| Basic Information | |
|---|---|
| Family ID | F031265 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 183 |
| Average Sequence Length | 44 residues |
| Representative Sequence | YTCAVKRRWSTAGESPARELGSLHPEAIGAAVEETKPSEPPV |
| Number of Associated Samples | 160 |
| Number of Associated Scaffolds | 183 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 9.89 % |
| % of genes near scaffold ends (potentially truncated) | 95.63 % |
| % of genes from short scaffolds (< 2000 bps) | 82.51 % |
| Associated GOLD sequencing projects | 158 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.525 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (24.044 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.137 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.645 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 28.57% β-sheet: 0.00% Coil/Unstructured: 71.43% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 183 Family Scaffolds |
|---|---|---|
| PF08388 | GIIM | 14.21 |
| PF00078 | RVT_1 | 12.02 |
| PF02371 | Transposase_20 | 3.83 |
| PF01548 | DEDD_Tnp_IS110 | 1.09 |
| PF00877 | NLPC_P60 | 0.55 |
| PF00069 | Pkinase | 0.55 |
| PF03901 | Glyco_transf_22 | 0.55 |
| PF01042 | Ribonuc_L-PSP | 0.55 |
| PF00589 | Phage_integrase | 0.55 |
| PF13751 | DDE_Tnp_1_6 | 0.55 |
| PF00224 | PK | 0.55 |
| PF12728 | HTH_17 | 0.55 |
| PF13426 | PAS_9 | 0.55 |
| PF13231 | PMT_2 | 0.55 |
| PF03544 | TonB_C | 0.55 |
| PF00076 | RRM_1 | 0.55 |
| PF13564 | DoxX_2 | 0.55 |
| PF01451 | LMWPc | 0.55 |
| COG ID | Name | Functional Category | % Frequency in 183 Family Scaffolds |
|---|---|---|---|
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 4.92 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.19 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.55 |
| COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 0.55 |
| COG0791 | Cell wall-associated hydrolase, NlpC_P60 family | Cell wall/membrane/envelope biogenesis [M] | 0.55 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.55 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.80 % |
| Unclassified | root | N/A | 8.20 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000878|AL9A1W_1132263 | All Organisms → cellular organisms → Bacteria | 1714 | Open in IMG/M |
| 3300001593|JGI12635J15846_10053578 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3061 | Open in IMG/M |
| 3300002347|JGIcombinedJ26865_1040038 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 744 | Open in IMG/M |
| 3300004606|Ga0068962_1003086 | Not Available | 1920 | Open in IMG/M |
| 3300004631|Ga0058899_12117358 | Not Available | 2263 | Open in IMG/M |
| 3300004633|Ga0066395_10725864 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
| 3300005173|Ga0066822_1004895 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 745 | Open in IMG/M |
| 3300005181|Ga0066678_10191629 | Not Available | 1302 | Open in IMG/M |
| 3300005332|Ga0066388_100057983 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4066 | Open in IMG/M |
| 3300005332|Ga0066388_107815802 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 535 | Open in IMG/M |
| 3300005436|Ga0070713_100681762 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 980 | Open in IMG/M |
| 3300005552|Ga0066701_10498110 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 754 | Open in IMG/M |
| 3300005554|Ga0066661_10510376 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidisarcina → Acidisarcina polymorpha | 725 | Open in IMG/M |
| 3300005878|Ga0075297_1001310 | All Organisms → Viruses → Predicted Viral | 1747 | Open in IMG/M |
| 3300005950|Ga0066787_10114880 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
| 3300006028|Ga0070717_10162758 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1936 | Open in IMG/M |
| 3300006052|Ga0075029_100471353 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300006059|Ga0075017_100443990 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300006163|Ga0070715_10997102 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300006854|Ga0075425_102995858 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300009826|Ga0123355_10023454 | All Organisms → cellular organisms → Bacteria | 9910 | Open in IMG/M |
| 3300009839|Ga0116223_10071715 | All Organisms → cellular organisms → Bacteria | 2221 | Open in IMG/M |
| 3300010046|Ga0126384_12490366 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300010048|Ga0126373_10550714 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1201 | Open in IMG/M |
| 3300010048|Ga0126373_11675133 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 700 | Open in IMG/M |
| 3300010086|Ga0127496_1073750 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidisarcina → Acidisarcina polymorpha | 670 | Open in IMG/M |
| 3300010108|Ga0127474_1017425 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidisarcina → Acidisarcina polymorpha | 704 | Open in IMG/M |
| 3300010136|Ga0127447_1061329 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 916 | Open in IMG/M |
| 3300010358|Ga0126370_11236352 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 696 | Open in IMG/M |
| 3300010360|Ga0126372_10297447 | Not Available | 1416 | Open in IMG/M |
| 3300010361|Ga0126378_10157300 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2320 | Open in IMG/M |
| 3300010361|Ga0126378_10764704 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
| 3300010361|Ga0126378_11363353 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300010366|Ga0126379_10024156 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR10 | 4625 | Open in IMG/M |
| 3300010366|Ga0126379_11940506 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 692 | Open in IMG/M |
