NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F029843

Metagenome / Metatranscriptome Family F029843

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F029843
Family Type Metagenome / Metatranscriptome
Number of Sequences 187
Average Sequence Length 41 residues
Representative Sequence MQAFHIRYRNTQGTLMRILNAASRRGLDLPSVQAEAAERD
Number of Associated Samples 174
Number of Associated Scaffolds 187

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 96.77 %
% of genes near scaffold ends (potentially truncated) 97.86 %
% of genes from short scaffolds (< 2000 bps) 89.30 %
Associated GOLD sequencing projects 170
AlphaFold2 3D model prediction Yes
3D model pTM-score0.51

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.465 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(11.230 % of family members)
Environment Ontology (ENVO) Unclassified
(18.717 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(47.059 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 22.06%    β-sheet: 2.94%    Coil/Unstructured: 75.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.51
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 187 Family Scaffolds
PF02775TPP_enzyme_C 76.47
PF02776TPP_enzyme_N 13.90
PF01450IlvC 1.07
PF07991IlvN 1.07
PF07992Pyr_redox_2 0.53
PF12698ABC2_membrane_3 0.53
PF00970FAD_binding_6 0.53
PF02875Mur_ligase_C 0.53
PF05977MFS_3 0.53
PF04024PspC 0.53

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 187 Family Scaffolds
COG0059Ketol-acid reductoisomeraseAmino acid transport and metabolism [E] 4.28
COG0499S-adenosylhomocysteine hydrolaseCoenzyme transport and metabolism [H] 1.07
COG2814Predicted arabinose efflux permease AraJ, MFS familyCarbohydrate transport and metabolism [G] 0.53


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.47 %
UnclassifiedrootN/A0.53 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459012|GOYVCMS01AOWG6All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300000156|NODE_c0732609All Organisms → cellular organisms → Bacteria8541Open in IMG/M
3300000891|JGI10214J12806_13647142All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300001593|JGI12635J15846_10003828All Organisms → cellular organisms → Bacteria13054Open in IMG/M
3300001991|JGI24743J22301_10007709All Organisms → cellular organisms → Bacteria1873Open in IMG/M
3300004153|Ga0063455_100002355All Organisms → cellular organisms → Bacteria3178Open in IMG/M
3300004480|Ga0062592_100331012All Organisms → cellular organisms → Bacteria1172Open in IMG/M
3300005450|Ga0066682_10262276All Organisms → cellular organisms → Bacteria1113Open in IMG/M
3300005450|Ga0066682_10333372All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium978Open in IMG/M
3300005518|Ga0070699_101641203All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium589Open in IMG/M
3300005529|Ga0070741_10724817All Organisms → cellular organisms → Bacteria875Open in IMG/M
3300005533|Ga0070734_10547851All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium659Open in IMG/M
3300005538|Ga0070731_10136731All Organisms → cellular organisms → Bacteria1624Open in IMG/M
3300005542|Ga0070732_10074729All Organisms → cellular organisms → Bacteria1978Open in IMG/M
3300005542|Ga0070732_10278235All Organisms → cellular organisms → Bacteria1003Open in IMG/M
3300005549|Ga0070704_102004070All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300005553|Ga0066695_10205609All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1236Open in IMG/M
3300005574|Ga0066694_10343173All Organisms → cellular organisms → Bacteria708Open in IMG/M
3300005764|Ga0066903_105183615All Organisms → cellular organisms → Bacteria690Open in IMG/M
3300005843|Ga0068860_100124197All Organisms → cellular organisms → Bacteria2474Open in IMG/M
3300005994|Ga0066789_10169434All Organisms → cellular organisms → Bacteria924Open in IMG/M
3300006050|Ga0075028_100461515All Organisms → cellular organisms → Bacteria736Open in IMG/M
3300006174|Ga0075014_100839011All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300006176|Ga0070765_100973278All Organisms → cellular organisms → Bacteria802Open in IMG/M
3300009089|Ga0099828_11953661All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300009090|Ga0099827_10160469All Organisms → cellular organisms → Bacteria1846Open in IMG/M
3300009090|Ga0099827_10290211All Organisms → cellular organisms → Bacteria1382Open in IMG/M
3300009137|Ga0066709_102420284All Organisms → cellular organisms → Bacteria713Open in IMG/M
3300009518|Ga0116128_1211343All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300009623|Ga0116133_1189187All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300009628|Ga0116125_1059727All Organisms → cellular organisms → Bacteria980Open in IMG/M
