| Basic Information | |
|---|---|
| Family ID | F031015 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 183 |
| Average Sequence Length | 46 residues |
| Representative Sequence | PGDANSWGRIEIPSAGDGYYDQYRIEVQRTAGSNYTLTSKIVGVR |
| Number of Associated Samples | 63 |
| Number of Associated Scaffolds | 183 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.45 % |
| % of genes from short scaffolds (< 2000 bps) | 88.52 % |
| Associated GOLD sequencing projects | 57 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.31 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.454 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat (72.678 % of family members) |
| Environment Ontology (ENVO) | Unclassified (95.082 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (72.678 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 19.18% Coil/Unstructured: 80.82% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 183 Family Scaffolds |
|---|---|---|
| PF00534 | Glycos_transf_1 | 3.28 |
| PF10124 | Mu-like_gpT | 0.55 |
| PF13439 | Glyco_transf_4 | 0.55 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.45 % |
| Unclassified | root | N/A | 0.55 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2010170001|BISONR_BXAS39919_y2 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 2010170001|BISONR_C769 | All Organisms → cellular organisms → Bacteria | 2326 | Open in IMG/M |
| 2010170003|BISONP_FGGH37661_b1 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300002493|JGI24185J35167_1037312 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
| 3300002510|JGI24186J35511_1023969 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
| 3300003605|JGI26463J51803_1008130 | All Organisms → cellular organisms → Bacteria | 2529 | Open in IMG/M |
| 3300003605|JGI26463J51803_1041862 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300003688|Ga0061020_1027193 | All Organisms → cellular organisms → Bacteria | 1646 | Open in IMG/M |
| 3300005409|Ga0068651_1109599 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300005414|Ga0068646_1121123 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300005452|Ga0068706_1058250 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300005452|Ga0068706_1061795 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300005452|Ga0068706_1067262 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300005452|Ga0068706_1072621 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300005452|Ga0068706_1076884 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300005452|Ga0068706_1086282 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300005453|Ga0068705_10058525 | All Organisms → cellular organisms → Bacteria | 1185 | Open in IMG/M |
| 3300005453|Ga0068705_10121652 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300005453|Ga0068705_10167236 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300005453|Ga0068705_10173972 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300005453|Ga0068705_10178295 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300005453|Ga0068705_10181189 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300005855|Ga0079992_133719 | All Organisms → cellular organisms → Bacteria | 12846 | Open in IMG/M |
| 3300006849|Ga0102029_1302062 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300006945|Ga0073933_1016606 | All Organisms → cellular organisms → Bacteria | 2738 | Open in IMG/M |
| 3300007000|Ga0102499_1330920 | All Organisms → cellular organisms → Bacteria | 1327 | Open in IMG/M |
| 3300010181|Ga0124926_1016007 | Not Available | 789 | Open in IMG/M |
| 3300010189|Ga0124915_1076612 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300010190|Ga0124925_1111581 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300010196|Ga0124923_1050692 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300010196|Ga0124923_1124953 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300010197|Ga0124922_1019667 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300010197|Ga0124922_1163377 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300010257|Ga0124913_1292775 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300010289|Ga0129299_1091376 | All Organisms → cellular organisms → Bacteria | 1019 | Open in IMG/M |
| 3300025373|Ga0209143_1034505 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300026280|Ga0209017_10032140 | All Organisms → cellular organisms → Bacteria | 1347 | Open in IMG/M |
| 3300026509|Ga0209809_1042667 | All Organisms → cellular organisms → Bacteria | 1464 | Open in IMG/M |
| 3300026509|Ga0209809_1055495 | All Organisms → cellular organisms → Bacteria | 1184 | Open in IMG/M |
| 3300026509|Ga0209809_1057287 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
| 3300026509|Ga0209809_1063275 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
| 3300026509|Ga0209809_1065240 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
| 3300026509|Ga0209809_1074106 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300026509|Ga0209809_1094869 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300026509|Ga0209809_1104378 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300026509|Ga0209809_1143791 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300027279|Ga0209691_1047850 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300027279|Ga0209691_1076264 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300028761|Ga0272447_1010570 | All Organisms → cellular organisms → Bacteria | 2607 | Open in IMG/M |
| 3300028761|Ga0272447_1040524 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300031245|Ga0308395_1028896 | All Organisms → cellular organisms → Bacteria | 1678 | Open in IMG/M |
| 3300031245|Ga0308395_1036942 | All Organisms → cellular organisms → Bacteria | 1384 | Open in IMG/M |
| 3300031245|Ga0308395_1038912 | All Organisms → cellular organisms → Bacteria | 1328 | Open in IMG/M |