| 3300010376|Ga0126381_100031465 | All Organisms → cellular organisms → Bacteria | 6333 | Open in IMG/M |
| 3300010376|Ga0126381_100294678 | All Organisms → cellular organisms → Bacteria | 2219 | Open in IMG/M |
| 3300010376|Ga0126381_100727292 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1421 | Open in IMG/M |
| 3300010398|Ga0126383_12553434 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300010862|Ga0126348_1155609 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 710 | Open in IMG/M |
| 3300010864|Ga0126357_1224717 | All Organisms → Viruses → Predicted Viral | 1073 | Open in IMG/M |
| 3300011064|Ga0138525_1000657 | Not Available | 1973 | Open in IMG/M |
| 3300011076|Ga0138574_1031072 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300011087|Ga0138570_1036449 | Not Available | 2152 | Open in IMG/M |
| 3300011120|Ga0150983_10713739 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300012096|Ga0137389_11265210 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
| 3300012376|Ga0134032_1051725 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidisarcina → Acidisarcina polymorpha | 695 | Open in IMG/M |
| 3300012389|Ga0134040_1110920 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 705 | Open in IMG/M |
| 3300012397|Ga0134056_1167663 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidisarcina → Acidisarcina polymorpha | 786 | Open in IMG/M |
| 3300012582|Ga0137358_10049186 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2806 | Open in IMG/M |
| 3300012923|Ga0137359_10235225 | All Organisms → cellular organisms → Bacteria | 1635 | Open in IMG/M |
| 3300012971|Ga0126369_12802439 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300012989|Ga0164305_12228502 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300014492|Ga0182013_10318447 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 865 | Open in IMG/M |
| 3300014493|Ga0182016_10104815 | All Organisms → cellular organisms → Bacteria | 1994 | Open in IMG/M |
| 3300014494|Ga0182017_10855783 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300014498|Ga0182019_10358120 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300014502|Ga0182021_12287579 | Not Available | 650 | Open in IMG/M |
| 3300014838|Ga0182030_10791495 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 869 | Open in IMG/M |
| 3300015193|Ga0167668_1012083 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1945 | Open in IMG/M |
| 3300015357|Ga0134072_10475248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300015374|Ga0132255_102253410 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 831 | Open in IMG/M |
| 3300016270|Ga0182036_10624429 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 866 | Open in IMG/M |
| 3300016341|Ga0182035_11668165 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
| 3300016445|Ga0182038_11729205 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
| 3300017823|Ga0187818_10094841 | All Organisms → cellular organisms → Bacteria | 1290 | Open in IMG/M |
| 3300017943|Ga0187819_10299238 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 935 | Open in IMG/M |
| 3300017943|Ga0187819_10541132 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 662 | Open in IMG/M |
| 3300017943|Ga0187819_10831510 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300017955|Ga0187817_10166026 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1405 | Open in IMG/M |
| 3300017966|Ga0187776_10332025 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300017970|Ga0187783_10179719 | All Organisms → cellular organisms → Bacteria | 1557 | Open in IMG/M |
| 3300017995|Ga0187816_10076533 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1422 | Open in IMG/M |
| 3300017995|Ga0187816_10278939 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 731 | Open in IMG/M |
| 3300018085|Ga0187772_10456541 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 896 | Open in IMG/M |
| 3300018086|Ga0187769_10817028 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 705 | Open in IMG/M |
| 3300018468|Ga0066662_10058854 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2500 | Open in IMG/M |
| 3300019265|Ga0187792_1622890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 688 | Open in IMG/M |
| 3300019278|Ga0187800_1351331 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidisarcina → Acidisarcina polymorpha | 504 | Open in IMG/M |
| 3300019870|Ga0193746_1001210 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1978 | Open in IMG/M |
| 3300019890|Ga0193728_1150010 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1026 | Open in IMG/M |
| 3300020012|Ga0193732_1006000 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2124 | Open in IMG/M |
| 3300020199|Ga0179592_10022807 | All Organisms → cellular organisms → Bacteria | 2795 | Open in IMG/M |
| 3300021401|Ga0210393_11228147 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300021560|Ga0126371_10054147 | All Organisms → cellular organisms → Bacteria | 3847 | Open in IMG/M |
| 3300021560|Ga0126371_11187022 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 900 | Open in IMG/M |
| 3300021560|Ga0126371_13928857 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300024179|Ga0247695_1004397 | All Organisms → cellular organisms → Bacteria | 2033 | Open in IMG/M |
| 3300024182|Ga0247669_1033824 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 860 | Open in IMG/M |
| 3300024222|Ga0247691_1047571 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 649 | Open in IMG/M |
| 3300024287|Ga0247690_1003187 | All Organisms → cellular organisms → Bacteria | 2044 | Open in IMG/M |
| 3300024331|Ga0247668_1056488 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 795 | Open in IMG/M |
