| Basic Information | |
|---|---|
| Family ID | F031237 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 183 |
| Average Sequence Length | 48 residues |
| Representative Sequence | EMRVTQHFLFDRFGARDRYLGPADLGPNGPWGRYNTIGVRKYFGTRRW |
| Number of Associated Samples | 162 |
| Number of Associated Scaffolds | 183 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.55 % |
| % of genes near scaffold ends (potentially truncated) | 98.91 % |
| % of genes from short scaffolds (< 2000 bps) | 87.98 % |
| Associated GOLD sequencing projects | 156 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.15 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.814 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (11.475 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.415 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.727 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.15 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 183 Family Scaffolds |
|---|---|---|
| PF03710 | GlnE | 16.39 |
| PF08335 | GlnD_UR_UTase | 9.29 |
| PF04542 | Sigma70_r2 | 4.92 |
| PF01740 | STAS | 2.73 |
| PF00180 | Iso_dh | 2.19 |
| PF04519 | Bactofilin | 2.19 |
| PF14489 | QueF | 1.09 |
| PF00679 | EFG_C | 0.55 |
| PF12158 | DUF3592 | 0.55 |
| PF01261 | AP_endonuc_2 | 0.55 |
| PF00583 | Acetyltransf_1 | 0.55 |
| PF11004 | Kdo_hydroxy | 0.55 |
| PF10131 | PTPS_related | 0.55 |
| PF00160 | Pro_isomerase | 0.55 |
| PF01244 | Peptidase_M19 | 0.55 |
| PF00561 | Abhydrolase_1 | 0.55 |
| PF12697 | Abhydrolase_6 | 0.55 |
| PF02687 | FtsX | 0.55 |
| COG ID | Name | Functional Category | % Frequency in 183 Family Scaffolds |
|---|---|---|---|
| COG1391 | Glutamine synthetase adenylyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 32.79 |
| COG2844 | UTP:GlnB (protein PII) uridylyltransferase | Signal transduction mechanisms [T] | 9.29 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 4.92 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 4.92 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 4.92 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 4.92 |
| COG1664 | Cytoskeletal protein CcmA, bactofilin family | Cytoskeleton [Z] | 2.19 |
| COG0652 | Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family | Posttranslational modification, protein turnover, chaperones [O] | 0.55 |
| COG2355 | Zn-dependent dipeptidase, microsomal dipeptidase homolog | Posttranslational modification, protein turnover, chaperones [O] | 0.55 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.81 % |
| Unclassified | root | N/A | 2.19 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459005|F1BAP7Q01BGW2R | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 2170459010|GIO7OMY02G7TFI | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 2170459014|G1P06HT02G37NW | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300002915|JGI25387J43893_1070364 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300004081|Ga0063454_102093917 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300004082|Ga0062384_100393518 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 890 | Open in IMG/M |
| 3300004091|Ga0062387_100066409 | Not Available | 1805 | Open in IMG/M |
| 3300004479|Ga0062595_100018831 | All Organisms → cellular organisms → Bacteria | 2549 | Open in IMG/M |
| 3300004635|Ga0062388_102394475 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
| 3300004635|Ga0062388_102761611 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300004643|Ga0062591_101641240 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300005167|Ga0066672_10418860 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 876 | Open in IMG/M |
| 3300005174|Ga0066680_10154267 | All Organisms → cellular organisms → Bacteria | 1437 | Open in IMG/M |
| 3300005332|Ga0066388_105596690 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300005332|Ga0066388_108066601 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300005333|Ga0070677_10842558 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300005336|Ga0070680_100555477 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
| 3300005341|Ga0070691_10771435 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
| 3300005365|Ga0070688_100256382 | All Organisms → cellular organisms → Bacteria | 1247 | Open in IMG/M |
| 3300005434|Ga0070709_10934490 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 687 | Open in IMG/M |
| 3300005435|Ga0070714_100138953 | All Organisms → cellular organisms → Bacteria | 2178 | Open in IMG/M |
| 3300005445|Ga0070708_100001308 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 19092 | Open in IMG/M |
| 3300005526|Ga0073909_10387163 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300005534|Ga0070735_10937916 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300005538|Ga0070731_10679729 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 684 | Open in IMG/M |
| 3300005542|Ga0070732_10450153 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 778 | Open in IMG/M |
| 3300005546|Ga0070696_100652310 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
| 3300005552|Ga0066701_10904216 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300005555|Ga0066692_10390384 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 882 | Open in IMG/M |
| 3300005560|Ga0066670_10248193 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