| 3300031245|Ga0308395_1048286 | All Organisms → cellular organisms → Bacteria | 1128 | Open in IMG/M |
| 3300031245|Ga0308395_1052608 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
| 3300031508|Ga0308394_1010113 | All Organisms → cellular organisms → Bacteria | 3185 | Open in IMG/M |
| 3300031508|Ga0308394_1032576 | All Organisms → cellular organisms → Bacteria | 1359 | Open in IMG/M |
| 3300031508|Ga0308394_1080227 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300031508|Ga0308394_1086917 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300031509|Ga0308399_1026531 | All Organisms → cellular organisms → Bacteria | 1417 | Open in IMG/M |
| 3300031512|Ga0308397_1102426 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300031512|Ga0308397_1114634 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300031513|Ga0308412_1043874 | All Organisms → cellular organisms → Bacteria | 1597 | Open in IMG/M |
| 3300031513|Ga0308412_1053272 | All Organisms → cellular organisms → Bacteria | 1384 | Open in IMG/M |
| 3300031513|Ga0308412_1062329 | All Organisms → cellular organisms → Bacteria | 1232 | Open in IMG/M |
| 3300031513|Ga0308412_1066542 | All Organisms → cellular organisms → Bacteria | 1174 | Open in IMG/M |
| 3300031513|Ga0308412_1190857 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300031513|Ga0308412_1215617 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300031514|Ga0308390_1059173 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300031514|Ga0308390_1080806 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300031514|Ga0308390_1123795 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300031515|Ga0308396_1040296 | All Organisms → cellular organisms → Bacteria | 1092 | Open in IMG/M |
| 3300031515|Ga0308396_1104284 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300031516|Ga0308398_1016439 | All Organisms → cellular organisms → Bacteria | 2313 | Open in IMG/M |
| 3300031516|Ga0308398_1020693 | All Organisms → cellular organisms → Bacteria | 1958 | Open in IMG/M |
| 3300031516|Ga0308398_1033072 | All Organisms → cellular organisms → Bacteria | 1396 | Open in IMG/M |
| 3300031516|Ga0308398_1048361 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
| 3300031517|Ga0308392_1011098 | All Organisms → cellular organisms → Bacteria | 2720 | Open in IMG/M |
| 3300031517|Ga0308392_1081854 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300031517|Ga0308392_1110698 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300031517|Ga0308392_1128864 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300031518|Ga0308389_1025356 | All Organisms → cellular organisms → Bacteria | 2012 | Open in IMG/M |
| 3300031518|Ga0308389_1083059 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300031518|Ga0308389_1102656 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300031518|Ga0308389_1106618 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300031567|Ga0308391_1033702 | All Organisms → cellular organisms → Bacteria | 1200 | Open in IMG/M |
| 3300031567|Ga0308391_1069181 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300031567|Ga0308391_1131916 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300031568|Ga0308393_1009292 | All Organisms → cellular organisms → Bacteria | 3084 | Open in IMG/M |
| 3300031568|Ga0308393_1018228 | All Organisms → cellular organisms → Bacteria | 1948 | Open in IMG/M |
| 3300031568|Ga0308393_1034886 | All Organisms → cellular organisms → Bacteria | 1246 | Open in IMG/M |
| 3300031568|Ga0308393_1113086 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300031568|Ga0308393_1138740 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300031767|Ga0308401_1011870 | All Organisms → cellular organisms → Bacteria | 2082 | Open in IMG/M |
| 3300031767|Ga0308401_1028542 | All Organisms → cellular organisms → Bacteria | 1205 | Open in IMG/M |
| 3300031767|Ga0308401_1044805 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300031767|Ga0308401_1045090 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
| 3300031767|Ga0308401_1047391 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300031767|Ga0308401_1055313 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300031767|Ga0308401_1089788 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300031767|Ga0308401_1101988 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300031767|Ga0308401_1108674 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300031776|Ga0308415_1119962 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300031783|Ga0308418_1017374 | All Organisms → cellular organisms → Bacteria | 2258 | Open in IMG/M |
| 3300031783|Ga0308418_1018001 | All Organisms → cellular organisms → Bacteria | 2199 | Open in IMG/M |
| 3300031783|Ga0308418_1061243 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
| 3300031812|Ga0308411_10060422 | All Organisms → cellular organisms → Bacteria | 1644 | Open in IMG/M |
| 3300031812|Ga0308411_10081817 | All Organisms → cellular organisms → Bacteria | 1298 | Open in IMG/M |
| 3300031812|Ga0308411_10092398 | All Organisms → cellular organisms → Bacteria | 1184 | Open in IMG/M |
| 3300031812|Ga0308411_10107740 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
| 3300031812|Ga0308411_10116032 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300031812|Ga0308411_10117155 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300031812|Ga0308411_10118111 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300031812|Ga0308411_10136868 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300031812|Ga0308411_10142859 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300031812|Ga0308411_10155056 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300031812|Ga0308411_10173737 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300031812|Ga0308411_10186312 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300031812|Ga0308411_10206732 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300031812|Ga0308411_10207330 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300031830|Ga0308409_1014448 | All Organisms → cellular organisms → Bacteria | 2404 | Open in IMG/M |
