | 3300018481 | Soil | MKTFIVYVDGIEVGTIKAAGHNSAEKKAQKKYPGKAVSVAYTEV |
| Ga0190271_129072972 | 3300018481 | Soil | VKTYVVFVDGIERGLIKAASHNAAEKKAAKQYPGRSVSVEYTEI |
| Ga0181359_10598913 | 3300019784 | Freshwater Lake | MKTYIIYVKGIEKGYLKAANHNAAEKKAQKKYSEVKASEVSVAYTEL |
| Ga0181359_11884512 | 3300019784 | Freshwater Lake | MKTYIIYVKGIEKGYLKAPNHNAAEKKAQKKHSEVKATEVSVSYTEL |
| Ga0193754_10215231 | 3300019872 | Soil | MKTYIVYVNGEELPRDKWVKAAGHNAAEKKAKAKYPGQQVSVAYTEV |
| Ga0196977_100144219 | 3300020146 | Soil | MKTYIVYVDGLEVRKIKAGNHNAAEKKAQKLYPALPRHRVSVAYTEV |
| Ga0194049_11132661 | 3300020157 | Anoxic Zone Freshwater | MKTYIIYVDGIERGYIKAGSHNAAERKAKKKYPTANNVSVAYTEL |
| Ga0214237_10237232 | 3300020711 | Freshwater | MKDYIVYVDGIEVGYIKAGSHNSAEKKAQKRYPNREVSVEYTEL |
| Ga0196981_10010493 | 3300021057 | Soil | MKTYIVYVKGVEQKEYIKAGSHNAAEKKAQKKFPHVKPHEVSVAYTEI |
| Ga0194048_1000411413 | 3300021519 | Anoxic Zone Freshwater | MKTYIIYVKGIEVGYLKAANHNAAEKKAQKKYSEVKASEVSVSYTEL |
| Ga0226658_100825142 | 3300022222 | Freshwater Microbial Mat | MKTYIVYVDGVEVGMIKAANHNAAERKAQAKYVGRNVMVAYTEA |
| Ga0212088_100415337 | 3300022555 | Freshwater Lake Hypolimnion | MKTYIVYVDGNEAGYIKAGSHNAAEKKAKKKYPNANDVSVAYTEI |
| Ga0212088_108591872 | 3300022555 | Freshwater Lake Hypolimnion | MKTYIVYVNGIEVGYIKAGSHNSAEKKAQKKYEGQAKPYNISVAYTEL |
| Ga0236341_10288582 | 3300022591 | Freshwater | MKIYIVYVNGSEVGYIKAASHNAAEKKAIKKYHGEAVPGQVQVVHTEI |
| Ga0224555_100383018 | 3300023088 | Soil | MKTYIVYVDGVEQAQYVRAGSHNAAEKKAKKKYPNKDVSVTYTEI |
| Ga0247736_101745962 | 3300023095 | Plant Litter | MKNYIVYVNGIEMPMIKAGSHNSAEKKAQKKYPNEFVTVSYTEV |
| Ga0247665_10023654 | 3300024219 | Soil | MKTYIVYVDGNELPRSQWIKAGSHNTAEKKAQAKYPGKQVSVAYTEV |
| Ga0196960_102866201 | 3300024426 | Soil | MKTYIVYVDGIKVDMIKATGHNAAEKKAQKKYPGRNVSVTYTEI |
| Ga0209210_100305211 | 3300025015 | Contaminated Groundwater | MKVYIVYVDGTETCKIKAGSTNAAEKKAQAKFPGKSISVAYTEV |
| Ga0209521_101823923 | 3300025164 | Soil | MKTYIVYVNGVEAGYIKAGSHNAAEKKAQAKFPGKQGSVEY |
| Ga0209642_103064302 | 3300025167 | Soil | MKTYIVYVNGVEAGYIKAGSHNAAEKKAQAKFPGKQVSVEYTEL |
| Ga0209002_105643733 | 3300025289 | Soil | IVYVNGVEAGYIKAGSHNAAEKKAQAKFPGKQVSVEYTEL |
| Ga0207997_11112883 | 3300025736 | Saline Lake | MKTYIVYVDGNEAGYIKAGSHNAAEKKAQKKYPGKNVMVTYTEL |