3300009665|Ga0116135_1470993All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300009792|Ga0126374_11747356All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300010048|Ga0126373_13259862All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300010303|Ga0134082_10487016All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300010320|Ga0134109_10272384All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium644Open in IMG/M
3300010361|Ga0126378_12652462All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300010366|Ga0126379_10643353All Organisms → cellular organisms → Bacteria1150Open in IMG/M
3300010399|Ga0134127_10374523All Organisms → cellular organisms → Bacteria1399Open in IMG/M
3300011061|Ga0138534_1110385All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300011120|Ga0150983_10326815All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300011269|Ga0137392_11066007All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300011271|Ga0137393_10800584All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium805Open in IMG/M
3300012189|Ga0137388_11220213All Organisms → cellular organisms → Bacteria690Open in IMG/M
3300012206|Ga0137380_10174949All Organisms → cellular organisms → Bacteria1954Open in IMG/M
3300012209|Ga0137379_11223628All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium658Open in IMG/M
3300012210|Ga0137378_11435682All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300012212|Ga0150985_116629969All Organisms → cellular organisms → Bacteria817Open in IMG/M
3300012354|Ga0137366_10772405All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300012357|Ga0137384_11592688All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300012384|Ga0134036_1041080All Organisms → cellular organisms → Bacteria666Open in IMG/M
3300012469|Ga0150984_100045860All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300012918|Ga0137396_10432202All Organisms → cellular organisms → Bacteria976Open in IMG/M
3300012924|Ga0137413_10732988All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae753Open in IMG/M
3300012924|Ga0137413_11538303All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300012929|Ga0137404_10198762All Organisms → cellular organisms → Bacteria1697Open in IMG/M
3300012929|Ga0137404_11595730All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300012955|Ga0164298_10764797All Organisms → cellular organisms → Bacteria686Open in IMG/M
3300013104|Ga0157370_10823492All Organisms → cellular organisms → Bacteria844Open in IMG/M
3300013307|Ga0157372_10250102All Organisms → cellular organisms → Bacteria2058Open in IMG/M
3300014157|Ga0134078_10008415All Organisms → cellular organisms → Bacteria2958Open in IMG/M
3300014201|Ga0181537_11001146All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300014493|Ga0182016_10697189All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300014654|Ga0181525_10086746All Organisms → cellular organisms → Bacteria1737Open in IMG/M
3300014658|Ga0181519_10265055All Organisms → cellular organisms → Bacteria1071Open in IMG/M
3300015241|Ga0137418_10660974All Organisms → cellular organisms → Bacteria809Open in IMG/M
3300015371|Ga0132258_13367521All Organisms → cellular organisms → Bacteria1098Open in IMG/M
3300016341|Ga0182035_10962532All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300016357|Ga0182032_10371878All Organisms → cellular organisms → Bacteria1149Open in IMG/M
3300016422|Ga0182039_10460556All Organisms → cellular organisms → Bacteria1091Open in IMG/M
3300017822|Ga0187802_10412252All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300017932|Ga0187814_10316096All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300017940|Ga0187853_10084054All Organisms → cellular organisms → Bacteria1583Open in IMG/M
3300017942|Ga0187808_10349225All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300017947|Ga0187785_10132753All Organisms → cellular organisms → Bacteria1029Open in IMG/M
3300017948|Ga0187847_10289193All Organisms → cellular organisms → Bacteria895Open in IMG/M
3300017959|Ga0187779_10329564All Organisms → cellular organisms → Bacteria982Open in IMG/M
3300017973|Ga0187780_10470357All Organisms → cellular organisms → Bacteria896Open in IMG/M
3300017975|Ga0187782_10422384All Organisms → cellular organisms → Bacteria1015Open in IMG/M
3300017975|Ga0187782_11059208All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300017975|Ga0187782_11658490All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300017995|Ga0187816_10071326All Organisms → cellular organisms → Bacteria1473Open in IMG/M
3300018006|Ga0187804_10482730All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300018007|Ga0187805_10215374All Organisms → cellular organisms → Bacteria878Open in IMG/M
3300018022|Ga0187864_10344163All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300018024|Ga0187881_10468096All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300018038|Ga0187855_10587489All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300018040|Ga0187862_10503681All Organisms → cellular organisms → Bacteria728Open in IMG/M