| 3300025427|Ga0208077_1024469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 861 | Open in IMG/M |
| 3300025905|Ga0207685_10003176 | All Organisms → cellular organisms → Bacteria | 3945 | Open in IMG/M |
| 3300025906|Ga0207699_10665304 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 761 | Open in IMG/M |
| 3300025915|Ga0207693_10421030 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1044 | Open in IMG/M |
| 3300025929|Ga0207664_11076338 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300026855|Ga0208404_1001746 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 773 | Open in IMG/M |
| 3300026995|Ga0208761_1013097 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidisarcina → Acidisarcina polymorpha | 732 | Open in IMG/M |
| 3300027326|Ga0209731_1041197 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300027502|Ga0209622_1024294 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
| 3300027523|Ga0208890_1015979 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1045 | Open in IMG/M |
| 3300027560|Ga0207981_1050957 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidisarcina → Acidisarcina polymorpha | 756 | Open in IMG/M |
| 3300027576|Ga0209003_1000495 | All Organisms → cellular organisms → Bacteria | 3633 | Open in IMG/M |
| 3300027676|Ga0209333_1005513 | All Organisms → cellular organisms → Bacteria | 4335 | Open in IMG/M |
| 3300027698|Ga0209446_1185009 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidisarcina → Acidisarcina polymorpha | 536 | Open in IMG/M |
| 3300027821|Ga0209811_10010389 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2988 | Open in IMG/M |
| 3300027846|Ga0209180_10039137 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2583 | Open in IMG/M |
| 3300027875|Ga0209283_10343220 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 981 | Open in IMG/M |
| 3300027882|Ga0209590_10069585 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2023 | Open in IMG/M |
| 3300027905|Ga0209415_11056117 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300028138|Ga0247684_1036154 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300028736|Ga0302214_1060947 | Not Available | 777 | Open in IMG/M |
| 3300028748|Ga0302156_10058768 | All Organisms → cellular organisms → Bacteria | 2049 | Open in IMG/M |
| 3300028766|Ga0302269_1033954 | All Organisms → cellular organisms → Bacteria | 1643 | Open in IMG/M |
| 3300028769|Ga0302213_1095695 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300028769|Ga0302213_1125431 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 703 | Open in IMG/M |
| 3300028772|Ga0302209_10051144 | Not Available | 1221 | Open in IMG/M |
| 3300028777|Ga0302290_10008865 | Not Available | 2418 | Open in IMG/M |
| 3300028779|Ga0302266_10078549 | All Organisms → cellular organisms → Bacteria | 1392 | Open in IMG/M |
| 3300028864|Ga0302215_10242565 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 678 | Open in IMG/M |
| 3300028869|Ga0302263_10169938 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 869 | Open in IMG/M |
| 3300028873|Ga0302197_10064066 | All Organisms → cellular organisms → Bacteria | 1973 | Open in IMG/M |
| 3300029995|Ga0302210_10023641 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1896 | Open in IMG/M |
| 3300030002|Ga0311350_10030004 | All Organisms → cellular organisms → Bacteria | 4730 | Open in IMG/M |
| 3300030002|Ga0311350_10849723 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 817 | Open in IMG/M |
| 3300030339|Ga0311360_11577093 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300030575|Ga0210288_1128936 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 650 | Open in IMG/M |
| 3300030581|Ga0210270_1048815 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 705 | Open in IMG/M |
| 3300030598|Ga0210287_1186995 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300030685|Ga0302285_10090505 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1123 | Open in IMG/M |
| 3300031170|Ga0307498_10014138 | All Organisms → Viruses → Predicted Viral | 1682 | Open in IMG/M |
| 3300031244|Ga0302297_1033713 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 980 | Open in IMG/M |
| 3300031421|Ga0308194_10020535 | All Organisms → cellular organisms → Bacteria | 1439 | Open in IMG/M |
| 3300031521|Ga0311364_12415399 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300031679|Ga0318561_10393086 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 761 | Open in IMG/M |
| 3300031713|Ga0318496_10779254 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300031718|Ga0307474_10092622 | All Organisms → cellular organisms → Bacteria | 2256 | Open in IMG/M |
| 3300031718|Ga0307474_11385791 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300031736|Ga0318501_10189668 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
| 3300031747|Ga0318502_10453915 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 765 | Open in IMG/M |
| 3300031748|Ga0318492_10345176 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 778 | Open in IMG/M |
| 3300031777|Ga0318543_10118833 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
| 3300031777|Ga0318543_10272097 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 756 | Open in IMG/M |
| 3300031781|Ga0318547_10389187 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidisarcina → Acidisarcina polymorpha | 855 | Open in IMG/M |
| 3300031793|Ga0318548_10325730 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 754 | Open in IMG/M |
| 3300031797|Ga0318550_10036078 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2157 | Open in IMG/M |
| 3300031805|Ga0318497_10366004 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 805 | Open in IMG/M |