| 3300005563|Ga0068855_100378636 | All Organisms → cellular organisms → Bacteria | 1554 | Open in IMG/M |
| 3300005566|Ga0066693_10052433 | All Organisms → cellular organisms → Bacteria | 1366 | Open in IMG/M |
| 3300005566|Ga0066693_10417159 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
| 3300005569|Ga0066705_10832307 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300005575|Ga0066702_10514424 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300005575|Ga0066702_10832074 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
| 3300005575|Ga0066702_10914476 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300005587|Ga0066654_10071701 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1598 | Open in IMG/M |
| 3300005617|Ga0068859_100693263 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
| 3300005764|Ga0066903_106670652 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300005834|Ga0068851_10006669 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5281 | Open in IMG/M |
| 3300005841|Ga0068863_100467888 | All Organisms → cellular organisms → Bacteria | 1239 | Open in IMG/M |
| 3300005841|Ga0068863_102257592 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300005844|Ga0068862_100183541 | All Organisms → cellular organisms → Bacteria | 1879 | Open in IMG/M |
| 3300005875|Ga0075293_1021936 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300005944|Ga0066788_10102752 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300006034|Ga0066656_10047581 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2463 | Open in IMG/M |
| 3300006047|Ga0075024_100864310 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300006050|Ga0075028_100007438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4374 | Open in IMG/M |
| 3300006050|Ga0075028_100512196 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300006162|Ga0075030_100614948 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300006172|Ga0075018_10237433 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 878 | Open in IMG/M |
| 3300006176|Ga0070765_101754344 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300006237|Ga0097621_100694894 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
| 3300006358|Ga0068871_100718926 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
| 3300006358|Ga0068871_101167265 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300006797|Ga0066659_10459743 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1013 | Open in IMG/M |
| 3300006800|Ga0066660_10910843 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300006914|Ga0075436_100304193 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
| 3300007258|Ga0099793_10044417 | All Organisms → cellular organisms → Bacteria | 1940 | Open in IMG/M |
| 3300009092|Ga0105250_10346860 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300009093|Ga0105240_10600302 | All Organisms → cellular organisms → Bacteria | 1212 | Open in IMG/M |
| 3300009101|Ga0105247_10258480 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1193 | Open in IMG/M |
| 3300009137|Ga0066709_103896618 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
| 3300009143|Ga0099792_10807987 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300009176|Ga0105242_10133535 | All Organisms → cellular organisms → Bacteria | 2145 | Open in IMG/M |
| 3300009545|Ga0105237_10767531 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 971 | Open in IMG/M |
| 3300009551|Ga0105238_10666969 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
| 3300009792|Ga0126374_10040313 | All Organisms → cellular organisms → Bacteria | 2283 | Open in IMG/M |
| 3300009839|Ga0116223_10435158 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 768 | Open in IMG/M |
| 3300010048|Ga0126373_10138444 | All Organisms → cellular organisms → Bacteria | 2300 | Open in IMG/M |
| 3300010301|Ga0134070_10446999 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300010303|Ga0134082_10241695 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 747 | Open in IMG/M |
| 3300010322|Ga0134084_10353247 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300010360|Ga0126372_10608488 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1050 | Open in IMG/M |
| 3300010361|Ga0126378_10465482 | All Organisms → cellular organisms → Bacteria | 1379 | Open in IMG/M |
| 3300010366|Ga0126379_13282737 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300010371|Ga0134125_10980830 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| 3300010373|Ga0134128_10654413 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1168 | Open in IMG/M |
| 3300010375|Ga0105239_10285682 | All Organisms → cellular organisms → Bacteria | 1858 | Open in IMG/M |
| 3300010376|Ga0126381_101711027 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 908 | Open in IMG/M |
| 3300010376|Ga0126381_104819176 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300010397|Ga0134124_12291122 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
| 3300010401|Ga0134121_12713447 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300011270|Ga0137391_10059730 | All Organisms → cellular organisms → Bacteria | 3264 | Open in IMG/M |
| 3300012189|Ga0137388_10151169 | All Organisms → cellular organisms → Bacteria | 2056 | Open in IMG/M |
