Basic Information | |
---|---|
Family ID | F029843 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 187 |
Average Sequence Length | 41 residues |
Representative Sequence | MQAFHIRYRNTQGTLMRILNAASRRGLDLPSVQAEAAERD |
Number of Associated Samples | 174 |
Number of Associated Scaffolds | 187 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 96.77 % |
% of genes near scaffold ends (potentially truncated) | 97.86 % |
% of genes from short scaffolds (< 2000 bps) | 89.30 % |
Associated GOLD sequencing projects | 170 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.51 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (99.465 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (11.230 % of family members) |
Environment Ontology (ENVO) | Unclassified (18.717 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.059 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 22.06% β-sheet: 2.94% Coil/Unstructured: 75.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 187 Family Scaffolds |
---|---|---|
PF02775 | TPP_enzyme_C | 76.47 |
PF02776 | TPP_enzyme_N | 13.90 |
PF01450 | IlvC | 1.07 |
PF07991 | IlvN | 1.07 |
PF07992 | Pyr_redox_2 | 0.53 |
PF12698 | ABC2_membrane_3 | 0.53 |
PF00970 | FAD_binding_6 | 0.53 |
PF02875 | Mur_ligase_C | 0.53 |
PF05977 | MFS_3 | 0.53 |
PF04024 | PspC | 0.53 |
COG ID | Name | Functional Category | % Frequency in 187 Family Scaffolds |
---|---|---|---|
COG0059 | Ketol-acid reductoisomerase | Amino acid transport and metabolism [E] | 4.28 |
COG0499 | S-adenosylhomocysteine hydrolase | Coenzyme transport and metabolism [H] | 1.07 |
COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.53 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 99.47 % |
Unclassified | root | N/A | 0.53 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459012|GOYVCMS01AOWG6 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300000156|NODE_c0732609 | All Organisms → cellular organisms → Bacteria | 8541 | Open in IMG/M |
3300000891|JGI10214J12806_13647142 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300001593|JGI12635J15846_10003828 | All Organisms → cellular organisms → Bacteria | 13054 | Open in IMG/M |
3300001991|JGI24743J22301_10007709 | All Organisms → cellular organisms → Bacteria | 1873 | Open in IMG/M |
3300004153|Ga0063455_100002355 | All Organisms → cellular organisms → Bacteria | 3178 | Open in IMG/M |
3300004480|Ga0062592_100331012 | All Organisms → cellular organisms → Bacteria | 1172 | Open in IMG/M |
3300005450|Ga0066682_10262276 | All Organisms → cellular organisms → Bacteria | 1113 | Open in IMG/M |
3300005450|Ga0066682_10333372 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 978 | Open in IMG/M |
3300005518|Ga0070699_101641203 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
3300005529|Ga0070741_10724817 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
3300005533|Ga0070734_10547851 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 659 | Open in IMG/M |
3300005538|Ga0070731_10136731 | All Organisms → cellular organisms → Bacteria | 1624 | Open in IMG/M |
3300005542|Ga0070732_10074729 | All Organisms → cellular organisms → Bacteria | 1978 | Open in IMG/M |
3300005542|Ga0070732_10278235 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
3300005549|Ga0070704_102004070 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300005553|Ga0066695_10205609 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1236 | Open in IMG/M |
3300005574|Ga0066694_10343173 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
3300005764|Ga0066903_105183615 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
3300005843|Ga0068860_100124197 | All Organisms → cellular organisms → Bacteria | 2474 | Open in IMG/M |
3300005994|Ga0066789_10169434 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
3300006050|Ga0075028_100461515 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
3300006174|Ga0075014_100839011 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300006176|Ga0070765_100973278 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
3300009089|Ga0099828_11953661 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300009090|Ga0099827_10160469 | All Organisms → cellular organisms → Bacteria | 1846 | Open in IMG/M |
3300009090|Ga0099827_10290211 | All Organisms → cellular organisms → Bacteria | 1382 | Open in IMG/M |
3300009137|Ga0066709_102420284 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
3300009518|Ga0116128_1211343 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300009623|Ga0116133_1189187 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300009628|Ga0116125_1059727 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
3300009665|Ga0116135_1470993 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300009792|Ga0126374_11747356 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300010048|Ga0126373_13259862 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300010303|Ga0134082_10487016 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300010320|Ga0134109_10272384 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 644 | Open in IMG/M |
3300010361|Ga0126378_12652462 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300010366|Ga0126379_10643353 | All Organisms → cellular organisms → Bacteria | 1150 | Open in IMG/M |