3300018043|Ga0187887_10841054All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300018047|Ga0187859_10929152All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300018088|Ga0187771_10355821All Organisms → cellular organisms → Bacteria1231Open in IMG/M
3300018090|Ga0187770_10958039All Organisms → cellular organisms → Bacteria688Open in IMG/M
3300018468|Ga0066662_10895267All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium871Open in IMG/M
3300019186|Ga0184588_131116All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300019241|Ga0187793_1434610All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300019242|Ga0181502_1090476All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300019270|Ga0181512_1409211All Organisms → cellular organisms → Bacteria785Open in IMG/M
3300019786|Ga0182025_1205211All Organisms → cellular organisms → Bacteria1184Open in IMG/M
3300020070|Ga0206356_11000464All Organisms → cellular organisms → Bacteria706Open in IMG/M
3300020582|Ga0210395_10128219All Organisms → cellular organisms → Bacteria1886Open in IMG/M
3300020582|Ga0210395_10884328All Organisms → cellular organisms → Bacteria664Open in IMG/M
3300021088|Ga0210404_10377090All Organisms → cellular organisms → Bacteria791Open in IMG/M
3300021180|Ga0210396_11445126All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300021401|Ga0210393_10189518All Organisms → cellular organisms → Bacteria1660Open in IMG/M
3300021401|Ga0210393_11011769All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300021403|Ga0210397_10322469All Organisms → cellular organisms → Bacteria1139Open in IMG/M
3300021406|Ga0210386_10258938All Organisms → cellular organisms → Bacteria1485Open in IMG/M
3300021420|Ga0210394_10055730All Organisms → cellular organisms → Bacteria3447Open in IMG/M
3300021433|Ga0210391_11366243All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300021474|Ga0210390_11345306All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300024176|Ga0224565_1036425All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300024330|Ga0137417_1115355All Organisms → cellular organisms → Bacteria1311Open in IMG/M
3300025457|Ga0208850_1055023All Organisms → cellular organisms → Bacteria656Open in IMG/M
3300025473|Ga0208190_1075337All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300025494|Ga0207928_1076451All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300025898|Ga0207692_10952173All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300025903|Ga0207680_11336929All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300025906|Ga0207699_10045057All Organisms → cellular organisms → Bacteria2572Open in IMG/M
3300025914|Ga0207671_10556717All Organisms → cellular organisms → Bacteria914Open in IMG/M
3300025918|Ga0207662_10013011All Organisms → cellular organisms → Bacteria4647Open in IMG/M
3300025928|Ga0207700_10051341All Organisms → cellular organisms → Bacteria3077Open in IMG/M
3300025929|Ga0207664_10394964All Organisms → cellular organisms → Bacteria1229Open in IMG/M
3300025929|Ga0207664_11168434All Organisms → cellular organisms → Bacteria687Open in IMG/M
3300025931|Ga0207644_10205824All Organisms → cellular organisms → Bacteria1554Open in IMG/M
3300025932|Ga0207690_10073782All Organisms → cellular organisms → Bacteria2361Open in IMG/M
3300025939|Ga0207665_11168606All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300025981|Ga0207640_10135135All Organisms → cellular organisms → Bacteria1789Open in IMG/M
3300026118|Ga0207675_100194451All Organisms → cellular organisms → Bacteria1947Open in IMG/M
3300026277|Ga0209350_1019313All Organisms → cellular organisms → Bacteria2111Open in IMG/M
3300026318|Ga0209471_1090091All Organisms → cellular organisms → Bacteria1341Open in IMG/M
3300026557|Ga0179587_10467269All Organisms → cellular organisms → Bacteria826Open in IMG/M
3300027064|Ga0208724_1024227All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300027334|Ga0209529_1042104All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300027478|Ga0207448_101260All Organisms → cellular organisms → Bacteria704Open in IMG/M
3300027575|Ga0209525_1110144All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300027619|Ga0209330_1062904All Organisms → cellular organisms → Bacteria846Open in IMG/M
3300027684|Ga0209626_1067177All Organisms → cellular organisms → Bacteria908Open in IMG/M
3300027698|Ga0209446_1012197All Organisms → cellular organisms → Bacteria2108Open in IMG/M
3300027737|Ga0209038_10185878All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium629Open in IMG/M
3300027826|Ga0209060_10001727All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae22653Open in IMG/M
3300027846|Ga0209180_10762055All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium521Open in IMG/M
3300027862|Ga0209701_10035009All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei3252Open in IMG/M