| Ga0208872_100051641 | 3300025838 | Freshwater | MKSYIVYVNGDEVCIIKASSHNAAEKKAQAKFPGKHVSVAYTEV |
| Ga0209954_10124614 | 3300026144 | Soil | MKTYIIYVKGYEKGVIKAASHNAAEKKAWKKFSDYPREQISVAYTEV |
| Ga0208974_100137115 | 3300027608 | Freshwater Lentic | MKTYIVYINGEEVGTIKAGNHNSAERKARAKYSDEPPHAVSVVYTEI |
| Ga0209581_12437602 | 3300027706 | Surface Soil | VNVKTYIVYVDGNELPRDKWIKAGSHNAAEKKAKAKYPNQQVSVAYTEV |
| Ga0209492_10893903 | 3300027721 | Freshwater Sediment | MKTYIVYVDGIEAGMIKARSHNVAEWKAQAKYPGRQVAVAYTEV |
| Ga0209596_12379243 | 3300027754 | Freshwater Lake | MKTYIIYVKGIEKGYIKAASHNAAEKKAQKKYSECKPFEVSVAYTEL |
| Ga0209229_100564433 | 3300027805 | Freshwater And Sediment | VKTYIVYDDTGREISLIKAGSHNSAEKKAIKKYGDRVTVTYTEV |
| Ga0209040_103761272 | 3300027824 | Bog Forest Soil | MKVYIVYLNGQELPRSQWIKAGSHNAAEKKAQAKYPGQSVSVAYTEV |
| Ga0209591_107038313 | 3300027850 | Freshwater | MQVYIVYVNGDKKGMIRAGSHDAAEKKAKKLYPNKNVDVAYTEI |
| (restricted) Ga0255053_100056417 | 3300027868 | Seawater | MKTYIVYVKGTEVKMIKAGSHNAAEAKAQKLYPNVHPAEVQVTYTEVSDEVYKSLT |
| Ga0209481_101326632 | 3300027880 | Populus Rhizosphere | MKTYIVYVDGDELPRDKWVKAGSHNAAEKKAKAKYPGKQVSVAYTEV |
| Ga0209068_100702116 | 3300027894 | Watersheds | MKTYIVYVDGEERGMIKAWSHNAAEKKAQAKYPGKSVSVAYTEV |
| Ga0209777_101329455 | 3300027896 | Freshwater Lake Sediment | MKTYIVYVNGIEVGYIKAGSHNAAEKKAQKKHPNQNVSVAYTEV |
| Ga0209777_103200653 | 3300027896 | Freshwater Lake Sediment | MKVFIVYVDGNEVGYIKASNHNKAEAKAKTQYPNRNVSVEYTEL |
| Ga0209254_101186093 | 3300027897 | Freshwater Lake Sediment | MKSYIVYVDGEEVGMIKAGSHNAAEKKAQAKYPGRQVSVAYTEV |
| Ga0268284_11780172 | 3300028176 | Saline Water | YIVYVDGIEVGYIKAGGHNAAEKKAQGKYPNRNVSVAYTEL |
| Ga0265595_10799491 | 3300028191 | Saline Water | MKTYIVYVNGIEVGYIKANNHNSAEKKAQKKHPGKNVSVCYTEL |
| Ga0268283_10255315 | 3300028283 | Saline Water | MKTYIVYVDGIEVGYIRAGGHNAAEKKAQKKYPNRNVSVAYTEL |
| Ga0247662_10064314 | 3300028293 | Soil | SILPLRGDCVRMKTYIVYVNGEEVGYIKAGSHNSAEKKTQKKYPGKTVWVAYTEI |
| Ga0247662_10139133 | 3300028293 | Soil | MKTYIVYVDGQEVGLIKAGSHNAAEKKAQKKYPGKQVSVAYTEV |
| Ga0268280_10574554 | 3300028298 | Saline Water | MKTYIVYVDGIEVGYIKASSHNSAEKKAQKKHPGKNVSVCYTEL |