3300010399|Ga0134127_10374523 | All Organisms → cellular organisms → Bacteria | 1399 | Open in IMG/M |
3300011061|Ga0138534_1110385 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300011120|Ga0150983_10326815 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
3300011269|Ga0137392_11066007 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
3300011271|Ga0137393_10800584 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 805 | Open in IMG/M |
3300012189|Ga0137388_11220213 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
3300012206|Ga0137380_10174949 | All Organisms → cellular organisms → Bacteria | 1954 | Open in IMG/M |
3300012209|Ga0137379_11223628 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 658 | Open in IMG/M |
3300012210|Ga0137378_11435682 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300012212|Ga0150985_116629969 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
3300012354|Ga0137366_10772405 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
3300012357|Ga0137384_11592688 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300012384|Ga0134036_1041080 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
3300012469|Ga0150984_100045860 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300012918|Ga0137396_10432202 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
3300012924|Ga0137413_10732988 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 753 | Open in IMG/M |
3300012924|Ga0137413_11538303 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300012929|Ga0137404_10198762 | All Organisms → cellular organisms → Bacteria | 1697 | Open in IMG/M |
3300012929|Ga0137404_11595730 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
3300012955|Ga0164298_10764797 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
3300013104|Ga0157370_10823492 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
3300013307|Ga0157372_10250102 | All Organisms → cellular organisms → Bacteria | 2058 | Open in IMG/M |
3300014157|Ga0134078_10008415 | All Organisms → cellular organisms → Bacteria | 2958 | Open in IMG/M |
3300014201|Ga0181537_11001146 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300014493|Ga0182016_10697189 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300014654|Ga0181525_10086746 | All Organisms → cellular organisms → Bacteria | 1737 | Open in IMG/M |
3300014658|Ga0181519_10265055 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
3300015241|Ga0137418_10660974 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
3300015371|Ga0132258_13367521 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
3300016341|Ga0182035_10962532 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
3300016357|Ga0182032_10371878 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
3300016422|Ga0182039_10460556 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
3300017822|Ga0187802_10412252 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300017932|Ga0187814_10316096 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
3300017940|Ga0187853_10084054 | All Organisms → cellular organisms → Bacteria | 1583 | Open in IMG/M |
3300017942|Ga0187808_10349225 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
3300017947|Ga0187785_10132753 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
3300017948|Ga0187847_10289193 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
3300017959|Ga0187779_10329564 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
3300017973|Ga0187780_10470357 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
3300017975|Ga0187782_10422384 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
3300017975|Ga0187782_11059208 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
3300017975|Ga0187782_11658490 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300017995|Ga0187816_10071326 | All Organisms → cellular organisms → Bacteria | 1473 | Open in IMG/M |
3300018006|Ga0187804_10482730 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300018007|Ga0187805_10215374 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
3300018022|Ga0187864_10344163 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
3300018024|Ga0187881_10468096 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300018038|Ga0187855_10587489 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
3300018040|Ga0187862_10503681 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
3300018043|Ga0187887_10841054 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300018047|Ga0187859_10929152 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300018088|Ga0187771_10355821 | All Organisms → cellular organisms → Bacteria | 1231 | Open in IMG/M |
3300018090|Ga0187770_10958039 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
3300018468|Ga0066662_10895267 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 871 | Open in IMG/M |
3300019186|Ga0184588_131116 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300019241|Ga0187793_1434610 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300019242|Ga0181502_1090476 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300019270|Ga0181512_1409211 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