| 3300012198|Ga0137364_10673156 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300012198|Ga0137364_10679619 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 777 | Open in IMG/M |
| 3300012198|Ga0137364_11291100 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300012199|Ga0137383_10623821 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 788 | Open in IMG/M |
| 3300012199|Ga0137383_10799224 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 689 | Open in IMG/M |
| 3300012202|Ga0137363_10278013 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1368 | Open in IMG/M |
| 3300012202|Ga0137363_10527626 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
| 3300012207|Ga0137381_11128196 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4 | 674 | Open in IMG/M |
| 3300012209|Ga0137379_11099726 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300012210|Ga0137378_11146060 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300012211|Ga0137377_10862753 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 837 | Open in IMG/M |
| 3300012357|Ga0137384_11316768 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
| 3300012362|Ga0137361_11605422 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300012469|Ga0150984_107523733 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300012469|Ga0150984_116578974 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300012922|Ga0137394_10024338 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4878 | Open in IMG/M |
| 3300012924|Ga0137413_10816067 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300012958|Ga0164299_10642300 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 733 | Open in IMG/M |
| 3300012977|Ga0134087_10359752 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 698 | Open in IMG/M |
| 3300012980|Ga0168315_118209 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 653 | Open in IMG/M |
| 3300012986|Ga0164304_10767797 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 740 | Open in IMG/M |
| 3300012987|Ga0164307_10659683 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 814 | Open in IMG/M |
| 3300013104|Ga0157370_10158161 | All Organisms → cellular organisms → Bacteria | 2108 | Open in IMG/M |
| 3300013306|Ga0163162_12400609 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
| 3300013308|Ga0157375_12750660 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300014150|Ga0134081_10154717 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 755 | Open in IMG/M |
| 3300014154|Ga0134075_10202245 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 854 | Open in IMG/M |
| 3300015265|Ga0182005_1154687 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300015372|Ga0132256_101513622 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300016404|Ga0182037_11905888 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300017823|Ga0187818_10376597 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300017933|Ga0187801_10171288 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 852 | Open in IMG/M |
| 3300017955|Ga0187817_10285698 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1052 | Open in IMG/M |
| 3300018038|Ga0187855_10674775 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 602 | Open in IMG/M |
| 3300018431|Ga0066655_10222580 | All Organisms → cellular organisms → Bacteria | 1184 | Open in IMG/M |
| 3300018431|Ga0066655_10403239 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 902 | Open in IMG/M |
| 3300018482|Ga0066669_11504924 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 612 | Open in IMG/M |
| 3300019999|Ga0193718_1039534 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1037 | Open in IMG/M |
| 3300020010|Ga0193749_1071880 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 645 | Open in IMG/M |
| 3300020199|Ga0179592_10054197 | All Organisms → cellular organisms → Bacteria | 1825 | Open in IMG/M |
| 3300020580|Ga0210403_10061075 | All Organisms → cellular organisms → Bacteria | 3020 | Open in IMG/M |
| 3300020581|Ga0210399_10371596 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1193 | Open in IMG/M |
| 3300020583|Ga0210401_10565918 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 998 | Open in IMG/M |
| 3300021171|Ga0210405_10102190 | All Organisms → cellular organisms → Bacteria | 2263 | Open in IMG/M |
| 3300021171|Ga0210405_10162881 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1766 | Open in IMG/M |
| 3300021180|Ga0210396_10127192 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2297 | Open in IMG/M |
| 3300021406|Ga0210386_10017069 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5660 | Open in IMG/M |
| 3300021420|Ga0210394_11621051 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 3300022721|Ga0242666_1209949 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 500 | Open in IMG/M |
| 3300022724|Ga0242665_10200395 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 657 | Open in IMG/M |
| 3300025464|Ga0208076_1048847 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300025898|Ga0207692_11204380 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300025908|Ga0207643_10754100 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300025915|Ga0207693_10058006 | All Organisms → cellular organisms → Bacteria | 3033 | Open in IMG/M |
| 3300025915|Ga0207693_10497142 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