3300027869|Ga0209579_10330668All Organisms → cellular organisms → Bacteria823Open in IMG/M
3300027869|Ga0209579_10643335All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300027889|Ga0209380_10755590All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300027895|Ga0209624_10261769All Organisms → cellular organisms → Bacteria1150Open in IMG/M
3300027986|Ga0209168_10165535All Organisms → cellular organisms → Bacteria1117Open in IMG/M
3300028798|Ga0302222_10211824All Organisms → cellular organisms → Bacteria757Open in IMG/M
3300028800|Ga0265338_10489006All Organisms → cellular organisms → Bacteria867Open in IMG/M
3300028863|Ga0302218_10214497All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300028869|Ga0302263_10393510All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300028874|Ga0302155_10322433All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300029911|Ga0311361_11183475All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300029954|Ga0311331_10947230All Organisms → cellular organisms → Bacteria754Open in IMG/M
3300029957|Ga0265324_10100426All Organisms → cellular organisms → Bacteria983Open in IMG/M
3300030001|Ga0302272_1119702All Organisms → cellular organisms → Bacteria725Open in IMG/M
3300030043|Ga0302306_10350910All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300030053|Ga0302177_10249751All Organisms → cellular organisms → Bacteria960Open in IMG/M
3300030503|Ga0311370_10369544All Organisms → cellular organisms → Bacteria1818Open in IMG/M
3300030707|Ga0310038_10493934All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300030760|Ga0265762_1000433All Organisms → cellular organisms → Bacteria → Proteobacteria7241Open in IMG/M
3300031231|Ga0170824_107167092All Organisms → cellular organisms → Bacteria971Open in IMG/M
3300031233|Ga0302307_10441449All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300031525|Ga0302326_13612174All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300031573|Ga0310915_10390428All Organisms → cellular organisms → Bacteria988Open in IMG/M
3300031679|Ga0318561_10650505All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300031708|Ga0310686_109106218All Organisms → cellular organisms → Bacteria1112Open in IMG/M
3300031740|Ga0307468_102276848All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300031744|Ga0306918_10105538All Organisms → cellular organisms → Bacteria2014Open in IMG/M
3300031753|Ga0307477_10096657All Organisms → cellular organisms → Bacteria2052Open in IMG/M
3300031754|Ga0307475_10481249All Organisms → cellular organisms → Bacteria997Open in IMG/M
3300031754|Ga0307475_11368396All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300031890|Ga0306925_10815154All Organisms → cellular organisms → Bacteria967Open in IMG/M
3300031912|Ga0306921_11844859All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium649Open in IMG/M
3300031939|Ga0308174_11762973All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300031962|Ga0307479_10049628All Organisms → cellular organisms → Bacteria4032Open in IMG/M
3300031962|Ga0307479_10636098All Organisms → cellular organisms → Bacteria1048Open in IMG/M
3300032035|Ga0310911_10300031All Organisms → cellular organisms → Bacteria924Open in IMG/M
3300032063|Ga0318504_10345204All Organisms → cellular organisms → Bacteria707Open in IMG/M
3300032180|Ga0307471_100207443All Organisms → cellular organisms → Bacteria1968Open in IMG/M
3300032205|Ga0307472_101234116All Organisms → cellular organisms → Bacteria716Open in IMG/M
3300032515|Ga0348332_11829238All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300032783|Ga0335079_12045890All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300032892|Ga0335081_11569986All Organisms → cellular organisms → Bacteria725Open in IMG/M
3300033547|Ga0316212_1023524All Organisms → cellular organisms → Bacteria863Open in IMG/M
3300034282|Ga0370492_0118630All Organisms → cellular organisms → Bacteria1082Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil11.23%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.56%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland5.35%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil4.81%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.28%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.28%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.28%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa3.74%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.21%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.21%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.21%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.21%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland2.