3300019786|Ga0182025_1205211 | All Organisms → cellular organisms → Bacteria | 1184 | Open in IMG/M |
3300020070|Ga0206356_11000464 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
3300020582|Ga0210395_10128219 | All Organisms → cellular organisms → Bacteria | 1886 | Open in IMG/M |
3300020582|Ga0210395_10884328 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
3300021088|Ga0210404_10377090 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
3300021180|Ga0210396_11445126 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300021401|Ga0210393_10189518 | All Organisms → cellular organisms → Bacteria | 1660 | Open in IMG/M |
3300021401|Ga0210393_11011769 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
3300021403|Ga0210397_10322469 | All Organisms → cellular organisms → Bacteria | 1139 | Open in IMG/M |
3300021406|Ga0210386_10258938 | All Organisms → cellular organisms → Bacteria | 1485 | Open in IMG/M |
3300021420|Ga0210394_10055730 | All Organisms → cellular organisms → Bacteria | 3447 | Open in IMG/M |
3300021433|Ga0210391_11366243 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300021474|Ga0210390_11345306 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300024176|Ga0224565_1036425 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300024330|Ga0137417_1115355 | All Organisms → cellular organisms → Bacteria | 1311 | Open in IMG/M |
3300025457|Ga0208850_1055023 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
3300025473|Ga0208190_1075337 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
3300025494|Ga0207928_1076451 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
3300025898|Ga0207692_10952173 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300025903|Ga0207680_11336929 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300025906|Ga0207699_10045057 | All Organisms → cellular organisms → Bacteria | 2572 | Open in IMG/M |
3300025914|Ga0207671_10556717 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
3300025918|Ga0207662_10013011 | All Organisms → cellular organisms → Bacteria | 4647 | Open in IMG/M |
3300025928|Ga0207700_10051341 | All Organisms → cellular organisms → Bacteria | 3077 | Open in IMG/M |
3300025929|Ga0207664_10394964 | All Organisms → cellular organisms → Bacteria | 1229 | Open in IMG/M |
3300025929|Ga0207664_11168434 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
3300025931|Ga0207644_10205824 | All Organisms → cellular organisms → Bacteria | 1554 | Open in IMG/M |
3300025932|Ga0207690_10073782 | All Organisms → cellular organisms → Bacteria | 2361 | Open in IMG/M |
3300025939|Ga0207665_11168606 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300025981|Ga0207640_10135135 | All Organisms → cellular organisms → Bacteria | 1789 | Open in IMG/M |
3300026118|Ga0207675_100194451 | All Organisms → cellular organisms → Bacteria | 1947 | Open in IMG/M |
3300026277|Ga0209350_1019313 | All Organisms → cellular organisms → Bacteria | 2111 | Open in IMG/M |
3300026318|Ga0209471_1090091 | All Organisms → cellular organisms → Bacteria | 1341 | Open in IMG/M |
3300026557|Ga0179587_10467269 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
3300027064|Ga0208724_1024227 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
3300027334|Ga0209529_1042104 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
3300027478|Ga0207448_101260 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
3300027575|Ga0209525_1110144 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300027619|Ga0209330_1062904 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
3300027684|Ga0209626_1067177 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
3300027698|Ga0209446_1012197 | All Organisms → cellular organisms → Bacteria | 2108 | Open in IMG/M |
3300027737|Ga0209038_10185878 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
3300027826|Ga0209060_10001727 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 22653 | Open in IMG/M |
3300027846|Ga0209180_10762055 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
3300027862|Ga0209701_10035009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 3252 | Open in IMG/M |
3300027869|Ga0209579_10330668 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
3300027869|Ga0209579_10643335 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
3300027889|Ga0209380_10755590 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300027895|Ga0209624_10261769 | All Organisms → cellular organisms → Bacteria | 1150 | Open in IMG/M |
3300027986|Ga0209168_10165535 | All Organisms → cellular organisms → Bacteria | 1117 | Open in IMG/M |
3300028798|Ga0302222_10211824 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
3300028800|Ga0265338_10489006 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
3300028863|Ga0302218_10214497 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
3300028869|Ga0302263_10393510 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300028874|Ga0302155_10322433 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
3300029911|Ga0311361_11183475 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300029954|Ga0311331_10947230 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