| 3300031830|Ga0308409_1045532 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
| 3300031830|Ga0308409_1047966 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
| 3300031830|Ga0308409_1070264 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300031830|Ga0308409_1119401 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300031865|Ga0308408_1051361 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
| 3300031865|Ga0308408_1094588 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300031875|Ga0308405_1082513 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300031878|Ga0308404_1047263 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
| 3300031878|Ga0308404_1066489 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300031878|Ga0308404_1073172 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300031948|Ga0308406_1046873 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300031950|Ga0308417_1223953 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300031958|Ga0308410_1019180 | All Organisms → cellular organisms → Bacteria | 2844 | Open in IMG/M |
| 3300031958|Ga0308410_1044247 | All Organisms → cellular organisms → Bacteria | 1499 | Open in IMG/M |
| 3300031958|Ga0308410_1050311 | All Organisms → cellular organisms → Bacteria | 1359 | Open in IMG/M |
| 3300031958|Ga0308410_1069191 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
| 3300031958|Ga0308410_1082402 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300031958|Ga0308410_1122915 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300031966|Ga0308420_1027735 | All Organisms → cellular organisms → Bacteria | 2291 | Open in IMG/M |
| 3300031966|Ga0308420_1054896 | All Organisms → cellular organisms → Bacteria | 1432 | Open in IMG/M |
| 3300031966|Ga0308420_1126643 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300031966|Ga0308420_1179073 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300031966|Ga0308420_1222409 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300031980|Ga0308403_1009121 | All Organisms → cellular organisms → Bacteria | 2501 | Open in IMG/M |
| 3300031980|Ga0308403_1011379 | All Organisms → cellular organisms → Bacteria | 2190 | Open in IMG/M |
| 3300031980|Ga0308403_1014156 | All Organisms → cellular organisms → Bacteria | 1928 | Open in IMG/M |
| 3300031980|Ga0308403_1021681 | All Organisms → cellular organisms → Bacteria | 1486 | Open in IMG/M |
| 3300031980|Ga0308403_1112513 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300032033|Ga0308402_1009407 | All Organisms → cellular organisms → Bacteria | 2329 | Open in IMG/M |
| 3300032033|Ga0308402_1020704 | All Organisms → cellular organisms → Bacteria | 1447 | Open in IMG/M |
| 3300032033|Ga0308402_1044284 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300032033|Ga0308402_1055234 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300032033|Ga0308402_1062299 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300032034|Ga0308407_1017656 | All Organisms → cellular organisms → Bacteria | 1927 | Open in IMG/M |
| 3300032034|Ga0308407_1117385 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300032045|Ga0308400_1017352 | All Organisms → cellular organisms → Bacteria | 1834 | Open in IMG/M |
| 3300032045|Ga0308400_1019255 | All Organisms → cellular organisms → Bacteria | 1717 | Open in IMG/M |
| 3300032045|Ga0308400_1034260 | All Organisms → cellular organisms → Bacteria | 1195 | Open in IMG/M |
| 3300032045|Ga0308400_1049714 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300032045|Ga0308400_1062773 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300032045|Ga0308400_1075497 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300032045|Ga0308400_1104775 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300032045|Ga0308400_1121987 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300032049|Ga0308416_1057216 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300032049|Ga0308416_1083328 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300032056|Ga0308310_1054019 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
| 3300032056|Ga0308310_1076059 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300032056|Ga0308310_1092327 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300032056|Ga0308310_1099028 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300032057|Ga0308421_1124148 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300032356|Ga0308414_1065661 | All Organisms → cellular organisms → Bacteria | 1428 | Open in IMG/M |
| 3300033886|Ga0308413_020993 | All Organisms → cellular organisms → Bacteria | 2264 | Open in IMG/M |
| 3300033886|Ga0308413_035965 | All Organisms → cellular organisms → Bacteria | 1527 | Open in IMG/M |
| 3300033886|Ga0308413_038093 | All Organisms → cellular organisms → Bacteria | 1462 | Open in IMG/M |
| 3300033886|Ga0308413_062840 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
| 3300033886|Ga0308413_164649 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300034647|Ga0372968_032559 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300034648|Ga0372970_060437 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300034649|Ga0372972_005909 | All Organisms → cellular organisms → Bacteria | 2437 | Open in IMG/M |
| 3300034649|Ga0372972_058715 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300034650|Ga0372973_034962 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300034650|Ga0372973_059131 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Hot Spring Phototrophic Mat | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat | 72.68% |
| Anoxygenic And Chlorotrophic | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic | 12.57% |