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.14%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.14%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.14%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog2.14%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.60%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.60%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.07%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.07%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.07%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.07%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.07%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.07%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.07%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.07%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.07%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.07%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.07%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.07%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.53%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.53%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.53%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.53%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.53%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.53%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.53%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.53%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.53%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.53%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.53%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.53%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.53%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.53%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.53%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.53%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.53%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.53%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.53%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.53%
RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Roots0.53%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.53%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.53%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.53%
Sugar Cane Bagasse Incubating BioreactorEngineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor0.53%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459012Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO1O1 lysis Rhizosphere grassEnvironmentalOpen in IMG/M
3300000156Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobicEngineeredOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300001991Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2Host-AssociatedOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005533Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1EnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005994Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009518Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150EnvironmentalOpen in IMG/M
3300009623Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10EnvironmentalOpen in IMG/M
3300009628Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10EnvironmentalOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300011061Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 12 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012384Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300014658Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaGEnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018022Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40EnvironmentalOpen in IMG/M
3300018024Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019186Soil microbial communities from Bohemian Forest, Czech Republic ? CSE3 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019241Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019242Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019270Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019786Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300024176Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU1EnvironmentalOpen in IMG/M
3300024330Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025457Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025473Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025494Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026277Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026318Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027064Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF003 (SPAdes)EnvironmentalOpen in IMG/M
3300027334Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027478Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-BECK03-E (SPAdes)EnvironmentalOpen in IMG/M