3300029957|Ga0265324_10100426 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
3300030001|Ga0302272_1119702 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
3300030043|Ga0302306_10350910 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300030053|Ga0302177_10249751 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
3300030503|Ga0311370_10369544 | All Organisms → cellular organisms → Bacteria | 1818 | Open in IMG/M |
3300030707|Ga0310038_10493934 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300030760|Ga0265762_1000433 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7241 | Open in IMG/M |
3300031231|Ga0170824_107167092 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
3300031233|Ga0302307_10441449 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
3300031525|Ga0302326_13612174 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300031573|Ga0310915_10390428 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
3300031679|Ga0318561_10650505 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300031708|Ga0310686_109106218 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
3300031740|Ga0307468_102276848 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300031744|Ga0306918_10105538 | All Organisms → cellular organisms → Bacteria | 2014 | Open in IMG/M |
3300031753|Ga0307477_10096657 | All Organisms → cellular organisms → Bacteria | 2052 | Open in IMG/M |
3300031754|Ga0307475_10481249 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
3300031754|Ga0307475_11368396 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300031890|Ga0306925_10815154 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
3300031912|Ga0306921_11844859 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 649 | Open in IMG/M |
3300031939|Ga0308174_11762973 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300031962|Ga0307479_10049628 | All Organisms → cellular organisms → Bacteria | 4032 | Open in IMG/M |
3300031962|Ga0307479_10636098 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
3300032035|Ga0310911_10300031 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
3300032063|Ga0318504_10345204 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
3300032180|Ga0307471_100207443 | All Organisms → cellular organisms → Bacteria | 1968 | Open in IMG/M |
3300032205|Ga0307472_101234116 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
3300032515|Ga0348332_11829238 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300032783|Ga0335079_12045890 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300032892|Ga0335081_11569986 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
3300033547|Ga0316212_1023524 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
3300034282|Ga0370492_0118630 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.23% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.56% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.35% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.81% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.28% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.28% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.28% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.74% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.21% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.21% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.21% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.21% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.14% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.14% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.14% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.14% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.60% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.60% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.07% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.07% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.07% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.07% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.07% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.07% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.07% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.07% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.07% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.07% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.07% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.07% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.53% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.53% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.53% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.53% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.53% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.53% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.53% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.53% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.53% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.53% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.53% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.53% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.53% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.53% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.53% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.53% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.53% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.53% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.53% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.53% |
Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.53% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.53% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.53% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.53% |
Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.53% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459012 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO1O1 lysis Rhizosphere grass | Environmental | Open in IMG/M |
3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Host-Associated | Open in IMG/M |
3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300011061 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 12 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012384 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019186 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSE3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019241 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019242 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019270 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300024176 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU1 | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025457 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025473 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 (SPAdes) | Environmental | Open in IMG/M |
3300025494 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027064 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF003 (SPAdes) | Environmental | Open in IMG/M |
3300027334 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027478 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-BECK03-E (SPAdes) | Environmental | Open in IMG/M |
3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027619 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
3300028863 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1 | Environmental | Open in IMG/M |
3300028869 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_4 | Environmental | Open in IMG/M |
3300028874 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_1 | Environmental | Open in IMG/M |
3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
3300029954 | I_Bog_N3 coassembly | Environmental | Open in IMG/M |
3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Host-Associated | Open in IMG/M |
3300030001 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N1_2 | Environmental | Open in IMG/M |
3300030043 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1 | Environmental | Open in IMG/M |
3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Host-Associated | Open in IMG/M |
3300034282 | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
N56_04795430 | 2170459012 | Grass Soil | MQTFHIRYRNTQGTLMRILNAASRRALDLPVVHAEPAEHD |
NODE_07326091 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | MHAFHIHYRNTQGTLMRILTAVSRRGLDLHYVRAAS |
JGI10214J12806_136471422 | 3300000891 | Soil | MQVFHIRYRNTQGTLMRILGAVSRRGLDIPFVQAEPEQHAHAVTI |
JGI12635J15846_100038281 | 3300001593 | Forest Soil | MQAFYIRYRNTQGTLMRILNAVSRRALDFPSVQAEAAEQD |
JGI24743J22301_100077092 | 3300001991 | Corn, Switchgrass And Miscanthus Rhizosphere | MQVFHIRYRNTQGTLMRILGAVSRRGLDLPFVQAEPEEHAHAVTILLDVNA |
Ga0063455_1000023551 | 3300004153 | Soil | MQTFHIRYRNTQGTLMRILNAASRRGIDIPVVHAEPAEHDHQV |
Ga0062592_1003310122 | 3300004480 | Soil | MQVFHIRYRNTQGTLMRILGAVSRRGLDIPFVQAEPEQHAHAVTILLDV |
Ga0066682_102622762 | 3300005450 | Soil | MQVFHIRYRNTQGTLMRILNAVSRRGLDLPSVQAQAAERDHS |
Ga0066682_103333722 | 3300005450 | Soil | MHIFHIRYRNTQGTLMRILTAASRRGIDLPYVQAEPAEHTHKVTL |
Ga0070699_1016412031 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MNIFHIHYRNTQGTLMRILNAASRRAIEMPYVQAEPADAGHQVTLLL |
Ga0070741_107248171 | 3300005529 | Surface Soil | MQAFQIRYRNTQGTLMRILNAASRRGLDIPYVQAEPTEQGHRVT |
Ga0070734_105478512 | 3300005533 | Surface Soil | MHVFHIRYRNTQGTLMRILNAASRRGLDMPYVQAEPAEHM |
Ga0070731_101367311 | 3300005538 | Surface Soil | MQLFHIRYRNAQGALMRILNAVSRRGLDFTSVHAEY |
Ga0070732_100747291 | 3300005542 | Surface Soil | MQTFYIRYRNTQGTLMRILNAASRRALDLPVVQAEPAEHDHQVTLALDVNQ |
Ga0070732_102782352 | 3300005542 | Surface Soil | MQSFHIRYRNTQGTLMRILNAASRRALDLPSVIAEPAERDHQV |
Ga0070704_1020040701 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MQVFHIRYRNTQGTLMRILGAVSRRGLDLPFVQAEPEQHAHAVTILL |
Ga0066695_102056091 | 3300005553 | Soil | MQVFHIRYRNTQGTLMRILNAVSRRGLDLPYVQAEALEH |
Ga0066694_103431732 | 3300005574 | Soil | MQVFHIRYRNTQGTLMRILNAVSRRGLDLPSVQAQAAERDHSV |
Ga0066903_1051836151 | 3300005764 | Tropical Forest Soil | MQFQVRYRSTQGTLMRILNAASRRGLDLTSVLAEAAG |
Ga0068860_1001241973 | 3300005843 | Switchgrass Rhizosphere | MHAFHIHYRNTQGTLMRILTAVSRRGLEMHYVRAANAGNLFR |
Ga0066789_101694342 | 3300005994 | Soil | MHAFHIHYRNTQGTLMRILTAVSRRALEVHYVHASP |
Ga0075028_1004615151 | 3300006050 | Watersheds | MHVFHIRYRNTQGTLMRILTAASRRGIDMPYVQAEPLEHTHKV |