| Anoxygenic And Chlorotrophic Microbial Mat | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic Microbial Mat | 8.74% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 2.19% |
| Hot Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring | 1.64% |
| Microbial Mat | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Microbial Mat | 1.09% |
| Hot Spring Microbial Mat | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Microbial Mats → Hot Spring Microbial Mat | 0.55% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 0.55% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2010170001 | 3_050719R | Environmental | Open in IMG/M |
| 2010170003 | 5_050719P | Environmental | Open in IMG/M |
| 3300002493 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant MS undermat 2012 | Environmental | Open in IMG/M |
| 3300002510 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant MS upper layer 2012 | Environmental | Open in IMG/M |
| 3300003605 | Freshwater microbial communities from Yellowstone National Park, Wyoming, USA - Fairy Falls C (FF_Mn_C) | Environmental | Open in IMG/M |
| 3300003688 | Coassembly of YNP Bryant MS undermat 2012 and YNP Bryant MS upper layer 2012 | Environmental | Open in IMG/M |
| 3300005409 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1300_B MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005414 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1300(2)_T MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005452 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-B MetaG | Environmental | Open in IMG/M |
| 3300005453 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-T MetaG | Environmental | Open in IMG/M |
| 3300005855 | Freshwater microbial communities from Yellowstone National Park, Wyoming, USA - Fairy Falls B (FF_Mn_B) MetaG (SPADES assembly) | Environmental | Open in IMG/M |
| 3300006849 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1600(2)_T MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300006945 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Dewar Creek DC16 2012 metaG | Environmental | Open in IMG/M |
| 3300007000 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1700(2)_T MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300010181 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1300_B MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300010189 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_2000_T MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300010190 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1400(2)_T MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300010196 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1200_T MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300010197 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1000_T MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300010257 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1800_T MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300010289 | Hot spring microbial mat communities from California, USA to study Microbial Dark Matter (Phase II) - Cone Pool mat layer C metaG | Environmental | Open in IMG/M |
| 3300025373 | Freshwater microbial communities from Yellowstone National Park, Wyoming, USA - Fairy Falls B (FF_Mn_B) MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026280 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant MS undermat 2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300026509 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-T MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027279 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-B MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028761 | Hot spring microbial mat communities from Yellowstone National Park, WY, United States - YNP-CB-013-3 | Environmental | Open in IMG/M |
| 3300031245 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050930_P4 | Environmental | Open in IMG/M |
| 3300031508 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050701_me2 | Environmental | Open in IMG/M |
| 3300031509 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060914_OS12-60 | Environmental | Open in IMG/M |
| 3300031512 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20051001_T8 | Environmental | Open in IMG/M |
| 3300031513 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20070728_OST1-BottomLayer | Environmental | Open in IMG/M |
| 3300031514 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20040719_149 | Environmental | Open in IMG/M |
| 3300031515 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050930_Pe2 | Environmental | Open in IMG/M |
| 3300031516 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20051001_T9 | Environmental | Open in IMG/M |
| 3300031517 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20050624_m2 | Environmental | Open in IMG/M |
| 3300031518 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20040719_148 | Environmental | Open in IMG/M |
| 3300031567 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20050623_t1 | Environmental | Open in IMG/M |
| 3300031568 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050630_ee2 | Environmental | Open in IMG/M |
| 3300031767 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060913_OS-M1 | Environmental | Open in IMG/M |
| 3300031776 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090730_OS55 | Environmental | Open in IMG/M |
| 3300031783 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090729_R4cd | Environmental | Open in IMG/M |
| 3300031812 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20070728_OST2-BottomLayer | Environmental | Open in IMG/M |
| 3300031830 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060912_MSe4 | Environmental | Open in IMG/M |
| 3300031865 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060912_MSe3 | Environmental | Open in IMG/M |