3300027575Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027619Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027684Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027698Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027737Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027826Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027986Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028798Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2EnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300028863Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1EnvironmentalOpen in IMG/M
3300028869Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_4EnvironmentalOpen in IMG/M
3300028874Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_1EnvironmentalOpen in IMG/M
3300029911III_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029954I_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029957Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaGHost-AssociatedOpen in IMG/M
3300030001Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N1_2EnvironmentalOpen in IMG/M
3300030043Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030053Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2EnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030707Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2)EnvironmentalOpen in IMG/M
3300030760Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031233Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300033547Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1Host-AssociatedOpen in IMG/M
3300034282Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
N56_047954302170459012Grass SoilMQTFHIRYRNTQGTLMRILNAASRRALDLPVVHAEPAEHD
NODE_073260913300000156Sugar Cane Bagasse Incubating BioreactorMHAFHIHYRNTQGTLMRILTAVSRRGLDLHYVRAAS
JGI10214J12806_1364714223300000891SoilMQVFHIRYRNTQGTLMRILGAVSRRGLDIPFVQAEPEQHAHAVTI
JGI12635J15846_1000382813300001593Forest SoilMQAFYIRYRNTQGTLMRILNAVSRRALDFPSVQAEAAEQD
JGI24743J22301_1000770923300001991Corn, Switchgrass And Miscanthus RhizosphereMQVFHIRYRNTQGTLMRILGAVSRRGLDLPFVQAEPEEHAHAVTILLDVNA
Ga0063455_10000235513300004153SoilMQTFHIRYRNTQGTLMRILNAASRRGIDIPVVHAEPAEHDHQV
Ga0062592_10033101223300004480SoilMQVFHIRYRNTQGTLMRILGAVSRRGLDIPFVQAEPEQHAHAVTILLDV
Ga0066682_1026227623300005450SoilMQVFHIRYRNTQGTLMRILNAVSRRGLDLPSVQAQAAERDHS
Ga0066682_1033337223300005450SoilMHIFHIRYRNTQGTLMRILTAASRRGIDLPYVQAEPAEHTHKVTL
Ga0070699_10164120313300005518Corn, Switchgrass And Miscanthus RhizosphereMNIFHIHYRNTQGTLMRILNAASRRAIEMPYVQAEPADAGHQVTLLL
Ga0070741_1072481713300005529Surface SoilMQAFQIRYRNTQGTLMRILNAASRRGLDIPYVQAEPTEQGHRVT
Ga0070734_1054785123300005533Surface SoilMHVFHIRYRNTQGTLMRILNAASRRGLDMPYVQAEPAEHM
Ga0070731_1013673113300005538Surface SoilMQLFHIRYRNAQGALMRILNAVSRRGLDFTSVHAEY
Ga0070732_1007472913300005542Surface SoilMQTFYIRYRNTQGTLMRILNAASRRALDLPVVQAEPAEHDHQVTLALDVNQ
Ga0070732_1027823523300005542Surface SoilMQSFHIRYRNTQGTLMRILNAASRRALDLPSVIAEPAERDHQV
Ga0070704_10200407013300005549Corn, Switchgrass And Miscanthus RhizosphereMQVFHIRYRNTQGTLMRILGAVSRRGLDLPFVQAEPEQHAHAVTILL
Ga0066695_1020560913300005553SoilMQVFHIRYRNTQGTLMRILNAVSRRGLDLPYVQAEALEH
Ga0066694_1034317323300005574SoilMQVFHIRYRNTQGTLMRILNAVSRRGLDLPSVQAQAAERDHSV
Ga0066903_10518361513300005764Tropical Forest SoilMQFQVRYRSTQGTLMRILNAASRRGLDLTSVLAEAAG
Ga0068860_10012419733300005843Switchgrass RhizosphereMHAFHIHYRNTQGTLMRILTAVSRRGLEMHYVRAANAGNLFR
Ga0066789_1016943423300005994SoilMHAFHIHYRNTQGTLMRILTAVSRRALEVHYVHASP
Ga0075028_10046151513300006050WatershedsMHVFHIRYRNTQGTLMRILTAASRRGIDMPYVQAEPLEHTHKV
Ga0075014_10083901123300006174WatershedsVKGKPMQAFTIRYRNTQGTLMRILTGASRRGLDIPSVHAEATEDGHH
Ga0070765_10097327823300006176SoilMQAFHIRYRNTQGTLMRILNAASRRGLDIPYIQAEPIEHT
Ga0099828_1195366123300009089Vadose Zone SoilMQSFHIRYRNTQGTLMRILNAASRRALDLPLVQAERAEH
Ga0099827_1016046913300009090Vadose Zone SoilMHIFHIRYRNTQGTLMRILTAASRRGIDLPYVQAEPAEH
Ga0099827_1029021113300009090Vadose Zone SoilMQVFHIQYRNSQGALMRILNAVSRRGLDLTSVHAEYAGQEY
Ga0066709_10242028433300009137Grasslands SoilMNNMNAFHIRYRNTQGTLMRILNGASRRALDLHSVHAEAAE
Ga0116128_121134313300009518PeatlandMNMRVFHIRYRNAQGALMRILNAISRRGIDLTSVHAEAAGPDYTVTLQ
Ga0116133_118918733300009623PeatlandMENPMHIFQIRYRNTQGTLMRILNAVARRGIELPFV
Ga0116125_105972713300009628PeatlandMHVFHIRYRNTQGTLMRILNAASRRGIDMPYVQAEPAEHTHKVTLLLN
Ga0116135_147099323300009665PeatlandMQVFHVRYRNTQGTLMRILNAASRRALDLPSVLAEPVEQD
Ga0126374_1174735623300009792Tropical Forest SoilMNAFHIHYRNTQGTLMRILTAVSRRGIDIPYLYAAA
Ga0126373_1325986213300010048Tropical Forest SoilMKAFHIYYRNTQGTLMRILTAVSRRGVDVPYLHAAAWEN
Ga0134082_1048701613300010303Grasslands SoilMHAFHVHYRNTQGTLMRILNAISRRAIDMPYVQAEPHGYN
Ga0134109_1027238413300010320Grasslands SoilMQAFHIRYRNTQGTLMRILNAASRRRLDLPYVQAEALEHT
Ga0126378_1265246223300010361Tropical Forest SoilMIEFHIRYRNTQGTLMRILNAASRRGLDMPAVRAEAA
Ga0126379_1064335323300010366Tropical Forest SoilMQVFHIRYRNTQGTLLRILNAASRRGLDLPTVMAEAAEHGHQVMLALDANPKQVGQLY