| 3300031819|Ga0318568_10381836 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 877 | Open in IMG/M |
| 3300031831|Ga0318564_10198005 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 894 | Open in IMG/M |
| 3300031833|Ga0310917_10219171 | Not Available | 1275 | Open in IMG/M |
| 3300031833|Ga0310917_10602370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 746 | Open in IMG/M |
| 3300031835|Ga0318517_10251686 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 797 | Open in IMG/M |
| 3300031845|Ga0318511_10277875 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 754 | Open in IMG/M |
| 3300031860|Ga0318495_10162699 | All Organisms → Viruses → Predicted Viral | 1006 | Open in IMG/M |
| 3300031880|Ga0318544_10177025 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 821 | Open in IMG/M |
| 3300031896|Ga0318551_10423596 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 758 | Open in IMG/M |
| 3300031896|Ga0318551_10892378 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300031897|Ga0318520_10386680 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 853 | Open in IMG/M |
| 3300031902|Ga0302322_102081783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 697 | Open in IMG/M |
| 3300031947|Ga0310909_11643086 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidisarcina → Acidisarcina polymorpha | 508 | Open in IMG/M |
| 3300031954|Ga0306926_10814287 | All Organisms → cellular organisms → Bacteria | 1124 | Open in IMG/M |
| 3300031962|Ga0307479_10053105 | All Organisms → cellular organisms → Bacteria | 3900 | Open in IMG/M |
| 3300032001|Ga0306922_10175372 | Not Available | 2297 | Open in IMG/M |
| 3300032009|Ga0318563_10124341 | Not Available | 1375 | Open in IMG/M |
| 3300032025|Ga0318507_10340263 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 653 | Open in IMG/M |
| 3300032035|Ga0310911_10425692 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 768 | Open in IMG/M |
| 3300032035|Ga0310911_10527097 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 685 | Open in IMG/M |
| 3300032042|Ga0318545_10024482 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1943 | Open in IMG/M |
| 3300032052|Ga0318506_10250421 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 784 | Open in IMG/M |
| 3300032054|Ga0318570_10298313 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 732 | Open in IMG/M |
| 3300032067|Ga0318524_10282860 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 856 | Open in IMG/M |
| 3300032160|Ga0311301_10076440 | Not Available | 6956 | Open in IMG/M |
| 3300032174|Ga0307470_10123092 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Frigoriglobus → Frigoriglobus tundricola | 1535 | Open in IMG/M |
| 3300032180|Ga0307471_100229764 | All Organisms → Viruses → Predicted Viral | 1888 | Open in IMG/M |
| 3300032180|Ga0307471_100405821 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1491 | Open in IMG/M |
| 3300032205|Ga0307472_100993687 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Frigoriglobus → Frigoriglobus tundricola | 785 | Open in IMG/M |
| 3300032261|Ga0306920_100619391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1600 | Open in IMG/M |
| 3300032261|Ga0306920_101480266 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
| 3300033289|Ga0310914_10589861 | All Organisms → Viruses → Predicted Viral | 1002 | Open in IMG/M |
| 3300033289|Ga0310914_11524449 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300033433|Ga0326726_11201642 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidisarcina → Acidisarcina polymorpha | 737 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 24.04% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.84% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 7.65% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.83% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.83% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.83% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.83% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.28% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.28% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.73% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.73% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.64% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.64% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.64% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.64% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.09% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.09% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.09% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.09% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.55% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.55% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.55% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.55% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.55% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.55% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.55% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.55% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.55% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.55% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.55% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.55% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000878 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-5 cm-9A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002347 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-072012 (NGEE Surface samples 415 (1, 2, 3 deep-072012) AP id is 1030520, ASSEMBLY_DATE=20131219) | Environmental | Open in IMG/M |