| 3300031875 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060912_MS13 | Environmental | Open in IMG/M |
| 3300031878 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060914_OS-M4 | Environmental | Open in IMG/M |
| 3300031948 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060911_MSe1 | Environmental | Open in IMG/M |
| 3300031950 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090730_OS65 | Environmental | Open in IMG/M |
| 3300031958 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20070728_OST2-MatCore | Environmental | Open in IMG/M |
| 3300031966 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090730_MS55 | Environmental | Open in IMG/M |
| 3300031980 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060914_OS-M3 | Environmental | Open in IMG/M |
| 3300032033 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060913_OS-M2 | Environmental | Open in IMG/M |
| 3300032034 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060911_MSe2 | Environmental | Open in IMG/M |
| 3300032045 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060914_OS12-65 | Environmental | Open in IMG/M |
| 3300032049 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090730_OS60 | Environmental | Open in IMG/M |
| 3300032056 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090730_MS65 | Environmental | Open in IMG/M |
| 3300032057 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090730_MS60 | Environmental | Open in IMG/M |
| 3300032356 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090730_OS50 | Environmental | Open in IMG/M |
| 3300033886 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090729_t10cd | Environmental | Open in IMG/M |
| 3300034647 | Metatranscriptome of hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050701_0600_MSt7 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034648 | Metatranscriptome of hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050701_1000_MSt9 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034649 | Metatranscriptome of hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050701_1400_MSt11 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034650 | Metatranscriptome of hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050701_1600_MSt12 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| BISONR_439400 | 2010170001 | Hot Spring | WGRIEIPSTGDGYYDQYRIEVQRTAGSSNYNLLSKIVGVR |
| BISONR_21640 | 2010170001 | Hot Spring | IEIAATTDGYYDQYRIEVQRTAGSNYSLTSKIVGVR |
| BISONP_676480 | 2010170003 | Hot Spring | ANSWGRIEIPSTGDGYYDQYRIEVYRTDGNNYTLTSKLIGVRG |
| JGI24185J35167_10373121 | 3300002493 | Anoxygenic And Chlorotrophic Microbial Mat | NSWGRIEIPSAGDGYYDQYRIEVRRTTGDNNYFLTSKIVGVR* |
| JGI24186J35511_10239692 | 3300002510 | Anoxygenic And Chlorotrophic Microbial Mat | NANEWGRIEIPSAGDGYYDQYRIEVYRTDGSNYTLTSKLIGVRG* |
| JGI26463J51803_10081303 | 3300003605 | Freshwater | WGRIEIPSTGDGYYDQYRIEVQRTAGSNYPLTSKILGVR* |
| JGI26463J51803_10418621 | 3300003605 | Freshwater | WGRIEIPSTGDGYYDQYRIEVQRTAGSNYALTSKILGVR* |
| Ga0061020_10271931 | 3300003688 | Anoxygenic And Chlorotrophic Microbial Mat | TWGRIEIPSAGDGYYDQYRIEVQRTAGSNYVLTSKIVGVR* |
| Ga0068651_11095992 | 3300005409 | Anoxygenic And Chlorotrophic Microbial Mat | NSWGRIEIPDGDDGYYDQYRVEVYRTDGNNYTLTSKLIGVRG* |
| Ga0068646_11211232 | 3300005414 | Anoxygenic And Chlorotrophic Microbial Mat | ANSWGRIEIPTAGDGYYDQYRIEVYRTDGSNYTLTSKLIGVRG* |
| Ga0068706_10582501 | 3300005452 | Anoxygenic And Chlorotrophic | IVPATPLPGGANSWGRIEIPSAGDGYYDQYRIEVRRTAGSAYSLASKIVGVR* |
| Ga0068706_10617951 | 3300005452 | Anoxygenic And Chlorotrophic | WQELIADTLPGGANSWGRIEIPTWDSGYYDQYRIEVRRTSGSSNYTLTSKIVGVR* |
| Ga0068706_10672621 | 3300005452 | Anoxygenic And Chlorotrophic | NTWGRIEIPASSDGYYDQYRIEVQRTGGSGYTLTSKIVGVR* |
| Ga0068706_10726211 | 3300005452 | Anoxygenic And Chlorotrophic | EANTWGRIEIPSAGDGYYDQYRIEVQRTAGSSYTLTSKIVGVR* |
| Ga0068706_10768842 | 3300005452 | Anoxygenic And Chlorotrophic | QEIVPATPLPGDANSWGRIDIPSAGDGYYDQYRIEVRRTAGNNYTLTSKIVGVR* |
| Ga0068706_10862822 | 3300005452 | Anoxygenic And Chlorotrophic | QEIVPATPLPGGANSWGRIEIPASGDGYYDQYRIEVRRTAGSGYILTNKIVGVR* |
| Ga0068705_100585252 | 3300005453 | Anoxygenic And Chlorotrophic | VPATPLPGEANTWGRIEIPSAGDGYYDQYRIEVRRTGGSSNYTLTSKIVGVR* |
| Ga0068705_101216522 | 3300005453 | Anoxygenic And Chlorotrophic | WQEIAPPTPLPGEANTWGRIEIPSAGDGYYDQYRIEVRRTAGSGYSLTSKIVGVR* |
| Ga0068705_101672361 | 3300005453 | Anoxygenic And Chlorotrophic | WEVVIPPTALPGDANSWGRIEIPSAGDGYYDQYRIEVRRTGGSGYTLTSKIVGVR* |
| Ga0068705_101739722 | 3300005453 | Anoxygenic And Chlorotrophic | TLPGGANSWGRIEIPASSDGYYDQYRIEVRRTAGDNYILTSKIVGVR* |
| Ga0068705_101782951 | 3300005453 | Anoxygenic And Chlorotrophic | PGEANTWGRIEIPASGDGYYDQYRIEVQRTAGSNYYLTSKIVGVR* |
| Ga0068705_101811891 | 3300005453 | Anoxygenic And Chlorotrophic | NSWGRIEIPASSDGYYDQYRIEVRRTAGDSNYNLLSKIVGVR* |
| Ga0079992_1337192 | 3300005855 | Freshwater | EIVPATTLPGGANSWGRIEIPTAGDGYYDQYRIEVRLTSGSSYLLTSKIVGVR* |
| Ga0102029_13020621 | 3300006849 | Anoxygenic And Chlorotrophic Microbial Mat | ELATGTLPGDANSWNRIEIPATTDGYYDQYRIEVWRTAGSNYTLASKVIGVR* |
| Ga0073933_10166063 | 3300006945 | Hot Spring Sediment | ANTWGRIEIPASGDGYYDQYRIEVQRTGGSDYALTSKIIGVR* |
| Ga0102499_13309202 | 3300007000 | Anoxygenic And Chlorotrophic Microbial Mat | RIEIPSAGDGYYDQYRIEVRRTAGSSYSLTSKIVGVR* |
| Ga0124926_10160071 | 3300010181 | Anoxygenic And Chlorotrophic Microbial Mat | ANELPGGANSWNRIEIPMTDGYYDQYRIEVWRTAVSNYTLASKVIGVR* |
| Ga0124915_10766121 | 3300010189 | Anoxygenic And Chlorotrophic Microbial Mat | GWQQLAQANLPGNANEWGRIEIPSAGDGYYDQYRIEVYRTDGSNYTLISKLIGVRG* |
| Ga0124925_11115812 | 3300010190 | Anoxygenic And Chlorotrophic Microbial Mat | EIPTTGDGYYDQYRVEVYRTDGNNYTLTSKLIGVRG* |
| Ga0124923_10506922 | 3300010196 | Anoxygenic And Chlorotrophic Microbial Mat | VVIPPTALPGDANSWGRIEIPSAGDGYYDQYRIEVRRTAGSGYSLASKIVGVR* |