Ga0075014_1008390112 | 3300006174 | Watersheds | VKGKPMQAFTIRYRNTQGTLMRILTGASRRGLDIPSVHAEATEDGHH |
Ga0070765_1009732782 | 3300006176 | Soil | MQAFHIRYRNTQGTLMRILNAASRRGLDIPYIQAEPIEHT |
Ga0099828_119536612 | 3300009089 | Vadose Zone Soil | MQSFHIRYRNTQGTLMRILNAASRRALDLPLVQAERAEH |
Ga0099827_101604691 | 3300009090 | Vadose Zone Soil | MHIFHIRYRNTQGTLMRILTAASRRGIDLPYVQAEPAEH |
Ga0099827_102902111 | 3300009090 | Vadose Zone Soil | MQVFHIQYRNSQGALMRILNAVSRRGLDLTSVHAEYAGQEY |
Ga0066709_1024202843 | 3300009137 | Grasslands Soil | MNNMNAFHIRYRNTQGTLMRILNGASRRALDLHSVHAEAAE |
Ga0116128_12113431 | 3300009518 | Peatland | MNMRVFHIRYRNAQGALMRILNAISRRGIDLTSVHAEAAGPDYTVTLQ |
Ga0116133_11891873 | 3300009623 | Peatland | MENPMHIFQIRYRNTQGTLMRILNAVARRGIELPFV |
Ga0116125_10597271 | 3300009628 | Peatland | MHVFHIRYRNTQGTLMRILNAASRRGIDMPYVQAEPAEHTHKVTLLLN |
Ga0116135_14709932 | 3300009665 | Peatland | MQVFHVRYRNTQGTLMRILNAASRRALDLPSVLAEPVEQD |
Ga0126374_117473562 | 3300009792 | Tropical Forest Soil | MNAFHIHYRNTQGTLMRILTAVSRRGIDIPYLYAAA |
Ga0126373_132598621 | 3300010048 | Tropical Forest Soil | MKAFHIYYRNTQGTLMRILTAVSRRGVDVPYLHAAAWEN |
Ga0134082_104870161 | 3300010303 | Grasslands Soil | MHAFHVHYRNTQGTLMRILNAISRRAIDMPYVQAEPHGYN |
Ga0134109_102723841 | 3300010320 | Grasslands Soil | MQAFHIRYRNTQGTLMRILNAASRRRLDLPYVQAEALEHT |
Ga0126378_126524622 | 3300010361 | Tropical Forest Soil | MIEFHIRYRNTQGTLMRILNAASRRGLDMPAVRAEAA |
Ga0126379_106433532 | 3300010366 | Tropical Forest Soil | MQVFHIRYRNTQGTLLRILNAASRRGLDLPTVMAEAAEHGHQVMLALDANPKQVGQLY |
Ga0134127_103745232 | 3300010399 | Terrestrial Soil | MQVFHIRYRNTQGTLMRILGAVSRRGLDLPFVQAEPEQHAHAVTILLDV |
Ga0138534_11103852 | 3300011061 | Peatlands Soil | MQAFQIHYRNTQGTLMRILNAASRRGLDLHSVQAV |
Ga0150983_103268151 | 3300011120 | Forest Soil | MQVFHIRYRNAQGTLMRILNAVSRRGLDLTSVHAE |
Ga0137392_110660071 | 3300011269 | Vadose Zone Soil | MQAFHIRYRNTQGTLMRILNAASRRGLDLLSVQAEPAEHDYHVT |
Ga0137393_108005842 | 3300011271 | Vadose Zone Soil | MHAFHIHYRNTQGTLMRILNAVSRRGIDMPYIQAEPAEHSTRSRCCSTSTR |
Ga0137388_112202132 | 3300012189 | Vadose Zone Soil | MQVFHIQYRNSQGALMRILNAVSRRGLDLTSVHAEFAGQ |
Ga0137380_101749492 | 3300012206 | Vadose Zone Soil | MQSFHIRYRNTQGTLMRILNAASRRALDLPLVQAERAEHDH |
Ga0137379_112236281 | 3300012209 | Vadose Zone Soil | MQVFHIRYRNTQGTLMRILNAASRRGLDLPYVQAEALDHAHNVT |
Ga0137378_114356822 | 3300012210 | Vadose Zone Soil | MQTFQIRYRNTQGTLMRILNAASRRALDLPLVHAEPAEHDHQATLSLDVNQ |
Ga0150985_1166299692 | 3300012212 | Avena Fatua Rhizosphere | MHAFHIHYRNTQGTLMRILTAVSRRGLEMFYVQAS |
Ga0137366_107724051 | 3300012354 | Vadose Zone Soil | MHIFHIRYRNTQGTLMRILSAASRRGIDLPYVQAEPAEHTHGVTLLMDVNATQVG |
Ga0137384_115926882 | 3300012357 | Vadose Zone Soil | MQSFHIRYRNTQGTLMRILNAASRRALDLPFVHAEQGETDHQVTIVL |
Ga0134036_10410802 | 3300012384 | Grasslands Soil | MHAFHVHYRNTQGTLMRILNAISRRAIDMPYVQA* |
Ga0150984_1000458602 | 3300012469 | Avena Fatua Rhizosphere | MQAFHIHYRNTQGTLMRILTAVSRRGLEMFYVQASADGHGQRA |
Ga0137396_104322022 | 3300012918 | Vadose Zone Soil | MQAFHIRYRNTQGTLMRILNAASRRGLDLPSVQAEAAERD |
Ga0137413_107329882 | 3300012924 | Vadose Zone Soil | MQVFHIRYRNSQGALMRILNAVSRRGLDLTSVHAEYAGQE |
Ga0137413_115383031 | 3300012924 | Vadose Zone Soil | MQVFHIRYRNAQGTLMRILNAVSRRGLDLTSVHAEYAGHD |
Ga0137404_101987621 | 3300012929 | Vadose Zone Soil | MQVFHIRYRNTQGTLMRILNAVSRRGLDLPYVQAEALEHAH |
Ga0137404_115957302 | 3300012929 | Vadose Zone Soil | MHVFHIRYRNTQGTLMRILTAASRRGIETPYVQAEPCGHEH |
Ga0164298_107647971 | 3300012955 | Soil | MHVFHIHYRNTQGNLMRIINAASRRALDLPYVKAEANANSHQATLLLE |
Ga0157370_108234921 | 3300013104 | Corn Rhizosphere | MHAFHIHYRNTQGTLMRILTAVSRRGLEMHYVRAA |
Ga0157372_102501023 | 3300013307 | Corn Rhizosphere | MHAFHIHYRNTQGTLMRILTAVSRRGLEIHYVRAASA |
Ga0134078_100084153 | 3300014157 | Grasslands Soil | MHAFHVHYRNTQGTLMRILNAISRRAIDMPYVQAEPH |
Ga0181537_110011462 | 3300014201 | Bog | MQLFHIRYRNAQGALMRILNAVSRRGIELNSVHAEAAEHEYAVTLL |
Ga0182016_106971892 | 3300014493 | Bog | MQVFHIRYRNAQGALMRILNAVSRRGLDLPSVHAEAAGADH |
Ga0181525_100867461 | 3300014654 | Bog | MHVFHLRYRNTQGTLMRILSAVVRRTIDLAYVQAEPSEHAHKVTLLVNVNAKQVGQ |
Ga0181519_102650551 | 3300014658 | Bog | MQVFHIRYRNTQGVLMRILNAVSRRGLDLTSVNAQPVTEHHEVTL |
Ga0137418_106609742 | 3300015241 | Vadose Zone Soil | MQAFHIRYRNTQGTLMRILNAASRRGLDLISVQAEPAGHDYHVTV |
Ga0132258_133675212 | 3300015371 | Arabidopsis Rhizosphere | MHTFHIRYRNTQGTLMRILNAASRRALDMPLIQAEPSESDHAV |
Ga0182035_109625322 | 3300016341 | Soil | MHVFHIRYRNTQGTLMRILPPASRRGIDPPSVQAEPRG |
Ga0182032_103718781 | 3300016357 | Soil | MKVFHIYYRNTQGTLMRILTAVSRRGIEITYLHAAA |
Ga0182039_104605562 | 3300016422 | Soil | MHTFSIRYRNTQGTLMRILNAASRRALDISYVQAEPNGHDHKV |
Ga0187802_104122521 | 3300017822 | Freshwater Sediment | MQIFHIRYRNAQGALMRILNAISRRGLDLTSVHAD |
Ga0187814_103160962 | 3300017932 | Freshwater Sediment | MQAFQIRYRNTQGTLMRILNAVSRRGLDMPSVHAGPAGL |
Ga0187853_100840542 | 3300017940 | Peatland | MQVFHIRYRNAQGALMRILNAISRRGIDLTSVHAEAAGPDYTVTL |
Ga0187808_103492251 | 3300017942 | Freshwater Sediment | MQVFHIRYRNAQGALMRILNAASRRGLDLGSVHAEAAGQEHGVTLLLD |
Ga0187785_101327531 | 3300017947 | Tropical Peatland | MHTFHIRYRNTQGTLMRILNAASRRALDMPLVQAEPSEYDHTVTLML |
Ga0187847_102891932 | 3300017948 | Peatland | MQTFHIRYRNTQGTLMRILNAASRRALDLPVVQAEPAE |