| 3300025916|Ga0207663_11380476 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
| 3300025934|Ga0207686_10267157 | All Organisms → cellular organisms → Bacteria | 1257 | Open in IMG/M |
| 3300025945|Ga0207679_10973628 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300025981|Ga0207640_10568799 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
| 3300026041|Ga0207639_10162226 | All Organisms → cellular organisms → Bacteria | 1885 | Open in IMG/M |
| 3300026294|Ga0209839_10263367 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300026296|Ga0209235_1015212 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4196 | Open in IMG/M |
| 3300026309|Ga0209055_1283998 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300026309|Ga0209055_1285438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300026322|Ga0209687_1140138 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 778 | Open in IMG/M |
| 3300026333|Ga0209158_1150378 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 852 | Open in IMG/M |
| 3300026530|Ga0209807_1197889 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300026552|Ga0209577_10015726 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6778 | Open in IMG/M |
| 3300027047|Ga0208730_1025282 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 681 | Open in IMG/M |
| 3300027591|Ga0209733_1175613 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300027660|Ga0209736_1183774 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300027862|Ga0209701_10210920 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1153 | Open in IMG/M |
| 3300027867|Ga0209167_10671700 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300027894|Ga0209068_10107713 | All Organisms → cellular organisms → Bacteria | 1476 | Open in IMG/M |
| 3300027915|Ga0209069_10302135 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300029915|Ga0311358_11183816 | Not Available | 509 | Open in IMG/M |
| 3300029954|Ga0311331_10436355 | Not Available | 1310 | Open in IMG/M |
| 3300031231|Ga0170824_103301787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300031573|Ga0310915_11028778 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
| 3300031716|Ga0310813_10394739 | All Organisms → cellular organisms → Bacteria | 1188 | Open in IMG/M |
| 3300031718|Ga0307474_10730645 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 782 | Open in IMG/M |
| 3300031740|Ga0307468_100997729 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300031754|Ga0307475_10194715 | All Organisms → cellular organisms → Bacteria | 1619 | Open in IMG/M |
| 3300031754|Ga0307475_10773735 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300031890|Ga0306925_11603306 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 633 | Open in IMG/M |
| 3300031946|Ga0310910_10407725 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1077 | Open in IMG/M |
| 3300031954|Ga0306926_12980628 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300031962|Ga0307479_11629539 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
| 3300032180|Ga0307471_101360735 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 871 | Open in IMG/M |
| 3300032180|Ga0307471_103610517 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300032205|Ga0307472_100036484 | All Organisms → cellular organisms → Bacteria | 2917 | Open in IMG/M |
| 3300032261|Ga0306920_103131655 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 621 | Open in IMG/M |
| 3300032828|Ga0335080_11386482 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 699 | Open in IMG/M |
| 3300032829|Ga0335070_10624558 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
| 3300032829|Ga0335070_12033711 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300033158|Ga0335077_11007347 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.56% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.37% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.37% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.83% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.28% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.28% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.28% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.73% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.19% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.19% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.19% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.19% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.19% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.19% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.64% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.64% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.09% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.09% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 1.09% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.09% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.09% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.09% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.09% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.09% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.55% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.55% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.55% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.55% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.55% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.55% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.55% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.55% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.55% |