| Ga0124923_11249532 | 3300010196 | Anoxygenic And Chlorotrophic Microbial Mat | EWGRIEIPSAGDGYYDQYRIEVYRTDGSNYTLTSKLIGVRG* |
| Ga0124922_10196672 | 3300010197 | Anoxygenic And Chlorotrophic Microbial Mat | WGRIEIPASGDGYYDQYRIEVWRTAGSNYDLTSKIVGVR* |
| Ga0124922_11633771 | 3300010197 | Anoxygenic And Chlorotrophic Microbial Mat | RIEIPSAGDGYYDQYRIEVRRTSGSNYTLTSKIVGVR* |
| Ga0124913_12927751 | 3300010257 | Anoxygenic And Chlorotrophic Microbial Mat | WEVVIPPTALPGDANSWGRIEIPSAGDGYYDQYRIEVQRTAGSSNYNLISKIVGVR* |
| Ga0129299_10913762 | 3300010289 | Hot Spring Microbial Mat | PGGANSWGRIDIPATTDGYYDQYRIEVQRTAGSNYTLTSKIVGVR* |
| Ga0209143_10345051 | 3300025373 | Freshwater | EIVPATTLPGGANSWGRIEIPTAGDGYYDQYRIEVRLTSGSSYLLTSKIVGVR |
| Ga0209017_100321402 | 3300026280 | Anoxygenic And Chlorotrophic Microbial Mat | WGRIEIPSAGDGYYDQYRIEVRRTAGSGYSLASKIVGVR |
| Ga0209809_10426672 | 3300026509 | Anoxygenic And Chlorotrophic | ANTWGRIEIPSAGDGYYDQYRIEVRRTGGSNNYTLTSKIVGVR |
| Ga0209809_10554951 | 3300026509 | Anoxygenic And Chlorotrophic | WQEIVPATPLPGEANTWGRIEIPSAGDGYYDQYRIEVRRTAGNNYTLTSKIVGVR |
| Ga0209809_10572871 | 3300026509 | Anoxygenic And Chlorotrophic | GWQEIVPATPLPGGANSWGRIEIPASGDGYYDQYRIEVRRTAGSGYSLASKIVGVR |
| Ga0209809_10632751 | 3300026509 | Anoxygenic And Chlorotrophic | EANTWGRIEIPSASDGYYDQYRIEVRRTGGSGYTLTSKIVGVR |
| Ga0209809_10652402 | 3300026509 | Anoxygenic And Chlorotrophic | QEIVPATPLPGEANTWGRIEIPSAGDGYYDQYRIEVRRTAGSNYALTSKIVGVR |
| Ga0209809_10741061 | 3300026509 | Anoxygenic And Chlorotrophic | WGRIDIPSAGDGYYDQYRIEVRRTGGSGYTLTSKIVGVR |
| Ga0209809_10948691 | 3300026509 | Anoxygenic And Chlorotrophic | GRIEIPSTGDGYYDQYRIEVQRTAGSNYNLTSKIVGVR |
| Ga0209809_11043781 | 3300026509 | Anoxygenic And Chlorotrophic | LPGEANSWGRIEIPATTDGYYDQYRIEVRRTAGDSNYSLTSKIVGVR |
| Ga0209809_11437911 | 3300026509 | Anoxygenic And Chlorotrophic | LPGGANEWARIEIPASSDGYYDQYRIEVRRTTGDNNYFLTSKIVGVR |
| Ga0209691_10478501 | 3300027279 | Anoxygenic And Chlorotrophic | NTWGRIEIPSAGDGYYDQYRIEVRRTAGSGYSLASKIVGVR |
| Ga0209691_10762642 | 3300027279 | Anoxygenic And Chlorotrophic | NTWGRIEIPASSDGYYDQYRIEVQRTGGSGYTLTSKIVGVR |
| Ga0272447_10105701 | 3300028761 | Microbial Mat | LPGGANTHNRIEIPSAGDGYYDQYRIEVQRTAGSNYTLTSKIVGVR |
| Ga0272447_10405241 | 3300028761 | Microbial Mat | SSWGRIEIPASGDGYYDQYRIEVRLTAGSGYSLTSKIVGVR |
| Ga0308395_10288961 | 3300031245 | Hot Spring Phototrophic Mat | RIEIPATTDGYYDQYRIEVWRTADSNYTLASKVIGVR |
| Ga0308395_10369421 | 3300031245 | Hot Spring Phototrophic Mat | GDANTWGRIDIPASGDGYYDQYRIVVERTSGSGYSLINKIVGVRG |
| Ga0308395_10389121 | 3300031245 | Hot Spring Phototrophic Mat | WITLATGTLPGEANTWGRIEIPASGDGYYDQYRIEVQRTAGSGYILTNKIVGVR |
| Ga0308395_10482862 | 3300031245 | Hot Spring Phototrophic Mat | QEIVPATPLPGNANSWGRIEIPTAGDGYYDQYRIEVYRTNDNENNYILTSKLIGVRG |
| Ga0308395_10526082 | 3300031245 | Hot Spring Phototrophic Mat | WQEIVPATPLPGEANTWGRIEIPSAGDGYYDQYRIEVRRTAGIGYSLASKIVGVR |
| Ga0308394_10101133 | 3300031508 | Hot Spring Phototrophic Mat | GANSWGRIEIPASGDGYYDQYRIEVQRTAGGQYNLTSKIVGVR |
| Ga0308394_10325762 | 3300031508 | Hot Spring Phototrophic Mat | WITLATGTLPGEANTWGRIEIPSADDGYYDQYRIEVQRTAGSNYTLTSKIVGVR |
| Ga0308394_10802271 | 3300031508 | Hot Spring Phototrophic Mat | NSWGRIEIPTTGDGYYDQYRVEVYRTDGNNYTLTSKLIGVRG |
| Ga0308394_10869171 | 3300031508 | Hot Spring Phototrophic Mat | PGGANSWGRIEIPASSDGYYDQYRIEVQRTAGSGYILTNKIVGVR |
| Ga0308399_10265311 | 3300031509 | Hot Spring Phototrophic Mat | RIEIPSTGDGYYDQYRIEVQRTAGSNYILTSKIVGVR |
| Ga0308397_11024261 | 3300031512 | Hot Spring Phototrophic Mat | ASYWGRIEIPATTDGYYDQYRIEVWRTAGNNYTLTSKIVGVR |
| Ga0308397_11146341 | 3300031512 | Hot Spring Phototrophic Mat | NSWGRIEIPASSDGYYDQYRIEVRRTTGDNNYFLTSKIVGVR |
| Ga0308412_10438742 | 3300031513 | Hot Spring Phototrophic Mat | GWQELVADTLPGGANTWGRIEIPSAGDGYYDQYRIEVRRTAGSNYFLTSKIVGVR |
| Ga0308412_10532721 | 3300031513 | Hot Spring Phototrophic Mat | VPATPLPGEANSWGRIEIPASSDGYYDQYRIEVQRTAGSNYNLISKIVGVR |
| Ga0308412_10623291 | 3300031513 | Hot Spring Phototrophic Mat | GASSWGRIEIPASGDGYYDQCRIEVQRTAGSNYALTSKIVGVR |
| Ga0308412_10665421 | 3300031513 | Hot Spring Phototrophic Mat | PGGANSWGRIEIPASSDGYYDQYRIEVRRTDGSNYSLTSKIVGVR |
| Ga0308412_11908572 | 3300031513 | Hot Spring Phototrophic Mat | WGRIEIPASGDGYYDQYRIEVWRTAGSNYDLTSKIVGVR |
| Ga0308412_12156172 | 3300031513 | Hot Spring Phototrophic Mat | LPGEANTWGRIEIPNAGDGYYDQYRIEVRRTGGSSNYTLTSKIVGVR |
| Ga0308390_10591732 | 3300031514 | Hot Spring Phototrophic Mat | TLPGNANSWGRIEIPTAGDGYYDQYRIEVYRTDGSNYTLTSKLIGVRG |
| Ga0308390_10808062 | 3300031514 | Hot Spring Phototrophic Mat | LATGTLPGGANSWGRIEIPASGDGYYDQYRIEVQRTAGGQYNLTSKIVGVR |
| Ga0308390_11237952 | 3300031514 | Hot Spring Phototrophic Mat | NANEWGRIEIPSAGDGYYDQYRIEVYRTDGSNYTLTSKLIGVRG |
| Ga0308396_10402962 | 3300031515 | Hot Spring Phototrophic Mat | PGANSWGRIEIPTTGDGYYDQYRVEVYRTDGNNYTLTSKLIGVRG |
| Ga0308396_11042842 | 3300031515 | Hot Spring Phototrophic Mat | VPATPLPGGANSWGRIEIPSAGDGYYDQYRIEVRRTAGGQYNLTSKIVGVR |
| Ga0308398_10164392 | 3300031516 | Hot Spring Phototrophic Mat | GTGWITLATGTLPGEANTWGRIEIPSAGDGYYDQYRIEVQRTAGSNYTLTSKIVGVR |
| Ga0308398_10206931 | 3300031516 | Hot Spring Phototrophic Mat | GGANSWGRIEIPASGDGYYDQYRIEVQRTAGSNYILTNKIVGVR |
| Ga0308398_10330722 | 3300031516 | Hot Spring Phototrophic Mat | TLPGGANSWGRIEIPSAGDAYYDQYRIEVRRTTGDNNYFLTSKIVGVR |
| Ga0308398_10483612 | 3300031516 | Hot Spring Phototrophic Mat | QELVADTLPGGANTWGRIEIPSAGDGYYDQYRIEVRRTAGSNYFLTSKIVGVR |
| Ga0308392_10110981 | 3300031517 | Hot Spring Phototrophic Mat | GGANSWGRIEIPASSDGYYDQYRIEVRLTAGNNYLLTSKIVGVR |
| Ga0308392_10818542 | 3300031517 | Hot Spring Phototrophic Mat | PPGANSWGRIEIPTTGDGYYDQYRIEVYRTDGGNYILTSKLIGVRG |
| Ga0308392_11106982 | 3300031517 | Hot Spring Phototrophic Mat | ATGTLLGGANSWGRIEIPSAGDGYYDQYRIEVRRTAGDNNYILTSKIVGVR |
| Ga0308392_11288642 | 3300031517 | Hot Spring Phototrophic Mat | WQELATGTLPPGANSWGRIEIPTTSDGYYDQYRVEVYRTDGGNYTLTSKLIGVRG |