Ga0187779_103295642 | 3300017959 | Tropical Peatland | MQVFGIRYRNTQGTLLRILNAVSRRGIELPYVQATPAEHSHTLTLLLEVG |
Ga0187780_104703571 | 3300017973 | Tropical Peatland | MQVFHIRYRNTQGTLMRILNAVSRRGLDMPSVHAAPAG |
Ga0187782_104223842 | 3300017975 | Tropical Peatland | MQFHIRYRNTQGTLMRILNAASRRGLDLAAVHAEAAGDDH |
Ga0187782_110592081 | 3300017975 | Tropical Peatland | MQAFQIRYRNTQGTLMRILNAASRRGLDIPTVHAESAEHDHQV |
Ga0187782_116584902 | 3300017975 | Tropical Peatland | MQTFHIRYRNTQGTLMRILNAASRRGLDLTSVHAAAAAQDYHVTLHLV |
Ga0187816_100713262 | 3300017995 | Freshwater Sediment | MQTFHIRYRNTQGTLMRILNAASRRGLDLPSVQAQPAERDHQVTLA |
Ga0187804_104827302 | 3300018006 | Freshwater Sediment | MQAFHIYYRNTQGTLMRILTAVSRRALDLTYVHAEAAPGGPNND |
Ga0187805_102153742 | 3300018007 | Freshwater Sediment | MQAFQIRYRNTQGTLMRILNAVSRRGLDMPSVHAGPIE |
Ga0187864_103441631 | 3300018022 | Peatland | MRVFHIRYRNAQGALMRILNAISRRGIDLTSVHAEAAGP |
Ga0187881_104680961 | 3300018024 | Peatland | MQTFHIRYRNTQGTLMRILNAASRRALDLPVVQAEPAEHDHQVTL |
Ga0187855_105874891 | 3300018038 | Peatland | MQAFHIRYRNAQGALMRILNAISRRGIDLTSVHAEYDGQHHSV |
Ga0187862_105036811 | 3300018040 | Peatland | MQAFHIRYRNAQGALMRFLNAISRRGIDLTSVHAEYDGQHHSVML |
Ga0187887_108410541 | 3300018043 | Peatland | MQIFHIHYRNAQGALMRILNAISRRGLDLTSVHAEAAGEDYA |
Ga0187859_109291522 | 3300018047 | Peatland | MQTFHIRYRNTQGTLMRILNAASRRALDLPVVQAEPAEHDHQVT |
Ga0187771_103558212 | 3300018088 | Tropical Peatland | MHTFHIRYRNTQGTLMRLLNAVSRRALDMPSVHAAPAG |
Ga0187770_109580391 | 3300018090 | Tropical Peatland | MHTFHIRYRNTQGTLMRILTAASRRALEMTSVHAAPAGRD |
Ga0066662_108952671 | 3300018468 | Grasslands Soil | MHIFHIRYRNTQGTLMRILTATSRRGIDLPYVQAEP |
Ga0184588_1311162 | 3300019186 | Soil | MQVFHVRYRNTQGTLMRILNAASRRALDLPSVLAEPVE |
Ga0187793_14346102 | 3300019241 | Peatland | MQVFQIRYRNTQGTLMRILNAASRRALDIPTLHANATEQDHEATIVLDVNP |
Ga0181502_10904762 | 3300019242 | Peatland | MQFHVRYRNTQGTLMRILNAASRRALDLPVVQAEPAEHDH |
Ga0181512_14092112 | 3300019270 | Peatland | MQTFHIRYRNTQGTLMRILNAASRRALDLPVVQAEPAEHDHQVTLALDVNQK |
Ga0182025_12052111 | 3300019786 | Permafrost | MQVFHIRYRNAQGALMRILNAASRRGLDLTSVHADHRYMLM |
Ga0206356_110004641 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MHAFHIHYRNTQGTLMRILTAVSRRGLELHYVRAASAGNLFR |
Ga0210395_101282192 | 3300020582 | Soil | MQVFHIRYRNAQGTLMRILNAVSRRGLDLTTVHAEGA |
Ga0210395_108843281 | 3300020582 | Soil | MQSFHIRYRNTQGTLMRILNAASRRALDLPVVQAEPAEHDHQVTL |
Ga0210404_103770902 | 3300021088 | Soil | MQVFHIRYRNAQGTLMRILNAVSRRGLDLTSVHAEYAGQDHSVT |
Ga0210396_114451261 | 3300021180 | Soil | MQVFHVRYRNTQGTLMRILNAASRRALDLPSVLAEPV |
Ga0210393_101895181 | 3300021401 | Soil | MQSFYIRYRNTQGTLMRILNAASRRALDLPVVHAA |
Ga0210393_110117692 | 3300021401 | Soil | MQSFHIRYRNTQGTLMRILNAASRRALDLPLVHAEPSEHEHQ |
Ga0210397_103224691 | 3300021403 | Soil | MQIFHIRYRNAQGALMRILNALSRRGLDLTSVHAEAAGQDHAVT |
Ga0210389_101460732 | 3300021404 | Soil | MQVFHIRYRNAQGALMRILNAVSRRGIDLTSVHAEYAGHDYAVTMM |
Ga0210386_102589382 | 3300021406 | Soil | MQSFHIRYRNTQGTLMRILNAASRRALDLPLVHAEPSEQEHQV |
Ga0210394_100557304 | 3300021420 | Soil | MQSFHIRYRNTQGTLMRILNAASRRALDLPLVHAEPSEQEHQVTL |
Ga0210391_113662432 | 3300021433 | Soil | MQAFMIGYRNTQGTLMRILNAASRRALDLSSVRAEPAEH |
Ga0210390_113453062 | 3300021474 | Soil | MHVFHIRYRNTQGTLMRILTAASRRGIDTPYVQAEPS |
Ga0224565_10364251 | 3300024176 | Plant Litter | MQVFHIRYRNAQGTLMRILNAISRRALDLTSVHAEADGQDHIVTLQ |
Ga0137417_11153552 | 3300024330 | Vadose Zone Soil | MQVFHIGYRNTQGTLMRILNAVSRRGLDLSSVQAQAAERDHSVS |
Ga0208850_10550232 | 3300025457 | Arctic Peat Soil | MQTFHIRYRNTQGTLMRILNAASRRALDLPVVQAEPAEH |
Ga0208190_10753371 | 3300025473 | Peatland | MQIFHIRYRNAQGALMRILNAISRRGLDLTSVHADVA |
Ga0207928_10764512 | 3300025494 | Arctic Peat Soil | MQSFQIRYRNTQGTLMRILNAASRRALDIPTVHAEAGERDHQVTLALDV |
Ga0207692_109521731 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MHAFHIHYRNTQGTLMRILTAVSRRGLEIPYVHSAAS |
Ga0207680_113369292 | 3300025903 | Switchgrass Rhizosphere | FHIHYRNTQGTLMRILTAVSRRGLELHYVRAASAGNLFRADLCRAE |
Ga0207699_100450571 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MQSFQIRYRNTQGTLMRILNAASRRALDIPSVHAEAGERDHQ |
Ga0207671_105567171 | 3300025914 | Corn Rhizosphere | MQFHIRYRNTQGTLMRILNAVSRRGLDLPAVHAEAAEHDH |
Ga0207662_100130116 | 3300025918 | Switchgrass Rhizosphere | MQVFHIRYRNTQGTLMRILGAVSRRGLDIPFVQAEPEQHA |
Ga0207700_100513413 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MNSFTIRYRNTQGTLMRILNAASRRALDLPYVRAEQ |
Ga0207664_103949642 | 3300025929 | Agricultural Soil | MQFHIRYRNTQGTLMRILNAVSRRGLDLPAVHAEAAE |
Ga0207664_111684342 | 3300025929 | Agricultural Soil | MHAFHIEYHNTQGTLMRILTAVSRRGLEVPYVHSAASGRVHRADL |
Ga0207644_102058242 | 3300025931 | Switchgrass Rhizosphere | MQVFHIHYRNTQGTLMRILNAISRRGIDMPYVQAEPLEHAHKVTLLL |
Ga0207690_100737823 | 3300025932 | Corn Rhizosphere | MQVFHIRYRNTQGTLMRILGAVSRRGLDLPFVQAEPEEHAHAVTILL |
Ga0207665_111686062 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MQSFQIRYRNTQGTLMRILNAASRRALDIPTVHAEAG |
Ga0207640_101351352 | 3300025981 | Corn Rhizosphere | MHAFHIHYRNTQGTLMRILTAVSRRGLELHYVRAASA |
Ga0207675_1001944512 | 3300026118 | Switchgrass Rhizosphere | MHAFHIHYRNTQGTLMRILTAVSRRGLEMHYVRAANAGNL |
Ga0209350_10193131 | 3300026277 | Grasslands Soil | MQAFHIRYRNTQGTLMRILNAVSRRGLDLPYVQAEALE |