| Weathered Mine Tailings | Environmental → Terrestrial → Geologic → Mine → Unclassified → Weathered Mine Tailings | 0.55% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.55% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.55% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.55% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.55% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.55% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.55% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.55% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.55% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.55% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.55% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
| 2170459014 | Litter degradation PV2 | Engineered | Open in IMG/M |
| 3300002915 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005875 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101 | Environmental | Open in IMG/M |
| 3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012980 | Weathered mine tailings microbial communities from Hibbing, Minnesota, USA - DCW15 | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019999 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1 | Environmental | Open in IMG/M |
| 3300020010 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s2 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300022721 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025464 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025475 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027047 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF042 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300029915 | III_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029954 | I_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E41_10717460 | 2170459005 | Grass Soil | QRFGARDRYLGTADLGLNGPWGRYNVIGVRKYFGHRAAD |
| F62_09586310 | 2170459010 | Grass Soil | VTIGRGFELRVTQHFLFQRFGARDRYLGTADLGLNGPWGRYNVIGVRKYFGHRAAD |
| 2PV_00222660 | 2170459014 | Switchgrass, Maize And Mischanthus Litter | MGCGFELRVTQHFXFQRFGSRDRYLGPADLGTNGPWGRYNVIGVRKYFGHREPD |
| JGI25387J43893_10703641 | 3300002915 | Grasslands Soil | QHFLFDRLGSRDRNLGQADLGPNGPWGRYNAIGIRKYFGTRRW* |
| Ga0063454_1020939171 | 3300004081 | Soil | HFLFDRFGARNANLGAADLGPNGPWGRYNAIGVRKYFGSRRW* |
| Ga0062384_1003935183 | 3300004082 | Bog Forest Soil | YLGRGFEFRVTQHPLFERFGSRTGNLGPADLGPNGPWGRYTTIGVRKYFGTRRW* |
| Ga0062387_1000664092 | 3300004091 | Bog Forest Soil | KGFEFRVTQHFLFDRLGARDRYLGPADLGPNGPWGRYNAIGVRKYFGTRRW* |
| Ga0062595_1000188311 | 3300004479 | Soil | TQHFLFSRFGARDRNLGSADLGPNGPWGRYNMIGVRKYFGQRRY* |
| Ga0062388_1023944751 | 3300004635 | Bog Forest Soil | GGGLYLGKGFEMRVTQHLLFTRFGARDRNLGPADLGPNGPWGRYNTIGVRKYFGTRRY* |
| Ga0062388_1027616111 | 3300004635 | Bog Forest Soil | FRVTQHFLFDRLGARDKYLGPADLGDNGPWGRYNTIGIRKYFGTRRW* |
| Ga0062591_1016412402 | 3300004643 | Soil | VTQHFLFDRLGARDRFLGPADLGTNGPWGRYNTIGVRKYFGSRRW* |
| Ga0066672_104188601 | 3300005167 | Soil | GKGFEARVTQHFLFDRVGARDRNLGAADLGPNGPWGRYNTIGVRKYFGTRRW* |
| Ga0066680_101542671 | 3300005174 | Soil | GIYLGKGFEMRVTQHFLFTRFGMRDRNLGAADLGPNGPWGRYNAIGVRKYFGERRY* |
| Ga0066388_1055966902 | 3300005332 | Tropical Forest Soil | GIDMGRGFELRVTQHFLFQRFGSRDRYLGPADLGTNGPWGRYNVIGVRKYFGHREPD* |
| Ga0066388_1080666011 | 3300005332 | Tropical Forest Soil | AIYLGKGFEFRATQHFLFDRWGSRDRYLGPADLGTNGPWGRYNTVGVRKYFGQRRW* |
| Ga0070677_108425581 | 3300005333 | Miscanthus Rhizosphere | MGRGFEMRVTQHFLFDRFGARDRYLGPADLGPNGPWGRYNTIGVRKYFGTRRW* |
| Ga0070680_1005554772 | 3300005336 | Corn Rhizosphere | TQHFLFDRFGARDRYLGPADLGPNGPWGRYNTIGVRKYFGTRRW* |
| Ga0070691_107714351 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | VTQHFLFDRFGARDRYLGTADLGPNGPWGRYNTIGVRKYFGTRRW* |
| Ga0070688_1002563821 | 3300005365 | Switchgrass Rhizosphere | RVTQHFLFTRFGARDQHLGGADLGPNGPWGRYNTIGVRKYFGTRRY* |
| Ga0070709_109344902 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | GFEMRVTQHFLFQRFGARDRYLGPADLGTNGPWGRYNVIGVRKYFGHREPD* |
| Ga0070714_1001389531 | 3300005435 | Agricultural Soil | QHFLFQRFGARDRYLGPADLGTNGPWGRYNVIGVRKYFGHRDAE* |
| Ga0070708_1000013081 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | YMGKGFEMRWTQHFLFSRFGARDRNLGSADLGPNGPWGRYNMIGVRKYFGQRRY* |
| Ga0073909_103871631 | 3300005526 | Surface Soil | RVTQHFLFDRLGARDRFLGPADLGTNGPWGRDNTIGVRKYFGSRRW* |
| Ga0070735_109379162 | 3300005534 | Surface Soil | DRLGARDRNLGPADLGNNGPWGRYNAIGVRKYFGTRRW* |
| Ga0070731_106797291 | 3300005538 | Surface Soil | IGKGFEMRVTQHFLFQRFGARDRNLGTADLGPNGPWGRYNVIGVRKYWGRREP* |
| Ga0070732_104501531 | 3300005542 | Surface Soil | RGFEMRVTQHFLFQRFGARDRYLGPADLGTNGPWGRYNVIGVRKYFGHRDAD* |
| Ga0070696_1006523102 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | EVRWTQHFLFSRFGARDRNLGSADLGPNGPWGRYNMIGVRKYFGQRRY* |
| Ga0066701_109042162 | 3300005552 | Soil | GIYMGKGFEVRVTQHFLFSRFGARDRNLGSADLGPNGPWGRYNMIGVRKYFGQRRY* |
| Ga0066692_103903842 | 3300005555 | Soil | FEMRVTQHFLFTRFGVRDRNLGPADLGPNGPWGRYNAIGVRKYFGERRY* |
| Ga0066670_102481933 | 3300005560 | Soil | GKGFEMRVTQHFLFTRFGVRDRNLGAADLGPNGPWGRYNAIGVRKYFGERRY* |