| 3300004606 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 54 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005173 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMA | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005878 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_104 | Environmental | Open in IMG/M |
| 3300005950 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010086 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010108 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010136 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010862 | Boreal forest soil eukaryotic communities from Alaska, USA - C4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010864 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011064 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 2 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011076 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 59 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011087 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 55 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012376 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012389 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012397 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014492 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014494 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaG | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019265 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019870 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m1 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020012 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s1 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024179 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36 | Environmental | Open in IMG/M |
| 3300024182 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK10 | Environmental | Open in IMG/M |
| 3300024222 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK32 | Environmental | Open in IMG/M |
| 3300024287 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK31 | Environmental | Open in IMG/M |
| 3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
| 3300025427 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026855 | Soil and rhizosphere microbial communities from Laval, Canada - mgLMA (SPAdes) | Environmental | Open in IMG/M |
| 3300026995 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB (SPAdes) | Environmental | Open in IMG/M |
| 3300027326 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027502 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027523 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes) | Environmental | Open in IMG/M |
| 3300027560 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC (SPAdes) | Environmental | Open in IMG/M |
| 3300027576 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028138 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25 | Environmental | Open in IMG/M |
| 3300028736 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_3 | Environmental | Open in IMG/M |
| 3300028748 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028766 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_2 | Environmental | Open in IMG/M |
| 3300028769 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_1 | Environmental | Open in IMG/M |
| 3300028772 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_1 | Environmental | Open in IMG/M |
| 3300028777 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N1_3 | Environmental | Open in IMG/M |
| 3300028779 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_2 | Environmental | Open in IMG/M |
| 3300028864 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N3_1 | Environmental | Open in IMG/M |
| 3300028869 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_4 | Environmental | Open in IMG/M |
| 3300028873 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300029995 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_2 | Environmental | Open in IMG/M |
| 3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030339 | III_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030575 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE050SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030581 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO142-VCO031SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030598 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE048SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030685 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_2 | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031244 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_2 | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AL9A1W_11322633 | 3300000878 | Permafrost | LAVYGRHSDSLAINRHYTCAVERRWTTAGESPARELGSLHPEAIRAAVEETKPSEPLV* |
| JGI12635J15846_100535782 | 3300001593 | Forest Soil | VTLSDYFTCAVERRWTTAGESPARELGSLHPEAIRAAVEETKPSEPLV* |
| JGIcombinedJ26865_10400381 | 3300002347 | Arctic Peat Soil | YTCAVKRRWLTAGESPARELGSLHPEAIRAAAEETKPSEPLV* |
| Ga0068962_10030861 | 3300004606 | Peatlands Soil | DYACAVKRRWTTAGESPARELGSLHPEAIRAAVEETKPSEPLV* |
| Ga0058899_121173584 | 3300004631 | Forest Soil | FTCAVERRWMTAGESPARELGSLHPEAIRAAVEETKPSEPLV* |
| Ga0066395_107258641 | 3300004633 | Tropical Forest Soil | MILWLALNRHYTCAVKRRWSTAGESPARELGSLHPEAIGAAVEETKPS |
| Ga0066822_10048952 | 3300005173 | Soil | HYTCAVKRRWTTAGESPARELGSLHPEAIRAAAEETKPSEPLV* |
| Ga0066678_101916291 | 3300005181 | Soil | VRRERRWFTAGESPARELGSLHPEAIEAAAEATELSELSV* |
| Ga0066388_1000579831 | 3300005332 | Tropical Forest Soil | VKNLDYTCAVKRRWSTAGESPARELGSLHPEAIGAAVEETKPS |