Ga0134127_1037452323300010399Terrestrial SoilMQVFHIRYRNTQGTLMRILGAVSRRGLDLPFVQAEPEQHAHAVTILLDV
Ga0138534_111038523300011061Peatlands SoilMQAFQIHYRNTQGTLMRILNAASRRGLDLHSVQAV
Ga0150983_1032681513300011120Forest SoilMQVFHIRYRNAQGTLMRILNAVSRRGLDLTSVHAE
Ga0137392_1106600713300011269Vadose Zone SoilMQAFHIRYRNTQGTLMRILNAASRRGLDLLSVQAEPAEHDYHVT
Ga0137393_1080058423300011271Vadose Zone SoilMHAFHIHYRNTQGTLMRILNAVSRRGIDMPYIQAEPAEHSTRSRCCSTSTR
Ga0137388_1122021323300012189Vadose Zone SoilMQVFHIQYRNSQGALMRILNAVSRRGLDLTSVHAEFAGQ
Ga0137380_1017494923300012206Vadose Zone SoilMQSFHIRYRNTQGTLMRILNAASRRALDLPLVQAERAEHDH
Ga0137379_1122362813300012209Vadose Zone SoilMQVFHIRYRNTQGTLMRILNAASRRGLDLPYVQAEALDHAHNVT
Ga0137378_1143568223300012210Vadose Zone SoilMQTFQIRYRNTQGTLMRILNAASRRALDLPLVHAEPAEHDHQATLSLDVNQ
Ga0150985_11662996923300012212Avena Fatua RhizosphereMHAFHIHYRNTQGTLMRILTAVSRRGLEMFYVQAS
Ga0137366_1077240513300012354Vadose Zone SoilMHIFHIRYRNTQGTLMRILSAASRRGIDLPYVQAEPAEHTHGVTLLMDVNATQVG
Ga0137384_1159268823300012357Vadose Zone SoilMQSFHIRYRNTQGTLMRILNAASRRALDLPFVHAEQGETDHQVTIVL
Ga0134036_104108023300012384Grasslands SoilMHAFHVHYRNTQGTLMRILNAISRRAIDMPYVQA*
Ga0150984_10004586023300012469Avena Fatua RhizosphereMQAFHIHYRNTQGTLMRILTAVSRRGLEMFYVQASADGHGQRA
Ga0137396_1043220223300012918Vadose Zone SoilMQAFHIRYRNTQGTLMRILNAASRRGLDLPSVQAEAAERD
Ga0137413_1073298823300012924Vadose Zone SoilMQVFHIRYRNSQGALMRILNAVSRRGLDLTSVHAEYAGQE
Ga0137413_1153830313300012924Vadose Zone SoilMQVFHIRYRNAQGTLMRILNAVSRRGLDLTSVHAEYAGHD
Ga0137404_1019876213300012929Vadose Zone SoilMQVFHIRYRNTQGTLMRILNAVSRRGLDLPYVQAEALEHAH
Ga0137404_1159573023300012929Vadose Zone SoilMHVFHIRYRNTQGTLMRILTAASRRGIETPYVQAEPCGHEH
Ga0164298_1076479713300012955SoilMHVFHIHYRNTQGNLMRIINAASRRALDLPYVKAEANANSHQATLLLE
Ga0157370_1082349213300013104Corn RhizosphereMHAFHIHYRNTQGTLMRILTAVSRRGLEMHYVRAA
Ga0157372_1025010233300013307Corn RhizosphereMHAFHIHYRNTQGTLMRILTAVSRRGLEIHYVRAASA
Ga0134078_1000841533300014157Grasslands SoilMHAFHVHYRNTQGTLMRILNAISRRAIDMPYVQAEPH
Ga0181537_1100114623300014201BogMQLFHIRYRNAQGALMRILNAVSRRGIELNSVHAEAAEHEYAVTLL
Ga0182016_1069718923300014493BogMQVFHIRYRNAQGALMRILNAVSRRGLDLPSVHAEAAGADH
Ga0181525_1008674613300014654BogMHVFHLRYRNTQGTLMRILSAVVRRTIDLAYVQAEPSEHAHKVTLLVNVNAKQVGQ
Ga0181519_1026505513300014658BogMQVFHIRYRNTQGVLMRILNAVSRRGLDLTSVNAQPVTEHHEVTL
Ga0137418_1066097423300015241Vadose Zone SoilMQAFHIRYRNTQGTLMRILNAASRRGLDLISVQAEPAGHDYHVTV
Ga0132258_1336752123300015371Arabidopsis RhizosphereMHTFHIRYRNTQGTLMRILNAASRRALDMPLIQAEPSESDHAV
Ga0182035_1096253223300016341SoilMHVFHIRYRNTQGTLMRILPPASRRGIDPPSVQAEPRG
Ga0182032_1037187813300016357SoilMKVFHIYYRNTQGTLMRILTAVSRRGIEITYLHAAA
Ga0182039_1046055623300016422SoilMHTFSIRYRNTQGTLMRILNAASRRALDISYVQAEPNGHDHKV
Ga0187802_1041225213300017822Freshwater SedimentMQIFHIRYRNAQGALMRILNAISRRGLDLTSVHAD
Ga0187814_1031609623300017932Freshwater SedimentMQAFQIRYRNTQGTLMRILNAVSRRGLDMPSVHAGPAGL
Ga0187853_1008405423300017940PeatlandMQVFHIRYRNAQGALMRILNAISRRGIDLTSVHAEAAGPDYTVTL
Ga0187808_1034922513300017942Freshwater SedimentMQVFHIRYRNAQGALMRILNAASRRGLDLGSVHAEAAGQEHGVTLLLD
Ga0187785_1013275313300017947Tropical PeatlandMHTFHIRYRNTQGTLMRILNAASRRALDMPLVQAEPSEYDHTVTLML
Ga0187847_1028919323300017948PeatlandMQTFHIRYRNTQGTLMRILNAASRRALDLPVVQAEPAE
Ga0187779_1032956423300017959Tropical PeatlandMQVFGIRYRNTQGTLLRILNAVSRRGIELPYVQATPAEHSHTLTLLLEVG
Ga0187780_1047035713300017973Tropical PeatlandMQVFHIRYRNTQGTLMRILNAVSRRGLDMPSVHAAPAG
Ga0187782_1042238423300017975Tropical PeatlandMQFHIRYRNTQGTLMRILNAASRRGLDLAAVHAEAAGDDH
Ga0187782_1105920813300017975Tropical PeatlandMQAFQIRYRNTQGTLMRILNAASRRGLDIPTVHAESAEHDHQV
Ga0187782_1165849023300017975Tropical PeatlandMQTFHIRYRNTQGTLMRILNAASRRGLDLTSVHAAAAAQDYHVTLHLV
Ga0187816_1007132623300017995Freshwater SedimentMQTFHIRYRNTQGTLMRILNAASRRGLDLPSVQAQPAERDHQVTLA
Ga0187804_1048273023300018006Freshwater SedimentMQAFHIYYRNTQGTLMRILTAVSRRALDLTYVHAEAAPGGPNND
Ga0187805_1021537423300018007Freshwater SedimentMQAFQIRYRNTQGTLMRILNAVSRRGLDMPSVHAGPIE
Ga0187864_1034416313300018022PeatlandMRVFHIRYRNAQGALMRILNAISRRGIDLTSVHAEAAGP
Ga0187881_1046809613300018024PeatlandMQTFHIRYRNTQGTLMRILNAASRRALDLPVVQAEPAEHDHQVTL
Ga0187855_1058748913300018038PeatlandMQAFHIRYRNAQGALMRILNAISRRGIDLTSVHAEYDGQHHSV
Ga0187862_1050368113300018040PeatlandMQAFHIRYRNAQGALMRFLNAISRRGIDLTSVHAEYDGQHHSVML
Ga0187887_1084105413300018043PeatlandMQIFHIHYRNAQGALMRILNAISRRGLDLTSVHAEAAGEDYA
Ga0187859_1092915223300018047PeatlandMQTFHIRYRNTQGTLMRILNAASRRALDLPVVQAEPAEHDHQVT
Ga0187771_1035582123300018088Tropical PeatlandMHTFHIRYRNTQGTLMRLLNAVSRRALDMPSVHAAPAG
Ga0187770_1095803913300018090Tropical PeatlandMHTFHIRYRNTQGTLMRILTAASRRALEMTSVHAAPAGRD
Ga0066662_1089526713300018468Grasslands SoilMHIFHIRYRNTQGTLMRILTATSRRGIDLPYVQAEP
Ga0184588_13111623300019186SoilMQVFHVRYRNTQGTLMRILNAASRRALDLPSVLAEPVE
Ga0187793_143461023300019241PeatlandMQVFQIRYRNTQGTLMRILNAASRRALDIPTLHANATEQDHEATIVLDVNP
Ga0181502_109047623300019242PeatlandMQFHVRYRNTQGTLMRILNAASRRALDLPVVQAEPAEHDH