| Ga0068855_1003786362 | 3300005563 | Corn Rhizosphere | RFGARDQHLGGADLGPNGPWGRYNTIGVRKYFGTRRY* |
| Ga0066693_100524332 | 3300005566 | Soil | FEARVTQHFLFSRFGARDRNLGSADLGPNGPWGRYNMIGVRKYFGQRRY* |
| Ga0066693_104171591 | 3300005566 | Soil | HFLFDRFGARDRNLGTADLGPNGPWGRYNTIGVRKYFGTRRW* |
| Ga0066705_108323072 | 3300005569 | Soil | RVTQHLLFQRFGARDRNLGPADLGVNGPWGRYTVIGVRKYFGYRKEGE* |
| Ga0066702_105144242 | 3300005575 | Soil | HFLFARLGARDRYLGAADLGPNGPWGRYNTIGVRKYFGTRRW* |
| Ga0066702_108320741 | 3300005575 | Soil | EARVTQHFLFDRFGARNANLGAADLGPNGPWGRYNAIGVRKYFGSRRW* |
| Ga0066702_109144762 | 3300005575 | Soil | HGFEARVTQHYLFQRFGSRDRNLGLADLGVNGPWGRYTVIGVRKYFGYRNPGQ* |
| Ga0066654_100717011 | 3300005587 | Soil | KGFEARVTQHFLFDRFGARDRNLGAADLGPNGPWGRYNTIGVRKYFGTRRW* |
| Ga0068859_1006932632 | 3300005617 | Switchgrass Rhizosphere | FEMRVTQHSLFTRFGARDRNLGPADLGPNGPWGRYNTIGVRKYFGTRPY* |
| Ga0066903_1066706521 | 3300005764 | Tropical Forest Soil | AGIYLGQGFEMRVTQHFLFHRFGTRDKYLGAADLGPNGPWGRYNVIGVRKYFGTRRW* |
| Ga0068851_100066694 | 3300005834 | Corn Rhizosphere | LFTRFGARDQHLGGADLGPNGPWGRYNTIGVRKYFGTRRY* |
| Ga0068863_1004678881 | 3300005841 | Switchgrass Rhizosphere | QHFLFKRLGARDTFLGEADLGPNGPWGRYNTVGVRKYFGTRRW* |
| Ga0068863_1022575922 | 3300005841 | Switchgrass Rhizosphere | GIFLGKGFEMRITQHFLFSRFGSRDQHLGPADLGPNGPWGRYNVVGIRKYFGTRRW* |
| Ga0068862_1001835412 | 3300005844 | Switchgrass Rhizosphere | HFLFTRFGARDQHLGGADLGPNGPWGRYNTIGVRKYFGTRRY* |
| Ga0075293_10219362 | 3300005875 | Rice Paddy Soil | KGFEFRATQHFLFQRFGARDTNLGPADLGPNGPYGRYNTVGVRKYFGTRRW* |
| Ga0066788_101027521 | 3300005944 | Soil | GLYLGKGFEMRVTQHFLFTRLGARDRNLGPADLGPNGPWGRYNTIGVRKYFGTRRY* |
| Ga0066656_100475815 | 3300006034 | Soil | RFGMRDRNLGAADLGPNGPWGRYNAIGVRKYFGERRY* |
| Ga0075024_1008643102 | 3300006047 | Watersheds | FEIRVTQHFLFQRFGSRDRYLGQADLGLNGPWGRYSVIGVRKYFGHRDAQ* |
| Ga0075028_1000074381 | 3300006050 | Watersheds | IYIGKGFEMRVTQHFLFSRFGARDRNLGPADLGPNGPWGRYNMIGVRKYFGQRRY* |
| Ga0075028_1005121961 | 3300006050 | Watersheds | SWGAGIEIGHGFEMRVTQHFLFQRFGSRDRNLGAADLGSNGPWGRYNVIGVRKYFGRREP |
| Ga0075030_1006149482 | 3300006162 | Watersheds | LFQRFGSRDRYLGPADLGTNGPWGRYSVIGVRKYFGHRAEQ* |
| Ga0075018_102374331 | 3300006172 | Watersheds | GKGFEFRVTQHFLFDRLGARDRNLGAADMGNNGPWGRYNAIGVRKYFGTRRW* |
| Ga0070765_1017543441 | 3300006176 | Soil | GFEVRVTQHFLFTRFGARDRNLGPADLGPNGPWGRYNTIGVRKYFGTRRY* |
| Ga0097621_1006948942 | 3300006237 | Miscanthus Rhizosphere | AAIYLGKGFEARVTQHFLFDRFGARDRYLGNADLGPNGPWGRYNTIGVRKYFGSRRW* |
| Ga0068871_1007189262 | 3300006358 | Miscanthus Rhizosphere | GARDRYLGNADLGPNGPWGRYNTIGVRKYFGSRRW* |
| Ga0068871_1011672651 | 3300006358 | Miscanthus Rhizosphere | GIYLGKGFEMRVTQHMLFTRFGARDRNLGPGDLGPNGPWGRYNTIGVRKYFGTRRY* |
| Ga0066659_104597431 | 3300006797 | Soil | HFLFQRLGARDRFLGPADLGTNGPWGRYSVIGVRKYFGQRR* |
| Ga0066660_109108432 | 3300006800 | Soil | LFDRFGARNANLGAADLGPNGPWGRYNAIGVRKYFGSRRW* |
| Ga0075436_1003041932 | 3300006914 | Populus Rhizosphere | QHFLFTRFGARDQHLGGADLGPNGPWGRYNTIGVRKYFGTRRY* |
| Ga0099793_100444172 | 3300007258 | Vadose Zone Soil | VTIGHGFEMRVTQHFLFQRFGARDQNLGAADLGPNGPWGRYAVIGVRKYFGHHEAE* |
| Ga0105250_103468602 | 3300009092 | Switchgrass Rhizosphere | LFKRLGARDTFLGEADLGPNGPWGRYNTVGVRKYFGTRRW* |
| Ga0105240_106003022 | 3300009093 | Corn Rhizosphere | GKCFEMRVTQVFLLTRFGARDPPLGGAGLGANGPWGGYNTIGVRKYFGTRRY* |
| Ga0105247_102584801 | 3300009101 | Switchgrass Rhizosphere | LGKGFEMRVTQHMLFTRFGARDRNLGPGDLGPNGPWGRYNTIGVRKYFGTRRY* |
| Ga0066709_1038966181 | 3300009137 | Grasslands Soil | KGFEMRWTQHFLFSRFGSRDRNLGAADLGPNGPWGRYNMIGVRKYFGERRY* |
| Ga0099792_108079872 | 3300009143 | Vadose Zone Soil | GIYMGKGFEMRVAQHFLFDRLGARDRNLGDADLGVNGPWGRYNVIGVRKYFGQRRY* |
| Ga0105242_101335351 | 3300009176 | Miscanthus Rhizosphere | EMRVTQHFLFDRFGARDRYLGPADLGPNGPWGRYNTIGVRKYFGTRRW* |
| Ga0105237_107675311 | 3300009545 | Corn Rhizosphere | IGKGFEARVTQHFLFDRFGARDANLGAADLGPNGPCGRYNAIGVRKYFGSRRW* |
| Ga0105238_106669692 | 3300009551 | Corn Rhizosphere | EARVTQHFLFDRFGARDRYLGNADLGPNGPWGRYNTIGVRKYFGSRRW* |
| Ga0126374_100403131 | 3300009792 | Tropical Forest Soil | VTQHFLFQRFGSRDRYLGPADLGTNGPWGRYNVIGVRKYFGHREPD* |
| Ga0116223_104351581 | 3300009839 | Peatlands Soil | MGKGFEFRVTQHFLFDRLGARDRNLGAADLGNNGPWGRYNAIGVRKYFGTRRW* |
| Ga0126373_101384442 | 3300010048 | Tropical Forest Soil | AAVYMGRGFEMRVTQHFLFDRLGARDRFLGPADLGPNGPWGRYNAIGVRKYFGTRRW* |
| Ga0134070_104469991 | 3300010301 | Grasslands Soil | GFEMRWTQHFLFSRFGSRDRNLGGADLGPNGPWGRYNMIGVRKYFGERRY* |
| Ga0134082_102416952 | 3300010303 | Grasslands Soil | QQFLFTRFGVRDRNLGAADLGPNGPWGRYNAIGVRKYFGERRY* |
| Ga0134084_103532472 | 3300010322 | Grasslands Soil | GRGFEMRVTQHFLFQRFGARDRYLGPADLGLNGPWGRYNVIGVRKYFGHREAD* |
| Ga0126372_106084881 | 3300010360 | Tropical Forest Soil | QHLLFDRLGARDRYLGPADLGPNGPWGRYNAIGIRKYFGTRRW* |
| Ga0126378_104654822 | 3300010361 | Tropical Forest Soil | FLFDRFGARDRYLGPADLGPNGPWGRYNAIGVRKYFGTRRW* |
| Ga0126379_132827371 | 3300010366 | Tropical Forest Soil | FGSRDRFLGPADLGPNGPWGRYTVIGVRKYFGYRNAGE* |
| Ga0134125_109808301 | 3300010371 | Terrestrial Soil | AIYLNRGFELRVTQHFLFDRMGSRDKNLGVADLGPNGPWGRYNTIGVRKTFGTRRW* |
| Ga0134128_106544132 | 3300010373 | Terrestrial Soil | EARVTQHFLFDRFGARDANLCAADLGPNGPWGRYNAIGVRKYFGSRRW* |
| Ga0105239_102856821 | 3300010375 | Corn Rhizosphere | EARVTQHFLFQRFGSRDRNLGPADLGVNGPWGRYNVIGVRKYFGYRKEGQ* |