| Ga0066388_1078158021 | 3300005332 | Tropical Forest Soil | MLGENPYITCAVKRRWSTAGESPARELGSLHPEAIGAAVEETKPSEP |
| Ga0070713_1006817621 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | YACAVKRRWSTAGESPARELGSLHPEAIRAAVEETKPSEPLV* |
| Ga0066701_104981101 | 3300005552 | Soil | ACAVKRRWSTAGESPARELGSLHPEAIGAAVEETKPSEPPV* |
| Ga0066661_105103761 | 3300005554 | Soil | CAVKRRWSTAGESPARELGSLHPEAIGAAVEETKPSEPPV* |
| Ga0075297_10013102 | 3300005878 | Rice Paddy Soil | TCAVKRRWSTAGESPARELGSLHPEAIGAAVEETKPSEPPVQRVT* |
| Ga0066787_101148803 | 3300005950 | Soil | MLAINRHSACAVERRWTTAGESPARELGSLHPEAIRAAVEETKPSEPLV* |
| Ga0070717_101627583 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | GESPARELGSLHPEAIRAAAEETKPSEPLVERVT* |
| Ga0075029_1004713532 | 3300006052 | Watersheds | TCAVKRRWSTAGESPARELGSLHPEAIGAAVEETKPSEPPV* |
| Ga0075017_1004439902 | 3300006059 | Watersheds | YACAVKRRWSTAGESPARELGSLHPEAIGAAVEETKPSEPPV* |
| Ga0070715_109971021 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | AVKRRWSTAGESPARELGSLHPEAIGAAVEETKPSEPPV* |
| Ga0075425_1029958582 | 3300006854 | Populus Rhizosphere | FTCAVKRRWSTAGESPARELGSLHPEAIGAAAEETKPSEPLV* |
| Ga0123355_1002345412 | 3300009826 | Termite Gut | MRNRDYTCAVERRWSTAGESPARELGSLHPEAIGVAVEETKPSEP |
| Ga0116223_100717153 | 3300009839 | Peatlands Soil | NRDYACAVKRRWTTAGESPARELGSLHPEAIRAAVEETKPSEPLV* |
| Ga0126384_124903662 | 3300010046 | Tropical Forest Soil | WTTAGESPARELGSLHPEAIRAAVEETKPSEPLVQRVT* |
| Ga0126373_105507143 | 3300010048 | Tropical Forest Soil | MLNPDYTCAVKRRWSTVGESPAWELGSLHPEAIGAAVEET |
| Ga0126373_116751332 | 3300010048 | Tropical Forest Soil | YTCAVKRRWSTAGESPARELGSLHPEAIGATVEETKPSEPPV* |
| Ga0127496_10737501 | 3300010086 | Grasslands Soil | RRWSTAGESPARELGSLHPEAIGAAVEETKPSEPPV* |
| Ga0127474_10174252 | 3300010108 | Grasslands Soil | CAVKRRWLTAGVSPARELGSLHPEAIGAAVEETKPSEPPV* |
| Ga0127447_10613291 | 3300010136 | Grasslands Soil | GDQFARNPDYTCAVKRRWSTAGESPARELGSLHPEAIGAAVEETKPSEPPV* |
| Ga0126370_112363521 | 3300010358 | Tropical Forest Soil | STCAVKRRWSTAGESPARELGSLHPEAIGAAVEETKPSEPPV* |
| Ga0126372_102974472 | 3300010360 | Tropical Forest Soil | LAMHLDYACAVKRRWSTAGESPARELGSLHPEAIRAAVEETKPSEPLVQRVT* |
| Ga0126378_101573001 | 3300010361 | Tropical Forest Soil | MLNPGYTCAVKRRWSTAGESPARELGSLHPEAIGAAVEETKPSEP |
| Ga0126378_107647041 | 3300010361 | Tropical Forest Soil | MVTVVYPKTIPQLAENRHDTCAVKRRWSTAGESPARELGSLHPEAIGAAVEETKPSEPP |
| Ga0126378_113633532 | 3300010361 | Tropical Forest Soil | AGESPARELGSLHPEAIGAAVEETKPSAPPVQTGA* |
| Ga0126379_100241561 | 3300010366 | Tropical Forest Soil | MILWLALNRHYTCAVKRRWSTAGESPARELGSLHPEAIGAAVEETKPSEPPV* |
| Ga0126379_119405061 | 3300010366 | Tropical Forest Soil | AVKRRWSTAGESPARELGSLHPEAIGATVEETKPSEPPV* |
| Ga0126381_1000314659 | 3300010376 | Tropical Forest Soil | MILWLALNRHYTCAVKRRWSTAGESPARELGSLHPEAI |
| Ga0126381_1002946781 | 3300010376 | Tropical Forest Soil | MTVANRDNTCAVKRRWSTAGESPARELGSLHPEAIGAAVE |
| Ga0126381_1007272922 | 3300010376 | Tropical Forest Soil | MLNPGYTCAVKRRWSTAGESPARELGSLHPEAIGAAVEETKPSE |
| Ga0126383_125534341 | 3300010398 | Tropical Forest Soil | RHWTTAGESPARELGSLHPEAIRAAVEETKPSEPLV* |
| Ga0126348_11556091 | 3300010862 | Boreal Forest Soil | VKRRWSTAGESPARELGSLHPEAIGAAAEETKPSEPLV* |
| Ga0126357_12247171 | 3300010864 | Boreal Forest Soil | VERRWTTAGESPARELGSLHPEAIRAAVKETKPSEPLV* |
| Ga0138525_10006571 | 3300011064 | Peatlands Soil | VKRRWTTAGESPARELGSLHPEAIRAAVEETKPSEPLV* |
| Ga0138574_10310721 | 3300011076 | Peatlands Soil | PDYTCAVKRRWTTAGESPARELGSLHPEAIRAAVEETKPSEPLV* |
| Ga0138570_10364492 | 3300011087 | Peatlands Soil | WALSEPPCRWLAINPDYTCAVKRRWTTAGESPARELGSLHPEAIRAAVEETKPSEPLV* |
| Ga0150983_107137391 | 3300011120 | Forest Soil | RWSTAGESPARELGSLHPEAIGAAVEETKPSEPPV* |
| Ga0137389_112652101 | 3300012096 | Vadose Zone Soil | LFPMPRRLLLKNPHYACAVKRRWSTAGESPARELGSLHPEAIGAAVEETKPSEP |
| Ga0134032_10517252 | 3300012376 | Grasslands Soil | TCAVKRHWLTAGESPARELGSLHPEAIGAAVEETKPSEPPV* |
| Ga0134040_11109201 | 3300012389 | Grasslands Soil | ERRWFTAGESPARELGSLHPEAIGAAVEETKPSEPPV* |
| Ga0134056_11676631 | 3300012397 | Grasslands Soil | VKRRWSTAGESPARELGSLHPEAIGAAVEETKPSEPPV* |
| Ga0137358_100491861 | 3300012582 | Vadose Zone Soil | CAVERRWTTAGESPARELGSLHPEAIRAAVEETKPSEPLV* |
| Ga0137359_102352251 | 3300012923 | Vadose Zone Soil | HNACAVERRWTTAGESPARELGSLHPEAIRAAVEETKPSEPLV* |
| Ga0126369_128024391 | 3300012971 | Tropical Forest Soil | CAVERHWTTAGESPARELGSLHPEAIRAAVEETKPSEPLV* |
| Ga0164305_122285021 | 3300012989 | Soil | MTNVELGYRHGILGVNRDSTCAGKRRWSTAGESPARELGSLHPEAIGAAVEETKP |
| Ga0182013_103184471 | 3300014492 | Bog | MMESINRNYTCAVERRWTTAGESPARELGSLHPEAIRAAAEETKPSEP |
| Ga0182016_101048152 | 3300014493 | Bog | YTCAVERRWTTAGESPARELGSLHPEAIRAAVEETKPSEPLV* |
| Ga0182017_108557831 | 3300014494 | Fen | INPDYTCAVERRWTTAGESPARELGSLHPEAIRAAAEETKPSEPLV* |
| Ga0182019_103581202 | 3300014498 | Fen | HFACAVKRRWLTAGESPARELGSLHPEAIGAAVEETKPSEPPV* |
| Ga0182021_122875791 | 3300014502 | Fen | CAVKRRWLTAGESPARELGSLHPEAIGAAVEETKPSEPPV* |
| Ga0182030_107914951 | 3300014838 | Bog | MMESINRNYTCAVERRWTTAGESPARELGSLHPEAIRAAAEETKPSEPL |
| Ga0167668_10120833 | 3300015193 | Glacier Forefield Soil | VKNLHNACAVKRRWSTAGESPARELGSLHPEAIGAAVEE |
| Ga0134072_104752481 | 3300015357 | Grasslands Soil | WSTAGESPARELGSLHPEAIGAAVEETKPSEPPV* |
| Ga0132255_1022534101 | 3300015374 | Arabidopsis Rhizosphere | MRTQRLQNPDFACAVERHWTTAGESPARELGSLHPVAIRAAAEE |
| Ga0182036_106244291 | 3300016270 | Soil | VTKNRYFTCAVKRRWLTAGESPARELGSLHPEAIGAAVEKTKPSEPL |
| Ga0182035_116681651 | 3300016341 | Soil | LELIVDQIGDSACAMKRRCSTAGESPARELASLHPEAIGAAVEEMKPSEPPVYRVRKSL |