| Ga0265338_106477262 | 3300028800 | Rhizosphere | MKVYLVYVDGVEQSKPIKAASHNAAEKKAQKLYPGKSVWVAYTEI |
| Ga0168034_1043151 | 3300029171 | Aquarium Water | VKTYIVYVDGVEVGMIKAGSHNAAEKKAQKKYPGKNVSVAYTEV |
| Ga0168029_1032421 | 3300029174 | Aquarium Water | MKTYIVYVNGFEAGTIKAGSHNAAEKKAKAKHPGKDVSVAYTEV |
| Ga0265297_10000396134 | 3300029288 | Landfill Leachate | MKVYIVYVDGEEVGMIRAKSHNDAERKAQAKYPGRQVSVAYTEI |
| Ga0265297_100212626 | 3300029288 | Landfill Leachate | MKTYIVYVDGVEMGYIKAGSHNSAEKKAQKKYPNKNVTVVYTEL |
| Ga0265297_100365171 | 3300029288 | Landfill Leachate | EGVEVGYIKAGSHNAAEKKAQKKHSGKQVTVVYTEV |
| Ga0265297_103725332 | 3300029288 | Landfill Leachate | MKTYIVYVEGVEVGYIKAGSHNAAEKKAQKKHSGKQVTVVYTEV |
| Ga0265297_105298361 | 3300029288 | Landfill Leachate | MKTYIVYVEGVEVGYIKAGSHNAAEKKAQKKHSGKQVTVVYTEVXIYETK |
| Ga0222749_102983001 | 3300029636 | Soil | MKTYLVYVDGNEVGMIKAGSHNAAEKKAQAKYPGKQVSVAYTKV |
| Ga0074000_107114841 | 3300030860 | Soil | MKTYIVYVNGNEVGMIKAGSHNAAEKKAQAKYKNGFVTIAYTEV |
| Ga0302324_1031071742 | 3300031236 | Palsa | MKVYIVYVDGIEVGMIKAGSHNAAEKKARLSYPGKHVSVAYTEV |
| Ga0307380_100271851 | 3300031539 | Soil | MKVYIVYVDGEEVGYIKAKDHNTAEKKAQKQYPGKNVM |
| Ga0307380_100605897 | 3300031539 | Soil | MKTYIVYVNGEERGYIKAGSHNSAEKKAKKKYGQNGENVSVCYTEI |
| Ga0307380_101539114 | 3300031539 | Soil | MKTYIVYVDGIEVGYIKAASHNAAEKKAQKKHPNRQVSVAYTEI |
| Ga0307380_103050876 | 3300031539 | Soil | MKVYIVYVDGEEVGYIKAKDHNTAEKKAQKQYPGKNVMVCYTEL |
| Ga0307380_108039512 | 3300031539 | Soil | MKTYIVYVDGIEVGYIKAASHNAAEKKAQKKYTGRQVSVAYTEI |
| Ga0307378_112358691 | 3300031566 | Soil | MKVYIVYVDGEEVGYIKAKDHNTAEKKAQKQYPGKNIMVCYTEL |
| Ga0307376_105643251 | 3300031578 | Soil | MKTYIVYVDGIEVGYIKAASHNAAEKKAQKKYPNRQVSVAYIE |
| Ga0307377_100138762 | 3300031673 | Soil | VWETNNAERKKPMKTYIVYVDGIEVGYIKAASHNAAEKKAQKKHPNRQVSVAYTEI |
| Ga0307377_102937062 | 3300031673 | Soil | MGGEQTTRRKPMKTYIVYVDGIEVGYIKAASHNAAEKKAQKKHPNRQVSVAYTEI |
| Ga0307377_111624551 | 3300031673 | Soil | MKTYIVYVNGVEVGYIKAASHNAAEKKAQKKHPNSQVSVAYTEI |
| Ga0315291_106273583 | 3300031707 | Sediment | MKTYICYVDGVEQDTYIKASGHNAAEKKAQKKYPKQNISVCYTEI |
| Ga0315291_107215321 | 3300031707 | Sediment | MKTYIVYVDGVEVGMIKAASHNAAEKKAKVKYPGRSVSVSYTEI |
| Ga0315291_107480901 | 3300031707 | Sediment | MKTYIVYVDGVEQTELLKAGSHNAAEKKAQKKYIGKNISVSYTEV |