| Ga0126381_1017110273 | 3300010376 | Tropical Forest Soil | ARDHYLGPADLGENGPWGRYNVIGVRKYFGYRKEGM* |
| Ga0126381_1048191762 | 3300010376 | Tropical Forest Soil | FEMRVTQHFLFDRLGARDRFLGPADLGPNGPWGRYNAIGVRKYFGTRRW* |
| Ga0134124_122911222 | 3300010397 | Terrestrial Soil | QHFLFDRFGARDRYLGNADLGPNGPWGRYNTIGVRKYFGSRRW* |
| Ga0134121_127134471 | 3300010401 | Terrestrial Soil | KGFEVRWTQHFLFSRFGARDRNLGSADLGPNGPWGRYNMIGVRKYFGQRRY* |
| Ga0137391_100597301 | 3300011270 | Vadose Zone Soil | TQHFLFDRFGARDRNLGAADLGPNGPWGRYNAIGVRKSFGTRRW* |
| Ga0137388_101511691 | 3300012189 | Vadose Zone Soil | GKGFEMRWTQHFLFSRFGARDRNLGSADLGPNGPWGRYNMSGVRKYFGKRRY* |
| Ga0137364_106731562 | 3300012198 | Vadose Zone Soil | EARLTQHFLFDRLGARDRYLGQADLGPNGPWGRYNTIGVRKYFGSRRW* |
| Ga0137364_106796191 | 3300012198 | Vadose Zone Soil | TRFGMRDRNLGAADLGPNGPWGRYNAIGVRKYFGERRY* |
| Ga0137364_112911003 | 3300012198 | Vadose Zone Soil | AIYIGKGFEMRVTQHFLFDRFGARDRNLGTADLGPNGPWGRYNAIGVRKYFGSRRW* |
| Ga0137383_106238211 | 3300012199 | Vadose Zone Soil | MRVTQHFLFTRFGMRDRNLGAADLGPNGPWGRYNAIGVRKYFGERRY* |
| Ga0137383_107992241 | 3300012199 | Vadose Zone Soil | RFGARDRNLGAADLGPNGPWGRYNAIGVRKYFGTRRW* |
| Ga0137363_102780133 | 3300012202 | Vadose Zone Soil | GRGFELRVSQHFLFQRFGARDRYLGQADLGTNGPWGRYNVIGVRKYFGHREPE* |
| Ga0137363_105276263 | 3300012202 | Vadose Zone Soil | GIYLGKGFEMRVTQHFLFTRFGVRDRNLGAADLGPNGPWGRYNAIGVRKYFGERRY* |
| Ga0137381_111281962 | 3300012207 | Vadose Zone Soil | QHFLFDRFGARDRNLGAADLGDNGPWGRYNAIGVRKYFGQRRW* |
| Ga0137379_110997262 | 3300012209 | Vadose Zone Soil | GKGFEMRVTQHFLFSRFGVRDRNLGSADLGPNGPWGRYNMIGVRKYFGQRRY* |
| Ga0137378_111460601 | 3300012210 | Vadose Zone Soil | TQHFLFSRFGVRDRNLGSADLGPNGPWGRYNMIGVRKYFGQRRY* |
| Ga0137377_108627531 | 3300012211 | Vadose Zone Soil | KGFEMRVTQHFLFTRFGMRDRNLGAADLGPNGPWGRYNAIGVRKYFGERRY* |
| Ga0137384_113167682 | 3300012357 | Vadose Zone Soil | EMRVTQHFLFQRFGARDRYLGPADLGLNGPWGRYNVIGVRKYFGHRDAD* |
| Ga0137361_116054222 | 3300012362 | Vadose Zone Soil | QRFGARDQNLGAADLGPNGPWGRYAVIGVRKYFGHHEAE* |
| Ga0150984_1075237332 | 3300012469 | Avena Fatua Rhizosphere | QHFLFDRFGARDRNLGAADLGPNGPWGRYNTIGVRKYFGTRRW* |
| Ga0150984_1165789742 | 3300012469 | Avena Fatua Rhizosphere | VTQHFLFDRFGARNANLGAADLGPNGPWGRYNAIGVRKYFGSRRW* |
| Ga0137394_100243386 | 3300012922 | Vadose Zone Soil | FELRVSQHFLFQRFGARDRYLGQADLGTNGPWGRYNVIGVRKYFGHREPE* |
| Ga0137413_108160672 | 3300012924 | Vadose Zone Soil | EVRWTQHFLITRFGARDRNLGPADLGPNGPWGRYNTIGVRKYFGTRRY* |
| Ga0164299_106423001 | 3300012958 | Soil | GGAGITIGRGFELRVTQHFLFQRFGARDRYLGTADLGLNGPWGRYNVIGVRKYFGHRDAD |
| Ga0134087_103597522 | 3300012977 | Grasslands Soil | GSRDRNLGAADLGPNGPWGRYNMIGVRKYFGERRY* |
| Ga0168315_1182091 | 3300012980 | Weathered Mine Tailings | HFLFQRLGARDRNLGPADLGTNGPWGRYTVIGVRKYFGKRRE* |
| Ga0164304_107677972 | 3300012986 | Soil | FDRFGARDRNLGSADLGPNGPWGRYNAIGVRKYFGSRRW* |
| Ga0164307_106596831 | 3300012987 | Soil | MGKGFEMRITQHFLFSRFGARDQYLGGADLGPNGPWGRYNVIGVRKYFGTRRY* |
| Ga0157370_101581611 | 3300013104 | Corn Rhizosphere | FLFTRFGARDQHLGGADLGPNGPWGRYNTIGVRKYFGTRRY* |
| Ga0163162_124006092 | 3300013306 | Switchgrass Rhizosphere | GFEMRVTQHMLFTRFGARDRNLGPGDLGPNGPWGRYNTIGVRKYFGTRRY* |
| Ga0157375_127506601 | 3300013308 | Miscanthus Rhizosphere | FRATQHFLFKRLGARDTFLGEADLGPNGPWGRYNTVGVRKYFGTRRW* |
| Ga0134081_101547172 | 3300014150 | Grasslands Soil | GKGFEMRVTQHFLFTRFGMRDRNLGAADLGPNGPWGRYNAIGVRKYFGERRY* |
| Ga0134075_102022451 | 3300014154 | Grasslands Soil | GFEMRVTQHFLFTRFGVRDRNLGAADLGPNGPWGRYNAIGVRKYFGERRY* |
| Ga0182005_11546872 | 3300015265 | Rhizosphere | HFLFDRFGARNRFLGPADLGTNGPWGRYNTIGVRKYFGTRRW* |
| Ga0132256_1015136222 | 3300015372 | Arabidopsis Rhizosphere | GIYMGKGFEVRWTQHFLFSRFGARDRNLGSADLGPNGPWGRYNMIGVRKYFGQRRY* |
| Ga0182037_119058882 | 3300016404 | Soil | VTQHFLFQRFGSRDRYLGPADLGPNGPWGRYNVIGVRKYFGHREP |
| Ga0187818_103765972 | 3300017823 | Freshwater Sediment | QHFLFDRLGARDKNLGPADLGNNGPWGRYNTIGVRKYFGMRRW |
| Ga0187801_101712881 | 3300017933 | Freshwater Sediment | HFLFDRLGARDRNLGPADLGNNGPWGRYNAIGVRKYFGTRRW |
| Ga0187817_102856981 | 3300017955 | Freshwater Sediment | IAKGFEFRVTQHFLFDRLGARDRNLGPADLGNNGPWGRYNAIGVRKYFGTRRW |
| Ga0187855_106747752 | 3300018038 | Peatland | RFGARDQFLGPAYLGPNGPWGQYNAIGVRKYFGSRPKDQE |
| Ga0066655_102225803 | 3300018431 | Grasslands Soil | TRFGMRDRNLGAADLGPNGPWGRYNAIGVRKYFGERRY |
| Ga0066655_104032392 | 3300018431 | Grasslands Soil | GFEARVTQHFLFDRFGARDRNLGAADLGPNGPWGRYNTIGVRKYFGTRRW |
| Ga0066669_115049241 | 3300018482 | Grasslands Soil | RFGARDRNLGAADLGPNGPWGRYNAIGVRKYFGTRRW |
| Ga0193718_10395343 | 3300019999 | Soil | FQRFGARDRFLGPADLGLNGPWGRYNVIGVRKYFGHREAD |
| Ga0193749_10718801 | 3300020010 | Soil | LFDRFGARDRNLGAADLGPNGPWGRYNTIGVRKYFGTRRW |
| Ga0179592_100541974 | 3300020199 | Vadose Zone Soil | FQRFGARDRYLGQADLGTNGPWGRYNVIGVRKYFGHREPE |
| Ga0210403_100610754 | 3300020580 | Soil | QRFGARDRYLGPADLGTNGPWGRYNVIGVRKYFGHRDAD |
| Ga0210399_103715961 | 3300020581 | Soil | IEIGRGFEMRVTQHFLFQRFGARDRYLGPADLGTNGPWGRYNVIGVRKYFGHRDAD |
| Ga0210401_105659183 | 3300020583 | Soil | YIAKGFEFRVTQHFLFDRLGARDRNLGPADLGNNGPWGRYNAVGVRKYFGTRRW |
| Ga0210405_101021902 | 3300021171 | Soil | GVEIGRGFEMRVAQHFLFQRFGSRDRYLGPADLGTNGPWGRYAVIGVRKYFGHRDAQ |
| Ga0210405_101628813 | 3300021171 | Soil | GFEMRITQHFLFQRFGARDRYLGPADLGTNGPWGRYNVIGVRKYFGHREAQ |