| Ga0182038_117292051 | 3300016445 | Soil | MLNLDYTCAVKRRWLTAGESPARELGSLHPEAIGAAVEKTKPSEP |
| Ga0187818_100948411 | 3300017823 | Freshwater Sediment | NRDFACAVKRRWSTAGESPARELGSLHPEAIGAAVEETKPSEPLV |
| Ga0187819_102992381 | 3300017943 | Freshwater Sediment | AVKRRWSTAGESPARELGSLHPEAIGAAVEETKPSEPLVQRVT |
| Ga0187819_105411321 | 3300017943 | Freshwater Sediment | LALNRDNACAVKRRWSTAGESPARELGSLHPEAIGAAVEETK |
| Ga0187819_108315101 | 3300017943 | Freshwater Sediment | MSGFETEPFERLLSLNRDYTCAVKRRWSTAGESPARELGSLHPEAIGAAVEET |
| Ga0187817_101660262 | 3300017955 | Freshwater Sediment | MQFDYTYPAQLTINRHSTCAVKRRWSTAGESPARELGSLHPEAIGAAVEETKPS |
| Ga0187776_103320251 | 3300017966 | Tropical Peatland | CAVTRRWSTAGESPARELGSLHPEAIGAAVEETKPSEPPV |
| Ga0187783_101797191 | 3300017970 | Tropical Peatland | RRWTTAGESPARELGSLHPEAIRAAVKETKPLEPLV |
| Ga0187816_100765331 | 3300017995 | Freshwater Sediment | TCAVKRHWSTAGESPARELGSLHPEAIGAAVEETKSSEPPV |
| Ga0187816_102789391 | 3300017995 | Freshwater Sediment | YTCAVKRRWSTAGESPARELGSLHPEAIGAAVEETKPSEPPV |
| Ga0187772_104565413 | 3300018085 | Tropical Peatland | TCAVKRRWSTAGESPARELGSLHPEAIGAAVEETKPSEPPV |
| Ga0187769_108170282 | 3300018086 | Tropical Peatland | CAVKRRWSTAGESPARELGSLHPEAIGAAVEETKPSEPPVQRVT |
| Ga0066662_100588541 | 3300018468 | Grasslands Soil | VRQAQLLLNPHRACAVKRRWSTAGESRAWGLGSRHPEAIGAAVEKTNPPEPAVA |
| Ga0187792_16228901 | 3300019265 | Peatland | RRWSTAGESPARELGSLHPEAIGAAVEETKPSEPPV |
| Ga0187800_13513311 | 3300019278 | Peatland | NTQSVEISLLKTGDFTCAVERRWTTAGESPARELGSLHPEAIRAAAEETKPSEPLVKRVT |
| Ga0193746_10012103 | 3300019870 | Soil | PHYTCAVKRRWSTAGESPARELGSLHPEAIGAAVEETKPSEPPV |
| Ga0193728_11500101 | 3300019890 | Soil | GTCAVERRWTTAGESPARELGSLHPEAIRAAVEETKPSEPLV |
| Ga0193732_10060001 | 3300020012 | Soil | NACAVKRRWSTAGESPARELGSLHPEAIGAAVEETKPSEPPV |
| Ga0179592_100228074 | 3300020199 | Vadose Zone Soil | RRSACAVERRWTTAGESPARELGSLHPEAIRAAVEETKPSEPLV |
| Ga0210393_112281472 | 3300021401 | Soil | RWTTAGESPARELGSLHPEAIRAAAEETKPSEPLV |
| Ga0126371_100541477 | 3300021560 | Tropical Forest Soil | MILWLALNRHYTCAVKRRWSTAGESPARELGSLHPEAIGAAVEETKPSEP |
| Ga0126371_111870222 | 3300021560 | Tropical Forest Soil | CAVKRRWSTAGESPARELGSLHPEAIGAAAEETKPSEPPV |
| Ga0126371_139288571 | 3300021560 | Tropical Forest Soil | MVKNLDSTCAVKRRWSTAGESPARELGSLHPEAIGAAVEETK |
| Ga0247695_10043971 | 3300024179 | Soil | HYTCAVKRRWSTAGESPARELGSLHPEAIGAAAEETKPSEPLV |
| Ga0247669_10338241 | 3300024182 | Soil | RYACAVKRHWLTAGVSPARELGSLHPEAIGAAVEETKPSEPPV |
| Ga0247691_10475712 | 3300024222 | Soil | RWSTAGESPARELGSLHPEAIRAAVEETKPSEPLV |
| Ga0247690_10031873 | 3300024287 | Soil | NPDCTCAVKRRWSTAGESPARELGSLHPEAIGAAAEETKPSEPLV |
| Ga0247668_10447861 | 3300024331 | Soil | AKATAPVLDSTPHYACAVKRRGSTAGESPARELGSLHPEAIRAAVEETKPSEPLV |
| Ga0247668_10564881 | 3300024331 | Soil | RACTCAVKRHWLTAGVSPARELGSLHPEAIGAAVEETKPSEPPV |
| Ga0208077_10244691 | 3300025427 | Arctic Peat Soil | VCAVKRRWLTAGESPARELGSLHPEAIGAAVEETKPSEPLV |
| Ga0207685_100031763 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTQRLQNPDFACAVERHWTTAGESPARELGSLHPEAIRAAAEETKPSEPLVERVT |
| Ga0207699_106653041 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | YRHYTCAVKRHWLTAGVSPARELGSLHPEAIGAAVEETKPSEPPV |
| Ga0207693_104210302 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | TAGESPARELGSLHPEAIRAAVEETKPSEPLVERVT |
| Ga0207664_110763381 | 3300025929 | Agricultural Soil | HFTCAVKRRWSTAGESPARELGSLHPEAIGAAVEETKPSEPLV |
| Ga0208404_10017462 | 3300026855 | Soil | LAINPHYACAVKRRWTTAGESPARELGSLHPEAIRAAAEETKPSEPLV |
| Ga0208761_10130972 | 3300026995 | Soil | NPHSTCAVERHWTTAGESPARELGSLHPEAIRAAVEETKPSEPLVQRVT |
| Ga0209731_10411971 | 3300027326 | Forest Soil | IANYACAVERRWTTAGESPARELGSLHPEAIRAAAEETKPSEPLV |
| Ga0209622_10242943 | 3300027502 | Forest Soil | SAVERRWSTAGESPARELGSLHPEAIRAAVEETKPSEPLV |
| Ga0208890_10159792 | 3300027523 | Soil | HKATTVGRQLSQNLDYTCAVKRRWTTAGESPARELGPLHPEAIRAAAEETKPSEPLV |
| Ga0207981_10509571 | 3300027560 | Soil | VKRRWTTAGESPARELGSLHPEAIRAAAEETKPSEPLV |
| Ga0209003_10004953 | 3300027576 | Forest Soil | HYTCAVKRRWSTAGESPARELGSLHPEAIGAAVEETKPSEPPV |
| Ga0209333_10055134 | 3300027676 | Forest Soil | IGRRDTYVRPLLAINRHNTCAVERRWTTAGESPARELGSLHPEAIRAAVEETKPSEPLV |
| Ga0209446_11850091 | 3300027698 | Bog Forest Soil | VKRRWSTAGESPARELGSLHPEAIGAAVEETKPSEPPV |
| Ga0209811_100103894 | 3300027821 | Surface Soil | YLHYTCAVERHWTTAGESPARELGSLHPEAIRAAVEETKPSEPLVERVT |
| Ga0209180_100391374 | 3300027846 | Vadose Zone Soil | CDFALLLQNPHYTCAVKRRWSTAGESPARELGSLHPEAIGAAVEETKPSEPPV |
| Ga0209283_103432201 | 3300027875 | Vadose Zone Soil | SQLAINPHFTCAVKRRWSTAGESPARELGSLHPEAIGAAVEETKPSEPPV |
| Ga0209590_100695853 | 3300027882 | Vadose Zone Soil | CAVKRRWSTAGESPARELGSLHPEAIGAAVEETKPSEPPV |
| Ga0209415_110561171 | 3300027905 | Peatlands Soil | CAVKRRWTTAGESPARELGSLHPEAIRAAVEETKPSEPLV |
| Ga0247684_10361541 | 3300028138 | Soil | SYSHQVLINPDYACAVKRRWSTAGESPARELGSLHPEAIGAAAEETKPSEPLV |
| Ga0302214_10609471 | 3300028736 | Fen | LAKNPNYTCAVKRRWLTAGESPARELGSLHPEAIRAAAEETKPSEPLV |
| Ga0302156_100587682 | 3300028748 | Bog | PGDYTCAVERRWTTAGESPARELGSLHPEAIRAAVEETKPSEPLV |
| Ga0302269_10339541 | 3300028766 | Bog | DYTCAVERRWTTAGESPARELGSLHPEAIRAAVEETKPSEPLV |
| Ga0302213_10956951 | 3300028769 | Fen | PCAVKRRWLTAGESPARELGSLHPEAIRAAVEETKPSEPPV |
| Ga0302213_11254311 | 3300028769 | Fen | RLLALNLDYTCAVKRRWLTAGESPARELGSLHPEAIRAAAEETKPSEPLV |
| Ga0302209_100511441 | 3300028772 | Fen | RWLTAGESPARELGSLHPEAIGAAVEETKPSEPPV |
| Ga0302290_100088651 | 3300028777 | Fen | HCACAVKRRWLTAGESPARELGSLHPEAIGAAVEETKPSEPPV |
| Ga0302266_100785492 | 3300028779 | Bog | YTCAVERRWTTAGESPARELGSLHPEAIRAAVEETKPSEPLV |
| Ga0302215_102425651 | 3300028864 | Fen | DYTCAVKRRWLTAGGSPARELGSLHPEAIRAAAEETKPSEPLV |