Ga0209471_10900912 | 3300026318 | Soil | MHVFQIRYRNTQGTLMRILTAASRRGIDLPYVQAEPVEHTHKVTL |
Ga0179587_104672691 | 3300026557 | Vadose Zone Soil | MQAFHIRYRNTQGTLMRILNAVSRRALDKPSVQAEPAEHDHQVTL |
Ga0208724_10242272 | 3300027064 | Forest Soil | MQVFHIRYRNAQGALMRIFNAVSRRGLEFNSVHAE |
Ga0209529_10421042 | 3300027334 | Forest Soil | MQVFHIRYRNAQGTLMRILNAVSRRALELTSVHAEGAG |
Ga0207448_1012601 | 3300027478 | Soil | MQVFHIHYRNTQGTLMRILNAISRRGIDMPYVQAEPLEHAHK |
Ga0209525_11101441 | 3300027575 | Forest Soil | MQIFHIRYRNAQGALMRILNAASRRGLDLTSVHAEAAEQD |
Ga0209330_10629042 | 3300027619 | Forest Soil | MQVFHIRYRNSQGALMRILNAVSRRGLGMPSVHAEAAA |
Ga0209626_10671772 | 3300027684 | Forest Soil | MQVFHIRYRNAQGALMRILNAVSRRGLDLTSVHAEAAEQD |
Ga0209446_10121973 | 3300027698 | Bog Forest Soil | MQVFHIRYRNAQGTLMRILNAVSRRALELTSVHAEAAGQDFAVT |
Ga0209038_101858781 | 3300027737 | Bog Forest Soil | MQVFHIRYRNTQGALMRILNAVSRRALELASVHAEAAGQ |
Ga0209060_100017271 | 3300027826 | Surface Soil | MHVFHIRYRNTQGTLMRILNAASRRGLDMPYVQAEPAEHMHKV |
Ga0209180_107620551 | 3300027846 | Vadose Zone Soil | MHAFHIHYRNTQGTLMRILNAVSRRGIDMPYIQAEPAEH |
Ga0209701_100350096 | 3300027862 | Vadose Zone Soil | MQVFHIRYRNTQGTLMRILTAASRRGIELPYVQAEPA |
Ga0209579_103306682 | 3300027869 | Surface Soil | MQSFQIRYRNTQGTLMRILNAASRRALDLPVVQAEPAERDHQVTLA |
Ga0209579_106433351 | 3300027869 | Surface Soil | MQLFHIRYRNAQGALMRILNAVSRRGLDFTSVHAEYD |
Ga0209380_107555901 | 3300027889 | Soil | MQFHVRYRNTQGTLMRILNAASKRGLDIPAVHAEPAERDHQV |
Ga0209624_102617692 | 3300027895 | Forest Soil | MQAFHIRYRNTQGTLMRILNAASRRGLDIPYIQAEPIEHTHQVTLLL |
Ga0209168_101655352 | 3300027986 | Surface Soil | MQCFHIRYRNSQGALMRVLNAISRRGIDLTSVRAGYD |
Ga0302222_102118242 | 3300028798 | Palsa | MQTFHIRYRNTQGTLMRILNAASRRALDLPVVHAEPSEHDHLVTLALEVNQNR |
Ga0265338_104890061 | 3300028800 | Rhizosphere | MQTFYIRYRNTQGTLMRILNAASRRALDLPVVQAEPSEHDHQVTLAL |
Ga0302218_102144971 | 3300028863 | Palsa | MQVFHVRYRNTQGTLMRILNAASRRALDLPSVLAEPVEQDH |
Ga0302263_103935101 | 3300028869 | Fen | MHIFHIRYRNTQGTLMRILGATSRRGIDLPYVQAEPAEHSHRVTL |
Ga0302155_103224331 | 3300028874 | Bog | MQLFHIRYRNAQGALMRILNAVSRRGLDLTSVHAEYAGQDH |
Ga0311361_111834752 | 3300029911 | Bog | MQVFHVRYRNSQGALMRILNAASRRGLDIPSVHAEASGADHA |
Ga0311331_109472302 | 3300029954 | Bog | MQIFHIRYRNMQGALMRILNAISRRALDLTTVHAEAD |
Ga0265324_101004261 | 3300029957 | Rhizosphere | MHIFHVRYRNTQGTLMRILSAASRRGIDLPYVQAEPVEHAHKVTL |
Ga0302272_11197021 | 3300030001 | Bog | MHIFHIRYRNTQGTLMRILGATSRRGIDLPYVQAEPAEH |
Ga0302306_103509101 | 3300030043 | Palsa | MGELEYMQVFHVRYRNTQGTLMRILNAASRRALDLP |
Ga0302177_102497511 | 3300030053 | Palsa | MGELEYMQVFHVRYRNTQGTLMRILNAASRRALDLPSVLAEPVEQ |
Ga0311370_103695441 | 3300030503 | Palsa | MQLFHIRYRNAQGALMRILNAVSRRGIDLNSVHAEEADHDH |
Ga0310038_104939341 | 3300030707 | Peatlands Soil | MQIFQIRYRNTQGTLMRILNGASRRGLDITSVHAEECGN |
Ga0265762_10004331 | 3300030760 | Soil | MQMFHIRYRNAQGALMRILNAISRRGIDLTSVHAEARGQEY |
Ga0170824_1071670922 | 3300031231 | Forest Soil | MQLFHIRYRNAQGALMRILNAVSRRGLDLTSVHAEYAGQ |
Ga0302307_104414492 | 3300031233 | Palsa | MQVFHVRYRNTQGTLMRILNAASRRALDLPSVLAEPVEQEHRVTLVLE |
Ga0302326_136121741 | 3300031525 | Palsa | MQAFHVHYRNTQGTLMRILTAVSRRAVELTYVHAQAEADADEQTW |
Ga0310915_103904282 | 3300031573 | Soil | MKVFHIYYRNTQGTLMRILTAVSRRGIEITYLHAAASENGHRLDL |
Ga0318561_106505052 | 3300031679 | Soil | MHVFHIRYRNTQGTLMRILTAASRRGIDTPYVQAEPRGHEHK |
Ga0310686_1091062182 | 3300031708 | Soil | MQVFHIRYRNAQGALMRILNAISRRGLDLPSVHAEAAGQEHAVTL |
Ga0307468_1022768481 | 3300031740 | Hardwood Forest Soil | MNAFHIRYRNTQGTLMRILNGASRRGLDLHSVHAEAAERDHQV |
Ga0306918_101055381 | 3300031744 | Soil | MQVFGIRYRNTQGTLLRILNAVSRRGIELPYVQATPA |
Ga0307477_100966571 | 3300031753 | Hardwood Forest Soil | MQVFHIRYRNTQGTLMRILNAVSRRSLDLPSVQAQAVEQD |
Ga0307475_104812491 | 3300031754 | Hardwood Forest Soil | MQVFHIRYRNAQGALMRILNAVSRRGIDLTSVHAEYAGH |
Ga0307475_113683961 | 3300031754 | Hardwood Forest Soil | MHVFHIRYRNTQGTLMRILNAASRRGIDTPYVQAEPSGHEHKV |
Ga0306925_108151542 | 3300031890 | Soil | MNNMNAFTIRYRNTQGTLMRILNAASRRGLDLHYVNAEA |
Ga0306921_118448591 | 3300031912 | Soil | MHTFNIRYRNTQGTFMRILNAASRRGLDIFTVEAGPADRDHKATVQLEVNAKQVGQLTRD |
Ga0308174_117629732 | 3300031939 | Soil | MQAFHIHYRNTQGTLMRILTAVSRRALEVPYMHAAASGHVHRVD |
Ga0307479_100496281 | 3300031962 | Hardwood Forest Soil | MQLFHIRYRNAQGALMRILNAVSRRGLDLTSVHAEYAGQDHVVTL |
Ga0307479_106360981 | 3300031962 | Hardwood Forest Soil | MQGFHIRYRNTQGTLMRILNAVSRRGLDLPSVQAEA |
Ga0310911_103000311 | 3300032035 | Soil | MQVFGIRYRNTQGTLLRILNAVSRRGIELPYVQATPAEHSHTVTL |
Ga0318504_103452041 | 3300032063 | Soil | MQVFGIRYRNTQGTLLRILNAVSRRGIELPYVQATPAEH |
Ga0307471_1002074431 | 3300032180 | Hardwood Forest Soil | MNAFHIRYRNTQGTLMRILNGASRRALDLHSVHAEAA |
Ga0307472_1012341161 | 3300032205 | Hardwood Forest Soil | MQLFHIRYRNAQGALMRILNAVSRRGLDLTSVHAEYAG |
Ga0348332_118292382 | 3300032515 | Plant Litter | MQVFHIHYRNTQGTLMRILNAASRRALDLPSVLAEPAER |
Ga0335079_120458901 | 3300032783 | Soil | MQSFHIRYRNTQGTLMRILNAASRRGLDLPFVQAEQG |
Ga0335081_115699862 | 3300032892 | Soil | MQTFHIRYRNTQGTLMRILNAASRRGLDIPVVRAEP |
Ga0316212_10235241 | 3300033547 | Roots | MQSFHIRYRNTQGTLMRILNAASRRALDLPVVQAEPAEHDHQV |
Ga0370492_0118630_950_1081 | 3300034282 | Untreated Peat Soil | MQAFHIRYRNTQGTLMRILNAASRRGLDLSAVQAGAAERDHHLT |
⦗Top⦘ |