| Ga0210396_101271921 | 3300021180 | Soil | GVYIAKGFEVRVTQHFLFDRLGARDRNLGPADLGNNGPWGRYNAIGVRKYFGTRRW |
| Ga0210386_100170691 | 3300021406 | Soil | GVYIAKGFEFRVTQHFLFDRLGARDRNLGTADLGNNGPWGRYNTIGVRKYFGTRRW |
| Ga0210394_116210512 | 3300021420 | Soil | LFQRSGARDRYLGPADLGTNGPWGRYNVIGVRKYFGHRDAQ |
| Ga0242666_12099491 | 3300022721 | Soil | KGFDVRFTQHFPFDRLGARDKTLGPADLGNNGPWGRYNAIGVRKTFGTRRW |
| Ga0242665_102003951 | 3300022724 | Soil | QHFLFDRLGARDRNRGLADVGNNGRWGRYNTVGVRKYFGTRRW |
| Ga0208076_10488471 | 3300025464 | Arctic Peat Soil | QHFLFTRLGARDRNLGPADLGPNGPWGRYNTIGVRKYFGKRRY |
| Ga0208478_10552131 | 3300025475 | Arctic Peat Soil | PLIQRFGARDQPLGPAWLGPNGPWGRYNAFGIRKYFGTRREGTY |
| Ga0207692_112043801 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | GIELGHGFEARVTQHFLFQRFGARNHNLGPADLGVNGPWGRYNVIGVRKYFGYRKGGE |
| Ga0207643_107541002 | 3300025908 | Miscanthus Rhizosphere | LGKGFEMRVTQHFLFTRFGARDQHLGGADLGPNGPWGRYNTIGVRKYFGTRRY |
| Ga0207693_100580061 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | AIYMGKGFEMRVTQHFLFDRFGARDRNLGSADLGPNGPWGRYNAIGVRKYFGSRRW |
| Ga0207693_104971421 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | YLGKGFEARVTQHFLFDRFGARDRYLGNADLGPNGPWGRYNTIGVRKYFGSRRW |
| Ga0207663_113804761 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | IYMGKGFEFRVTQHFLFDRFGARDRYLGPADLGPNGPWGRYNTIGVRKYFGTRRW |
| Ga0207686_102671571 | 3300025934 | Miscanthus Rhizosphere | EMRVTQHFLFDRFGARDRYLGPADLGPNGPWGRYNTIGVRKYFGTRRW |
| Ga0207679_109736281 | 3300025945 | Corn Rhizosphere | KGFEMRVTQHFLFTRFGARDQHLGGADLGPNGPWGRYNTIGVRKYFGTRRY |
| Ga0207640_105687991 | 3300025981 | Corn Rhizosphere | TQHFLFDRFGARDRYLGNADLGPNGPWGRYNTIGVRKYFGSRRW |
| Ga0207639_101622262 | 3300026041 | Corn Rhizosphere | VTQHFLFDRFGARDRYLGPADLGPNGPWGRYNTIGVRKYFGTRRW |
| Ga0209839_102633672 | 3300026294 | Soil | DVRFTQHFLFDRFGSRDRNLGVADQGPNGPWGRYNAIGVRKTFGTRRW |
| Ga0209235_10152124 | 3300026296 | Grasslands Soil | GKGFEMRVTQHFLFTRFGVRDRNLGPADLGPNGPWGRYNAIGVRKYFGERRY |
| Ga0209055_12839981 | 3300026309 | Soil | MGKGFEMRVTQHFLFDRLGARDRNLGAADLGVNGPWGRYNVIGVRKYFGQRRY |
| Ga0209055_12854381 | 3300026309 | Soil | TQHFLFDRFGARDRNLGAADLGPNGPWGRYNAIGVRKYFGTRRW |
| Ga0209687_11401382 | 3300026322 | Soil | LGKGFEMRVTQHFLFTRFGMRDRNLGAADLGPNGPWGRYNAIGVRKYFGERRY |
| Ga0209158_11503781 | 3300026333 | Soil | FGARDRNLGAADLGPNGPWGRYNTIGVRKYFGTRRW |
| Ga0209807_11978891 | 3300026530 | Soil | RSWGAGIEIGRGFEMRVTQHFLFQRLGARDRFLGPADLGTNGPWGRYSVIGVRKYFGQRR |
| Ga0209577_100157268 | 3300026552 | Soil | FEMRVTQHFLFQRFGARDRYLGPADLGTNGPWGRYNVIGVRKYFGHRDAD |
| Ga0208730_10252821 | 3300027047 | Forest Soil | GARDRYLGPADLGTNGPWGRYNVIGVRKYFGHRDAD |
| Ga0209733_11756131 | 3300027591 | Forest Soil | GVYLAKGFEFRVTQHFLFDRLGARDRNLGPADLGNNGPWGRYNTIGVRKYFGTRRW |
| Ga0209736_11837742 | 3300027660 | Forest Soil | GGLYLGKGFEVRVTQHFLFTRFGARDRNLGPADLGPNGPWGRYNTIGVRKYFGTRRY |
| Ga0209701_102109201 | 3300027862 | Vadose Zone Soil | DRLGSRDRNLGAADLGPNGPWGRYNAIGVRKYFGTRRW |
| Ga0209167_106717002 | 3300027867 | Surface Soil | QHFQFDRLGARDKNLGPADLGNNGPWGRYNTIGVRKYFGTRRW |
| Ga0209068_101077131 | 3300027894 | Watersheds | GHGFEMRVTQHFLFQRVGSRDRYLGQADLGLNGPWGRYSVIGVRKYFGHRDAQ |
| Ga0209069_103021352 | 3300027915 | Watersheds | GFEMRVTQHFLFQRFGSRDRYLGQADLGLNGPWGRYSVIGVRKYFGHRDAQ |
| Ga0311358_111838161 | 3300029915 | Bog | RLGARNTYLGPADLGPNGPYGRYTTIGVRKTFGIRRW |
| Ga0311331_104363552 | 3300029954 | Bog | EFRVTQHFLFGRLGARNTYLGPADLGPNGPYGRYTTIGVRKTFGIRRW |
| Ga0170824_1033017872 | 3300031231 | Forest Soil | FLFDRFGSRDRNLGAADLGDNGPWGRYNAIGVRKSFGTRRW |
| Ga0310915_110287782 | 3300031573 | Soil | FQRFGVRDRNLGTADLGPNGPWGRYNVIGVRKYWGRREP |
| Ga0310813_103947392 | 3300031716 | Soil | TQHFLFTRFGARDQHLGGADLGPNGPWGRYNTIGVRKYFGTRRY |
| Ga0307474_107306451 | 3300031718 | Hardwood Forest Soil | QRFGSRDQNLGPADLGPNGPWGRYAVIGVRKYFGHRDAQ |
| Ga0307468_1009977291 | 3300031740 | Hardwood Forest Soil | YLGKGFEMRVTQHFLFTRFGARDQHLGGADLGPNGPWGRYNTIGVRKYFGTRRY |
| Ga0307475_101947151 | 3300031754 | Hardwood Forest Soil | RVTQHFLFQRFGARDRYLGPADLGANGPWGRYNVIGVRKYFGHREPD |
| Ga0307475_107737352 | 3300031754 | Hardwood Forest Soil | RFGSRDRYLGPADLGTNGPWGRYNVIGVRKYFGHREP |
| Ga0306925_116033061 | 3300031890 | Soil | SIDIGWGIQARVTQHYLFQRLGARDRNLGPADLGVNGPWGRYTVIGVRKYFGKRRESVD |
| Ga0310910_104077251 | 3300031946 | Soil | RFGTRDKYLGAADLGPNGPWGRYNVIGVRKYFGTRRW |
| Ga0306926_129806282 | 3300031954 | Soil | WGAGIYLGQGFEMRVTQHFLFHRFGTRDKYLGAADLGPNGPWGRYNVIGVRKYFGTRRW |
| Ga0307479_116295391 | 3300031962 | Hardwood Forest Soil | EIGHGFEMRVTQHFLFQRFGARDRYLGPADLGTNGPWGRYNVIGVRKYFGHREAQ |
| Ga0307471_1013607351 | 3300032180 | Hardwood Forest Soil | IGHGFEMRVTQHFLFQRFGARDRYLGPADLGLNGPWGRYNVIGVRKYFGHRAEE |
| Ga0307471_1036105171 | 3300032180 | Hardwood Forest Soil | EMRVTQHFLFDRLGARDRNLGAADLGVNGPWGRYNVIGVRKYFGQRRY |
| Ga0307472_1000364842 | 3300032205 | Hardwood Forest Soil | KGFEVRWTQHFLITRFGARDRNLGPADLGPNGPWGRYNTIGVRKYFGTRRY |
| Ga0306920_1031316552 | 3300032261 | Soil | VYLGKGFEMRVTQHLLFDRLGARDRYLGPADLGPNGPWGRYNAIGIRKYFGTRRWQ |
| Ga0335080_113864821 | 3300032828 | Soil | HVLFQRFGARDRNLGTADLGPNGPWGRYNVIGVRKYWGRREP |
| Ga0335070_106245581 | 3300032829 | Soil | LGKGFEMRVTQHFLFSRFGARDRNLGPADLGPNGPWGRYNTIGVRKYFGTRRY |
| Ga0335070_120337112 | 3300032829 | Soil | IELGHGFQARVTQHFLIQRFGLRAGYLGPADLGPNGPWGRYTVIGVRKYFGYRREGE |
| Ga0335077_110073471 | 3300033158 | Soil | VTQHFLFQRFGARDRNLGPADLGVNGPWGRYTVIGVRKYFGKRRE |
| ⦗Top⦘ |