| Ga0308389_10253562 | 3300031518 | Hot Spring Phototrophic Mat | QELATGTLPGGANSWGRIEIPASGDGYYDQYRIEVQRTAGSNYILTNKIVGVR |
| Ga0308389_10830591 | 3300031518 | Hot Spring Phototrophic Mat | LAQANLPGNANEWGRIEIPTAGDGYYDQYRIEVYRTDGSNYTLTSKLIGVRG |
| Ga0308389_11026562 | 3300031518 | Hot Spring Phototrophic Mat | IPSAGDAYYDQYRIEVRRTTGDNNYFLTSKIVGVR |
| Ga0308389_11066182 | 3300031518 | Hot Spring Phototrophic Mat | TTLPGGANSWGRIEIPSAGDGYYDQYRIEVRRTAGSNYTLTSKIVGVR |
| Ga0308391_10337021 | 3300031567 | Hot Spring Phototrophic Mat | ITLATGTLPGEANTWGRIEIPASGDGYYDQYRIEVWRTAGSSNHNLTSKIVGVR |
| Ga0308391_10691812 | 3300031567 | Hot Spring Phototrophic Mat | PATTLPGGANSWGRIEIPASSDGYYDQYRIEVRLTAGSSYALTSKIVGVR |
| Ga0308391_11319162 | 3300031567 | Hot Spring Phototrophic Mat | PGDANSWGRIEIPSAGDGYYDQYRIEVQRTAGSNYTLTSKIVGVR |
| Ga0308393_10092921 | 3300031568 | Hot Spring Phototrophic Mat | EIPTWDSGYYDQYRIEVRRTAGSNYTLTSKIVGVR |
| Ga0308393_10182282 | 3300031568 | Hot Spring Phototrophic Mat | WGRIEIPSAGDGYYDQYRIEVQRTAGSNYALTSKIVGVR |
| Ga0308393_10348862 | 3300031568 | Hot Spring Phototrophic Mat | QELATGTLPPGANSWGRIEIPTTGDGYYDQYRVEVYRTDGSNYTLTSKLIGVRG |
| Ga0308393_11130862 | 3300031568 | Hot Spring Phototrophic Mat | ATPLPGEANTWGRIEIPSAGDGYYDQYRIEVRRTGGSGYMLTSKIVGVR |
| Ga0308393_11387402 | 3300031568 | Hot Spring Phototrophic Mat | EANTWGRIEIPASGDGYYDQYRIEVWRTAGSSNHNLTSKIVGVR |
| Ga0308401_10118702 | 3300031767 | Hot Spring Phototrophic Mat | GWEVVIPPTALPGDANSWGRIEIPSAGDGYYDQYRIEVQRTAGSNYTLTSKIVGVR |
| Ga0308401_10285421 | 3300031767 | Hot Spring Phototrophic Mat | WQELATGTLPGGANSWGRIEIPSAGDGYYDQYRIEVRRTSGSNYTLTSKIVGVR |
| Ga0308401_10448052 | 3300031767 | Hot Spring Phototrophic Mat | LPGGANSWGRIEIPASGDGYYDQYRIEVRRTAGDNNYILTSKIVGVR |
| Ga0308401_10450901 | 3300031767 | Hot Spring Phototrophic Mat | LPGDANSWGRIEIPSAGDGYYDQYRIEVQRTAGSSNYNLISKIVGVR |
| Ga0308401_10473911 | 3300031767 | Hot Spring Phototrophic Mat | WITLATGTLPGGANSWGRIEIPSTGDGYYDQYRIEVRRTAGDSNYNLTSKIVGVR |
| Ga0308401_10553131 | 3300031767 | Hot Spring Phototrophic Mat | LPGEANTWGRIEIPASNDGYYDQYRIEVQRTAGSNYALTSKIVGVR |
| Ga0308401_10897882 | 3300031767 | Hot Spring Phototrophic Mat | PGDANSWGRIEIPSTGDGYYDQYRIEVQRTAGSNYILTSKIVGVR |
| Ga0308401_11019882 | 3300031767 | Hot Spring Phototrophic Mat | GGGWITLATGTLPGEANTWGRIEIPSAGDGYYDQYRIEVQRTAGSSYVLTSKIVGVR |
| Ga0308401_11086742 | 3300031767 | Hot Spring Phototrophic Mat | TPLPGEANTWGRIEIPSAGDGYYDQYRIEVRRTGGSSYSLTSKIVGVR |
| Ga0308415_11199622 | 3300031776 | Hot Spring Phototrophic Mat | WQLLATGTLPGEANSWGRIEIPATTDGYYDQYRIEVQRTSGDSNYNLTSKIVGVR |
| Ga0308418_10173741 | 3300031783 | Hot Spring Phototrophic Mat | LPGGANSWGRIEIPSAGDGYYDQYRIEVQRTGGSNYNLISKIVGVR |
| Ga0308418_10180012 | 3300031783 | Hot Spring Phototrophic Mat | GWQEIVPATTLPGGANSWGRIEIPSAGDGYYDQYRIEVRRTAGSNYTLTSKIVGVR |
| Ga0308418_10612431 | 3300031783 | Hot Spring Phototrophic Mat | TLPGASDPNASYWGRIEIPATTDGYYDQYRIEVQRTAGSGYTLTSKIVGVR |
| Ga0308411_100604222 | 3300031812 | Hot Spring Phototrophic Mat | EIPSAGDGYYDQYRIEVRLTAGSGYSLTSKIVGVR |
| Ga0308411_100818172 | 3300031812 | Hot Spring Phototrophic Mat | GTGWQELAQADLPGNANEWGRIEIPTTGDGYYDQYRIEVYRTDGSNYTLTSKLIGVRG |
| Ga0308411_100923982 | 3300031812 | Hot Spring Phototrophic Mat | NSWGRIEIPTTGDGYYDQYRIEVRLTDGSNYSLTSKIVGVR |
| Ga0308411_101077402 | 3300031812 | Hot Spring Phototrophic Mat | WGRIEIPSAGDGYYDQYRIEVQRTAGSNYTLTSKIVGVR |
| Ga0308411_101160322 | 3300031812 | Hot Spring Phototrophic Mat | GWQELATGPLPGEANTWGRIEIPSAGDGYYDQYRIEVRRTGGSNYTLTSKIVGVR |
| Ga0308411_101171552 | 3300031812 | Hot Spring Phototrophic Mat | TGTLPGEANTWGRIEIPSAGDGYYDQYRIEVWRTAGSNYGLTSKILGVR |
| Ga0308411_101181111 | 3300031812 | Hot Spring Phototrophic Mat | EIPSAGDAYYDQYRIEVRRTAGDSNYSLTSKIVGVR |
| Ga0308411_101368682 | 3300031812 | Hot Spring Phototrophic Mat | TQLPGAANSWGRIEIPATTDGYYDQYRIEVQRTAGSNYFLTSKIVGVR |
| Ga0308411_101428592 | 3300031812 | Hot Spring Phototrophic Mat | LPGGANSWNRIEIPSAGDGYYDQYRIEVRLTSGSNYPLTSKIVGVR |
| Ga0308411_101550561 | 3300031812 | Hot Spring Phototrophic Mat | RIEIPSAGDGYYDQYRIEVQRTGGSNYALTSKIVGVR |
| Ga0308411_101737371 | 3300031812 | Hot Spring Phototrophic Mat | EANTWGRIEIPSAGDGYYDQYRIEVRRTGGSGYTLTSKIVGVR |
| Ga0308411_101863121 | 3300031812 | Hot Spring Phototrophic Mat | PATPLPGAANSWGRIEIPSAGDGYYDQYRIEVQRTGGSSYTLTSKIVGVR |
| Ga0308411_102067321 | 3300031812 | Hot Spring Phototrophic Mat | ANSWGRIEIPSAGDGYYDQYRIEVQRTAGSNYILTSKIVGVR |
| Ga0308411_102073301 | 3300031812 | Hot Spring Phototrophic Mat | GGANSWGRIEIPSTGDGYYDQYRIEVQRTAGSNYSLTSKIVGVR |
| Ga0308409_10144483 | 3300031830 | Hot Spring Phototrophic Mat | GRIEIPSAGDGYYDQYRIEVRRTAGDNYILTSKIVGVR |
| Ga0308409_10455322 | 3300031830 | Hot Spring Phototrophic Mat | WGRIEIPASSDGYYDQYRIEVQRTGGSNNYTLTSKIVGVR |
| Ga0308409_10479662 | 3300031830 | Hot Spring Phototrophic Mat | GRIEIPSTGDGYYDQYRIEVQRTAGSNYALTSKILGVR |
| Ga0308409_10702641 | 3300031830 | Hot Spring Phototrophic Mat | GRIEIPATTDGYYDQYRIEVQRTAGSNYNLTSKIVGVR |
| Ga0308409_11194012 | 3300031830 | Hot Spring Phototrophic Mat | IPSAGDGYYDQYRVEVYRTDGNNYTLTSKLIGVRG |
| Ga0308408_10513611 | 3300031865 | Hot Spring Phototrophic Mat | IADTLPGGANSWGRIEIPAWDSGYYDQYRIEVQRTGGSNYALTSKIVGVR |
| Ga0308408_10945882 | 3300031865 | Hot Spring Phototrophic Mat | IEIPSAGDGYYDQYRIEVQRTGGSNYNLISKIVGVR |
| Ga0308405_10825131 | 3300031875 | Hot Spring Phototrophic Mat | DTLPGGANTWGRIEIPSAGDGYYDQYRIEVRRTAGSNYFLTSKIVGVR |
| Ga0308404_10472632 | 3300031878 | Hot Spring Phototrophic Mat | TGTLPGEANTWGRIEIPASGDGYYDQYRIEVQRTAGSSYVLTSKIVGVR |
| Ga0308404_10664891 | 3300031878 | Hot Spring Phototrophic Mat | NSWERIEIPSAGDGYYDQYRIEVQRTAGNNYTLVSKIVGVR |
| Ga0308404_10731722 | 3300031878 | Hot Spring Phototrophic Mat | APPTPLPGEANTWGRIEIPSAGDGYYDQYRIEVRRTAGSNYVLTSKIAGVR |
| Ga0308406_10468732 | 3300031948 | Hot Spring Phototrophic Mat | EIPSAGDGYYDQYRIEVRRTAGSNYFLTSKIVGVR |