| Ga0302263_101699381 | 3300028869 | Fen | PRPCAVKRRWLTAGESPARELGSLHPEAIRAAAEETKPSEPLV |
| Ga0302197_100640662 | 3300028873 | Bog | GDYTCAVERRWTTAGESPARELGSLHPEAIRAAVEETKPSEPLV |
| Ga0302210_100236413 | 3300029995 | Fen | AINPDYTCAVKRRWLTAGESPARELGSLHPEAIRAAAEETKPSEPLV |
| Ga0311350_100300044 | 3300030002 | Fen | CAVKRRWLTAGESPARELGSLHPEAIGAAVEETKPSEPPV |
| Ga0311350_108497231 | 3300030002 | Fen | DYTCAVKRRWLTAGESPARELGSLHPEAIRAAAEETKPSEPLV |
| Ga0311360_115770931 | 3300030339 | Bog | YPLLAKNPDYTCAVKRRWLTAGESPARELGSLHPEAIRAAAEETKPSEPLV |
| Ga0210288_11289361 | 3300030575 | Soil | DFTCAVERRWTTAGESPARELGSLHPEAIRAAAEETKPSEPLV |
| Ga0210270_10488151 | 3300030581 | Soil | HSACAVERRWTTAGESPARELGSLHPEAIRAAAEETKPSEPLV |
| Ga0210287_11869952 | 3300030598 | Soil | LVERRWTTAGESPARELGSLHPEAIRAAAEETKPSEPLV |
| Ga0302285_100905051 | 3300030685 | Fen | ERRWTTAGESPARELGSLHPEAIGAAVEETKPSEPLV |
| Ga0307498_100141383 | 3300031170 | Soil | AVKRRWTTAGESPARELGSLHPEAIRAAVEETKPSEPLV |
| Ga0302297_10337131 | 3300031244 | Fen | RCTCAVKRRWLTAGESPARELGSLHPEAIRAAAEETKPSEPLV |
| Ga0308194_100205352 | 3300031421 | Soil | RWTTAGESPARELGSLHPEAIRAAGEETKPSEPLV |
| Ga0311364_124153991 | 3300031521 | Fen | VRLLALNLDYTCAVKRRWLTAGESPARELGSLHPEAIRAAAEETKPSEPL |
| Ga0318561_103930861 | 3300031679 | Soil | LTINPYFTCAVKRRWLTAGESPARELGSLHPEAIGAAVEKTKPSEPLV |
| Ga0318496_107792542 | 3300031713 | Soil | RWSTAGESPARELGSLHPEAIGAAAEETKPSEPPV |
| Ga0307474_100926221 | 3300031718 | Hardwood Forest Soil | FTCAVERRWTTAGESPARELGSLHPEAIRAAVEETKPSEPLV |
| Ga0307474_113857911 | 3300031718 | Hardwood Forest Soil | AVKRHWLTAGESPARELGSLHPQAIGAAVEETKPSEPPV |
| Ga0318501_101896682 | 3300031736 | Soil | LLLNPDYTCAVKRRWSTAGESPARELGSLHPEAIGAAVEETKPSEPPV |
| Ga0318502_104539152 | 3300031747 | Soil | LMLNLDYTCAVKRRWLTAGESPARELGSLHPEAIGAAVEKTKPSEPLV |
| Ga0318492_103451761 | 3300031748 | Soil | HPHYTCAVKRRWLTAGESPARELGSLHPEAIGAAVEKTKPSEPLV |
| Ga0318543_101188331 | 3300031777 | Soil | LAKNLYYTCAVERCWSTAGESPARELGSLHPEAIGVMVEETKPSEPPV |
| Ga0318543_102720971 | 3300031777 | Soil | NYTCAVKRRWLTAGESPARELGSLHPEAIGAAVEKTKPSEPLV |
| Ga0318547_103891871 | 3300031781 | Soil | LSKNPNYTCAVKRRWSTVGESPARELGSLHPEAIGAAAEETKPSEPPV |
| Ga0318548_103257301 | 3300031793 | Soil | ACAVKRRWLTAGESPARELGSLHPEAIGAAVEKTKPSEPLV |
| Ga0318550_100360783 | 3300031797 | Soil | HNACAVKRRWSTAGESPARELGSLHPEAIGAAAEETKPSEPPV |
| Ga0318497_103660042 | 3300031805 | Soil | DHLINPHCTCAVKRRWLTAGESPARELGSLHPEAIGAAVEKTKPSEPLV |
| Ga0318568_103818363 | 3300031819 | Soil | INPHCTCAVKRRWLTAGESPARELGSLHPEAIGAAVEKTKPSEPLV |
| Ga0318564_101980051 | 3300031831 | Soil | TCAVKRRWLTAGESPARELGSLHPEAIGAAVEKTKPSEPLV |
| Ga0310917_102191711 | 3300031833 | Soil | VVKNRNFTCAVERCWSTAGESPARELGSLHPEAIGVMVEETKPSEPPV |
| Ga0310917_106023701 | 3300031833 | Soil | MLNLDYTCAVKRRWLTAGESPARELGSLHPEAIGAAVEKTKPSE |
| Ga0318517_102516862 | 3300031835 | Soil | LAKHPRYTCAVKRRWLTAGESPARELGSLHPEAIGAAVEKTKPSEPLV |
| Ga0318511_102778751 | 3300031845 | Soil | YTCAVKRRWLTAGESPARELGSLHPEAIGAAVEKTKPSEPLV |
| Ga0318495_101626991 | 3300031860 | Soil | LDSTCAVERCWSTAGESPARELGSLHPEAIGVMVEETKPSEPPV |
| Ga0318544_101770252 | 3300031880 | Soil | QLVKNRDCTCAVKRRWLTAGESPARELGSLHPEAIGAAVEKTKPSEPLV |
| Ga0318551_104235962 | 3300031896 | Soil | NRHYTCAVKRRWLTAGESPARELGSLHPEAIGAAVEKTKPSEPLV |
| Ga0318551_108923781 | 3300031896 | Soil | DVIGDNACAVKRRWTTAGENPARELGSLHPEAIRAAVEETKPSEPLV |
| Ga0318520_103866801 | 3300031897 | Soil | CAVKRRWLTAGESPARELGSLHPEAIGAAVEKTKPSEPLV |
| Ga0302322_1020817831 | 3300031902 | Fen | YTCAVKRRWLTAGESPARELGSLHPEAIRAAAEETKPSEPLV |
| Ga0310909_116430861 | 3300031947 | Soil | CAVKRRWSTVGESPARELGSLHPEAIGAAVEETKPSEPPV |
| Ga0306926_108142872 | 3300031954 | Soil | CAVERCWSTAGESPARELGSLHPEAIGVMVEETKPSEPPV |
| Ga0307479_100531054 | 3300031962 | Hardwood Forest Soil | MLYQLAKNPHYPCAVERRWTTAGESPARELGSLHPEAIRAAVEETKPLV |
| Ga0306922_101753721 | 3300032001 | Soil | LHPHNACAVKRRWSTAGESPARELGSLHPEAIGAAVEETKPSEPPV |
| Ga0318563_101243411 | 3300032009 | Soil | HYTCAVERCWSTAGESPARELGSLHPEAIGVMVEETKPSEPPV |
| Ga0318507_103402632 | 3300032025 | Soil | VKRRWSTAGESPARELGSLHPEAIGAAAEETKPSEPPV |
| Ga0310911_104256922 | 3300032035 | Soil | TPHYTCAVKRRWLTAGESPARELGSLHPEAIGAAVEKTKPSEPLV |
| Ga0310911_105270971 | 3300032035 | Soil | MRVLGSFANIVDVIGDNACAVKRRWTTAGENPARELGSLHPEAIRAAVEETKPSEPLV |
| Ga0318545_100244821 | 3300032042 | Soil | YYACAVKRRWSTAGESPARELGSLHPEAIGAAAEETKPSEPPV |
| Ga0318506_102504211 | 3300032052 | Soil | VVKNRNFTCAVKRRWLTAGESPARELGSLHPEAIGAAVEKTKPSEPLV |
| Ga0318570_102983131 | 3300032054 | Soil | KRRWLTAGESPARELGSLHPEAIGAAVEKTKPSEPLV |
| Ga0318524_102828601 | 3300032067 | Soil | GQNTAISQLTQNRDRTCAVKRRWLTAGESPARELGSLHPEAIGAAVEKTKPSEPLV |
| Ga0311301_1007644012 | 3300032160 | Peatlands Soil | GLDSVYTCAVKRHWSTAGESPARELGSLHPEAIGAAAEETKPSEPPV |
| Ga0307470_101230921 | 3300032174 | Hardwood Forest Soil | NRHYTCAVKRRWSTAGESPARELGSLHPEAIGAAVEETKPSEPPV |
| Ga0307471_1002297641 | 3300032180 | Hardwood Forest Soil | QNRDYTCAVERRWTTAGESPARELGSLHPEAIRAAVEETKPSEPLV |
| Ga0307471_1004058211 | 3300032180 | Hardwood Forest Soil | MATNDRTSAQSAKNPDYACAVERRWTTAGESPARELGSLHPEAIRAAVEETKPSE |
| Ga0307472_1009936871 | 3300032205 | Hardwood Forest Soil | RLLAKNRYFTCAVKRRWSTAGESPARELGSLHPEAIGAAVEETKPSEPPV |
| Ga0306920_1006193911 | 3300032261 | Soil | MQILHRTCAVKRRWLTAGESPARELGSLHPEAIGAAVE |
| Ga0306920_1014802662 | 3300032261 | Soil | LLLSGDFTCAVERRWSTAGESPARELGSLHPEAIRAAAEETKPSEPLVQGVT |
| Ga0310914_105898611 | 3300033289 | Soil | LALYRYYTCAVKRRWSTAGESPARELGSLHPEAIGAAVEETKPSEPPV |
| Ga0310914_115244491 | 3300033289 | Soil | MLNLDYTCAVKRRWLTAGESPARELGSLHPEAIGAAV |
| Ga0326726_112016421 | 3300033433 | Peat Soil | IVDDNTCAVKRRWSTAGESPARELGSLHPEAIGAAVEETKPSEPPV |
| ⦗Top⦘ |