| Ga0315291_110307472 | 3300031707 | Sediment | MKTYIVYVDGDEVGYIKAGSHNAAEKKAQAKYPGKQVSVTYTEV |
| Ga0315293_101257373 | 3300031746 | Sediment | MKTFIVYNEKGIEVGYIKAGGHNAAEKKAQKKYGAKASVAYTEL |
| Ga0315293_106468441 | 3300031746 | Sediment | GNEVGMIKASGHNAAEKKAQKKYPGKQVSVAYTEI |
| Ga0315293_110968732 | 3300031746 | Sediment | MKTYIVYVDGVEQQGYIKAGGQNAAEKKAQKKYPGKNVSVSYTEV |
| Ga0315288_100239973 | 3300031772 | Sediment | MKVYIVYVDGIECGKVKAASHNAAEKKAAKLYPNQNVSVAYTEV |
| Ga0315288_100642938 | 3300031772 | Sediment | MKTYIVYVDGNEVGMIKAGSHNAAEKKAKAKYPTAQVSVAYTEI |
| Ga0315288_100789767 | 3300031772 | Sediment | MKTYIVYVDGREVGMIKAGSHNAAEKKAKAKYPTAQVSVAYTEV |
| Ga0315288_101445234 | 3300031772 | Sediment | MKVYIVYVNGEEVGHIKAASHNAAEKKAQKKYPDKQVSVAYTEI |
| Ga0315288_102308594 | 3300031772 | Sediment | MKTYIVYVDGEEVGYIRAGSHNAAEVKAMKKYPGRNVMVCYTEI |
| Ga0315288_104718473 | 3300031772 | Sediment | MKVYIVYVDGEERGMLRAKSHNAAEKKAQAKYPGKHVSVAYTEV |
| Ga0315288_110701922 | 3300031772 | Sediment | MKTYIVYVDGDEVGYIKAGSHNAAEKKAQAKYPGKQVSVAYTEV |
| Ga0315288_113857522 | 3300031772 | Sediment | MKTYIVYVNGEEVGYIKAKGHNDAEKKAQAKYPDQQVSVAYTEI |
| Ga0315297_103365753 | 3300031873 | Sediment | MKTYIVYVNGIEHGMIRARSHNLAEVKAAALYPGRNVSVAYTEV |
| Ga0315297_105857122 | 3300031873 | Sediment | MKTYIVYCDGVEVGMIKAKSHNAAEKKAKKLYPRANDVSVAYTEV |
| Ga0315285_104568011 | 3300031885 | Sediment | MKTYIVFVDGAEQKELIKAANHNAAEKKATKKYPGKLVNVSYTE |
| Ga0315285_105702561 | 3300031885 | Sediment | MKVFIVYVDGNEVGMIKASGHNAAEKKAQKKYPGKQVSV |
| Ga0315294_104525922 | 3300031952 | Sediment | MKTYIVYVNGFEREYIKAASHNAAEKKAKKKYKNPNEQVTVSYTEV |
| Ga0315901_102339413 | 3300031963 | Freshwater | MKTFIVYLKGIEVGYIKAKGHNEAEKKAQKKYSNYKSYEVSVSYTEL |
| Ga0315278_102541866 | 3300031997 | Sediment | MKTYIVYVDGNEAGTLKAANHNAAEKKAQKKYPGRDVSVAYTEV |
| Ga0315284_1003862112 | 3300032053 | Sediment | MKTYIVFVDGAEQKELIKAANHNAAEKKATKKYPGKLVNVSYTEV |
| Ga0315284_101110457 | 3300032053 | Sediment | MKTYLVFVDGISAGTVKAANHNAAEKKAKALFPQNSVSVEYTEV |
| Ga0315284_101352243 | 3300032053 | Sediment | MKNYVVYVEGVEVGYLKAGSHNAAEKKAAKKYPGKQVSVAYTEL |
| Ga0315284_113821991 | 3300032053 | Sediment | VKEAKNMKHYIVYVDGDEVGNVKAASHNAAEKKAKAKYPNKQVSVEYTEY |