| Ga0308417_12239532 | 3300031950 | Hot Spring Phototrophic Mat | WGRIEIPSAGDGYYDQYRIEVQRTAGSNYPLTSKIVGVR |
| Ga0308410_10191801 | 3300031958 | Hot Spring Phototrophic Mat | GWITLATGTLPGEANTWGRIEIPSAGDGYYDQYRIEVWRTAGSNYTLTSKIVGVR |
| Ga0308410_10442472 | 3300031958 | Hot Spring Phototrophic Mat | IPSAGDGYYDQYRVEVYRTDGSNYTLTSKLIGVRG |
| Ga0308410_10503111 | 3300031958 | Hot Spring Phototrophic Mat | GTLPGEANTWGRIEIPATTDGYYDQYRIEVQRTAGSNYSLTSKIVGVR |
| Ga0308410_10691911 | 3300031958 | Hot Spring Phototrophic Mat | LPGGANSWGRIEIPSAGDGYYDQYRIEVQRTAGSNYVLTSKIVGVR |
| Ga0308410_10824022 | 3300031958 | Hot Spring Phototrophic Mat | EIPSASDGYYDQYRIEVQRTAGSSNYSLTSKIVGVR |
| Ga0308410_11229151 | 3300031958 | Hot Spring Phototrophic Mat | EANTWGRIEIPNAGDGYYDQYRIEVRRTGGSGYTLTSKIVGVR |
| Ga0308420_10277352 | 3300031966 | Hot Spring Phototrophic Mat | WQELATGTLPGGANSWGRIEIPSAGDGYYDQYRIEVRRTSGSSNYTLTSKIVGVR |
| Ga0308420_10548961 | 3300031966 | Hot Spring Phototrophic Mat | GDANSWGRIEIPATTDGYYDQYRIEVWRTAGSNYTLASKVIGVR |
| Ga0308420_11266431 | 3300031966 | Hot Spring Phototrophic Mat | LPGEANTWGRIEIPSAGDGYYDQYRIEVRRTAGSNYALTSKIVGVR |
| Ga0308420_11790732 | 3300031966 | Hot Spring Phototrophic Mat | TTLPGGANSWGRIEIPSAGDGYYDQYRIEVQRTGGSSNYTLTSKIVGVR |
| Ga0308420_12224091 | 3300031966 | Hot Spring Phototrophic Mat | TTLPGAANSWNRIEIPATTDGYYDQYRIEVQRTAGSNYTLTSKIVGVR |
| Ga0308403_10091211 | 3300031980 | Hot Spring Phototrophic Mat | ALPGDANSWGRIEIPSAGDGYYDQYRIEVQRTAGSNYTLTSKIVGVR |
| Ga0308403_10113791 | 3300031980 | Hot Spring Phototrophic Mat | LEDALPGGANSWGRIEIPSASDGYYDQYRIEVRRTAGDSNYSLTSKIVGVR |
| Ga0308403_10141561 | 3300031980 | Hot Spring Phototrophic Mat | TLPGGANSWGRIEIPASGDGYYDQYRIEVQRTAGGQYNLTSKIVGVR |
| Ga0308403_10216811 | 3300031980 | Hot Spring Phototrophic Mat | IEIPATTDGYYDQYRIEVQRTAGSNYTLTSKIVGVR |
| Ga0308403_11125132 | 3300031980 | Hot Spring Phototrophic Mat | EIPTTGDGYYDQYRVEVYRTDGNNYTLTSKLIGVRG |
| Ga0308402_10094071 | 3300032033 | Hot Spring Phototrophic Mat | NSWGRIEIPSAGDGYYDQYRIEVQRTGGSSNYTLTSKIVGVR |
| Ga0308402_10207041 | 3300032033 | Hot Spring Phototrophic Mat | LPGEANTWGRIETPASSDGYYDQYRIEVQRTAGSNYALTSKIVGVR |
| Ga0308402_10442841 | 3300032033 | Hot Spring Phototrophic Mat | ATTLPGGANSWGRIEIPSAGDGYYDQYRIEVQRTAGSSNYTLTSKIVGVR |
| Ga0308402_10552342 | 3300032033 | Hot Spring Phototrophic Mat | LPGGASSWGRIEIPSAGDGYYDQYRIEVQRTAGSNYALTSKIVGVR |
| Ga0308402_10622991 | 3300032033 | Hot Spring Phototrophic Mat | WGRIEIPISEGYYDQYRIEVRRTAGDNNYNLISKIVGVR |
| Ga0308407_10176561 | 3300032034 | Hot Spring Phototrophic Mat | ANSWGRIEIPSAGDGYYDQYRIEVQRTAGSSNYNLISKIVGVR |
| Ga0308407_11173851 | 3300032034 | Hot Spring Phototrophic Mat | QELATGTLSGEANSWGRIEIPATTDGYYDQYRIEVQRTSGDSNYNLTSKIVGVR |
| Ga0308400_10173522 | 3300032045 | Hot Spring Phototrophic Mat | LATGTLPGDASTWGRIEIPSAGDGYYDQYRIEVQRTAGNNYILTSKIVGVR |
| Ga0308400_10192551 | 3300032045 | Hot Spring Phototrophic Mat | ATGTLPGEANTWGRIEIPASGDGYYDQYRIEVQRTAGSSYSLTSKIVGVR |
| Ga0308400_10342601 | 3300032045 | Hot Spring Phototrophic Mat | PPTALPGDANSWGRIEIPSAGDGYYDQYRIEVQRTAGSSNYNLISKIVGVR |
| Ga0308400_10497142 | 3300032045 | Hot Spring Phototrophic Mat | SWGRIEIPASGDGYYDQYRIEVQRTAGSNYVLTSKILGVR |
| Ga0308400_10627731 | 3300032045 | Hot Spring Phototrophic Mat | LATGTLPGEANSWGRIEIPSAGDGYYDQYRIGVQRTAGSNYTLTSKIVGVR |
| Ga0308400_10754971 | 3300032045 | Hot Spring Phototrophic Mat | PGGANSWGRIEIPSAGDGYYDQYRIEVQRTAGSNYALISKIVGVR |
| Ga0308400_11047752 | 3300032045 | Hot Spring Phototrophic Mat | QLVVDTLPGGANSWGRIEIPSAGDGYYDQYRIEVQRTAGSSNYILTSKIVGVR |
| Ga0308400_11219871 | 3300032045 | Hot Spring Phototrophic Mat | VPPTPLPGEANTWGRIEIPSAGDGYYDQYRIEVRRTAGSGYSLTSKIVGVR |
| Ga0308416_10572161 | 3300032049 | Hot Spring Phototrophic Mat | EIPSTGDGYYDQYRIEVQRTAGNSSYILTSKIVGVR |
| Ga0308416_10833282 | 3300032049 | Hot Spring Phototrophic Mat | WGRIEIPSAGDGYYDQYRIEVQRTGSSNYSLTSKIVGVR |
| Ga0308310_10540191 | 3300032056 | Hot Spring Phototrophic Mat | ATGTLPGASDPNASYWGRIEIPSTGDGYYDQYRIEVQRTAGSNYILTSKIVGVR |
| Ga0308310_10760592 | 3300032056 | Hot Spring Phototrophic Mat | ATTLPGGANSWGRIEIPASSDGYYDQYRIEVQRTAGSNYILTNKIVGVR |
| Ga0308310_10923272 | 3300032056 | Hot Spring Phototrophic Mat | SWGRIEIPSTGDGYYDQYRIEVQRTAGSNYNLTSKIVGVR |
| Ga0308310_10990281 | 3300032056 | Hot Spring Phototrophic Mat | GRLEIPATGDAYYDQYRIVVERTSGSGYSLISKIVGVR |
| Ga0308421_11241482 | 3300032057 | Hot Spring Phototrophic Mat | TTLPGAANSWNRIEIPATTDGYYDQYRIEVQRTSGSNYALTSKIVGVR |
| Ga0308414_10656612 | 3300032356 | Hot Spring Phototrophic Mat | RIEIPSAGDGYYDQYRVEVHRTDGSNYTLTSKLIGVRG |
| Ga0308413_020993_2150_2263 | 3300033886 | Hot Spring Phototrophic Mat | RIEIPSAGDGYYDQYRIEVRRTAGNNYVLTSKIVGVR |
| Ga0308413_035965_1415_1525 | 3300033886 | Hot Spring Phototrophic Mat | IEIPSAGDGYYDQYRIEVRRTAGDNYFLTSKIVGVR |
| Ga0308413_038093_1350_1460 | 3300033886 | Hot Spring Phototrophic Mat | EIPSAGDGYYDQYRIEVQRTAGSSSYNLISKIVGVR |
| Ga0308413_062840_880_1011 | 3300033886 | Hot Spring Phototrophic Mat | EANTWGRIEIPASSDGYYDQYRIEVQRTAGSNYELTSKIVGVR |
| Ga0308413_164649_1_159 | 3300033886 | Hot Spring Phototrophic Mat | ELATGTLPGNANSWNRIEIPSAGDGYYDQYRIEVQRTAGSNYTLTSKIVGVR |
| Ga0372968_032559_3_149 | 3300034647 | Hot Spring Phototrophic Mat | TLPGGANSWGRIEIPSAGDGYYDQYRIEVYRTDGNNYTLTSKVIGVRG |
| Ga0372970_060437_3_128 | 3300034648 | Hot Spring Phototrophic Mat | SWGRIEIPTTGDGYYDQYRVEVYRTDGNNYTLTSKLIGVRG |
| Ga0372972_005909_2266_2436 | 3300034649 | Hot Spring Phototrophic Mat | GWQEIVPATPLPGEANTWGRIEIPSAGDGYYDQYRIEVRRTAGSGYSLASKIVGVR |
| Ga0372972_058715_337_507 | 3300034649 | Hot Spring Phototrophic Mat | GWQEIVPATPLPGEANTWGRIEIPSAGDGYYDQYRIEVRRTGGSGYTLTSKIVGVR |
| Ga0372973_034962_1_123 | 3300034650 | Hot Spring Phototrophic Mat | SWNRIEIPATTDGYYDQYRIEVQRTSGSNYPLTSKIVGVR |
| Ga0372973_059131_383_526 | 3300034650 | Hot Spring Phototrophic Mat | PLPGEANTWGRIEIPSAGDGYYDQYRIEVRRTAGSNYALTSKIVGVR |
| ⦗Top⦘ |