| Ga0315284_114965423 | 3300032053 | Sediment | MKVFIVYVDGNEVGMIKASGHNAAEKKAQKKYPGKQVSVAYTEV |
| Ga0315284_115257702 | 3300032053 | Sediment | MKTYIVYVDGCECCYIKAASHNAAEKKAKKKYPEKQVSVAYTEV |
| Ga0315277_112282032 | 3300032118 | Sediment | MKTYIVYVNGIEVKMIKAGSHNAAEKKAKKLYPDSSFVAVVYTEV |
| Ga0315281_1004535914 | 3300032163 | Sediment | MKTYIVYVDGREVGMIKAGSHNAAEKKAKERYPSAQVSVAYTEV |
| Ga0315281_100761819 | 3300032163 | Sediment | MKTYIVYVDGNEVGMIKAGSHNAAEKKAKAKYPNAQVSVAYTEV |
| Ga0315281_106108353 | 3300032163 | Sediment | MKTYIVYVDGVEVGMLKAVSHNAAEKKAQKKYPGRNVSVAYTEV |
| Ga0315281_123134051 | 3300032163 | Sediment | MKVYIVYVEGEEVKPMIKAGSQNAALKKAQAKYPGKQVDVVYTEV |
| Ga0315268_101829504 | 3300032173 | Sediment | MKNYIVYVDGIERGMVISGSHNAAEKKAQKKYPGKQVSVEYTEI |
| Ga0315276_122704572 | 3300032177 | Sediment | MKTYIVYVDGNEVGMIKAGSHNAAEKKAKAKYPTAQVSVAYTEV |
| Ga0307472_1007124992 | 3300032205 | Hardwood Forest Soil | MKTYIVYLDGNELPRDKWIKAGSHNAAEKKAQAKYPGRSVSVAYTEV |
| Ga0315286_102147923 | 3300032342 | Sediment | MKTYRVYVNGIEAGTLKAANHNAAEKKARAKFPGTNVSVEYTEV |
| Ga0315286_109695172 | 3300032342 | Sediment | MKVFIVYVDGNEVGMIKASGHNAAEKKAQKKYPGKQVSVAYTEI |
| Ga0315275_119823571 | 3300032401 | Sediment | MKTYIVYVDGNEVGMIKAGSHNAAEKKAKAKYPNAQVS |
| Ga0315273_100118335 | 3300032516 | Sediment | MKTYIVYVDGVEVGMLKAGSHNAAEKKAQAKYPGKQVSVAYTEV |
| Ga0315273_108493585 | 3300032516 | Sediment | QVGTTKGNKMKVFIVYVDGNEVGMIKASGHNAAEKKAQKKYPGKQVSVAYTEV |
| Ga0315273_113634921 | 3300032516 | Sediment | MKTYLVFVDGISAGTVKAANHNAAEKKAKALYPQNSVSVEYTEV |
| Ga0315273_115291551 | 3300032516 | Sediment | MKVFIVYVDGNEVGMIKASGHNAAEKKAQKKYPGKQVSVAYTEIXRWHAQSFVRP |
| Ga0315273_122487992 | 3300032516 | Sediment | MKTYIVYVDGVEQDTYIKASGHNAAEKKAQKKYPNKNVSVCYTEI |
| Ga0315273_125089171 | 3300032516 | Sediment | SNMKTYIVYVDGEEVGYIRAGSHNAAEVKAMKKYPGRNVMVCYTEI |
| Ga0335082_112070992 | 3300032782 | Soil | MKTYIVYVNGLEIALIKAANHNAAEKKAQKKYKMHPPSKVSVVYTEV |
| Ga0326728_103513382 | 3300033402 | Peat Soil | MKTYIVYVNGVEVGYIKAGSHNAAEKKAQKRHKNVEPYKVSVVYTEL |
| Ga0334811_183782_310_444 | 3300033891 | Soil | MKTYIVYIDGNEVGYIKAGSHNSAEKKAQKKYPGKNVTVVYTEI |
| Ga0370485_0001814_1067_1201 | 3300034358 | Untreated Peat Soil | MKVYLVFVDGIEVGKLRAKSHNAAEKKAAALYPGRSVMVSYTEI |
| ⦗Top⦘ |