Ga0181512_140921123300019270PeatlandMQTFHIRYRNTQGTLMRILNAASRRALDLPVVQAEPAEHDHQVTLALDVNQK
Ga0182025_120521113300019786PermafrostMQVFHIRYRNAQGALMRILNAASRRGLDLTSVHADHRYMLM
Ga0206356_1100046413300020070Corn, Switchgrass And Miscanthus RhizosphereMHAFHIHYRNTQGTLMRILTAVSRRGLELHYVRAASAGNLFR
Ga0210395_1012821923300020582SoilMQVFHIRYRNAQGTLMRILNAVSRRGLDLTTVHAEGA
Ga0210395_1088432813300020582SoilMQSFHIRYRNTQGTLMRILNAASRRALDLPVVQAEPAEHDHQVTL
Ga0210404_1037709023300021088SoilMQVFHIRYRNAQGTLMRILNAVSRRGLDLTSVHAEYAGQDHSVT
Ga0210396_1144512613300021180SoilMQVFHVRYRNTQGTLMRILNAASRRALDLPSVLAEPV
Ga0210393_1018951813300021401SoilMQSFYIRYRNTQGTLMRILNAASRRALDLPVVHAA
Ga0210393_1101176923300021401SoilMQSFHIRYRNTQGTLMRILNAASRRALDLPLVHAEPSEHEHQ
Ga0210397_1032246913300021403SoilMQIFHIRYRNAQGALMRILNALSRRGLDLTSVHAEAAGQDHAVT
Ga0210389_1014607323300021404SoilMQVFHIRYRNAQGALMRILNAVSRRGIDLTSVHAEYAGHDYAVTMM
Ga0210386_1025893823300021406SoilMQSFHIRYRNTQGTLMRILNAASRRALDLPLVHAEPSEQEHQV
Ga0210394_1005573043300021420SoilMQSFHIRYRNTQGTLMRILNAASRRALDLPLVHAEPSEQEHQVTL
Ga0210391_1136624323300021433SoilMQAFMIGYRNTQGTLMRILNAASRRALDLSSVRAEPAEH
Ga0210390_1134530623300021474SoilMHVFHIRYRNTQGTLMRILTAASRRGIDTPYVQAEPS
Ga0224565_103642513300024176Plant LitterMQVFHIRYRNAQGTLMRILNAISRRALDLTSVHAEADGQDHIVTLQ
Ga0137417_111535523300024330Vadose Zone SoilMQVFHIGYRNTQGTLMRILNAVSRRGLDLSSVQAQAAERDHSVS
Ga0208850_105502323300025457Arctic Peat SoilMQTFHIRYRNTQGTLMRILNAASRRALDLPVVQAEPAEH
Ga0208190_107533713300025473PeatlandMQIFHIRYRNAQGALMRILNAISRRGLDLTSVHADVA
Ga0207928_107645123300025494Arctic Peat SoilMQSFQIRYRNTQGTLMRILNAASRRALDIPTVHAEAGERDHQVTLALDV
Ga0207692_1095217313300025898Corn, Switchgrass And Miscanthus RhizosphereMHAFHIHYRNTQGTLMRILTAVSRRGLEIPYVHSAAS
Ga0207680_1133692923300025903Switchgrass RhizosphereFHIHYRNTQGTLMRILTAVSRRGLELHYVRAASAGNLFRADLCRAE
Ga0207699_1004505713300025906Corn, Switchgrass And Miscanthus RhizosphereMQSFQIRYRNTQGTLMRILNAASRRALDIPSVHAEAGERDHQ
Ga0207671_1055671713300025914Corn RhizosphereMQFHIRYRNTQGTLMRILNAVSRRGLDLPAVHAEAAEHDH
Ga0207662_1001301163300025918Switchgrass RhizosphereMQVFHIRYRNTQGTLMRILGAVSRRGLDIPFVQAEPEQHA
Ga0207700_1005134133300025928Corn, Switchgrass And Miscanthus RhizosphereMNSFTIRYRNTQGTLMRILNAASRRALDLPYVRAEQ
Ga0207664_1039496423300025929Agricultural SoilMQFHIRYRNTQGTLMRILNAVSRRGLDLPAVHAEAAE
Ga0207664_1116843423300025929Agricultural SoilMHAFHIEYHNTQGTLMRILTAVSRRGLEVPYVHSAASGRVHRADL
Ga0207644_1020582423300025931Switchgrass RhizosphereMQVFHIHYRNTQGTLMRILNAISRRGIDMPYVQAEPLEHAHKVTLLL
Ga0207690_1007378233300025932Corn RhizosphereMQVFHIRYRNTQGTLMRILGAVSRRGLDLPFVQAEPEEHAHAVTILL
Ga0207665_1116860623300025939Corn, Switchgrass And Miscanthus RhizosphereMQSFQIRYRNTQGTLMRILNAASRRALDIPTVHAEAG
Ga0207640_1013513523300025981Corn RhizosphereMHAFHIHYRNTQGTLMRILTAVSRRGLELHYVRAASA
Ga0207675_10019445123300026118Switchgrass RhizosphereMHAFHIHYRNTQGTLMRILTAVSRRGLEMHYVRAANAGNL
Ga0209350_101931313300026277Grasslands SoilMQAFHIRYRNTQGTLMRILNAVSRRGLDLPYVQAEALE
Ga0209471_109009123300026318SoilMHVFQIRYRNTQGTLMRILTAASRRGIDLPYVQAEPVEHTHKVTL
Ga0179587_1046726913300026557Vadose Zone SoilMQAFHIRYRNTQGTLMRILNAVSRRALDKPSVQAEPAEHDHQVTL
Ga0208724_102422723300027064Forest SoilMQVFHIRYRNAQGALMRIFNAVSRRGLEFNSVHAE
Ga0209529_104210423300027334Forest SoilMQVFHIRYRNAQGTLMRILNAVSRRALELTSVHAEGAG
Ga0207448_10126013300027478SoilMQVFHIHYRNTQGTLMRILNAISRRGIDMPYVQAEPLEHAHK
Ga0209525_111014413300027575Forest SoilMQIFHIRYRNAQGALMRILNAASRRGLDLTSVHAEAAEQD
Ga0209330_106290423300027619Forest SoilMQVFHIRYRNSQGALMRILNAVSRRGLGMPSVHAEAAA
Ga0209626_106717723300027684Forest SoilMQVFHIRYRNAQGALMRILNAVSRRGLDLTSVHAEAAEQD
Ga0209446_101219733300027698Bog Forest SoilMQVFHIRYRNAQGTLMRILNAVSRRALELTSVHAEAAGQDFAVT
Ga0209038_1018587813300027737Bog Forest SoilMQVFHIRYRNTQGALMRILNAVSRRALELASVHAEAAGQ
Ga0209060_1000172713300027826Surface SoilMHVFHIRYRNTQGTLMRILNAASRRGLDMPYVQAEPAEHMHKV
Ga0209180_1076205513300027846Vadose Zone SoilMHAFHIHYRNTQGTLMRILNAVSRRGIDMPYIQAEPAEH
Ga0209701_1003500963300027862Vadose Zone SoilMQVFHIRYRNTQGTLMRILTAASRRGIELPYVQAEPA
Ga0209579_1033066823300027869Surface SoilMQSFQIRYRNTQGTLMRILNAASRRALDLPVVQAEPAERDHQVTLA
Ga0209579_1064333513300027869Surface SoilMQLFHIRYRNAQGALMRILNAVSRRGLDFTSVHAEYD
Ga0209380_1075559013300027889SoilMQFHVRYRNTQGTLMRILNAASKRGLDIPAVHAEPAERDHQV
Ga0209624_1026176923300027895Forest SoilMQAFHIRYRNTQGTLMRILNAASRRGLDIPYIQAEPIEHTHQVTLLL
Ga0209168_1016553523300027986Surface SoilMQCFHIRYRNSQGALMRVLNAISRRGIDLTSVRAGYD
Ga0302222_1021182423300028798PalsaMQTFHIRYRNTQGTLMRILNAASRRALDLPVVHAEPSEHDHLVTLALEVNQNR
Ga0265338_1048900613300028800RhizosphereMQTFYIRYRNTQGTLMRILNAASRRALDLPVVQAEPSEHDHQVTLAL
Ga0302218_1021449713300028863PalsaMQVFHVRYRNTQGTLMRILNAASRRALDLPSVLAEPVEQDH
Ga0302263_1039351013300028869FenMHIFHIRYRNTQGTLMRILGATSRRGIDLPYVQAEPAEHSHRVTL
Ga0302155_1032243313300028874BogMQLFHIRYRNAQGALMRILNAVSRRGLDLTSVHAEYAGQDH
Ga0311361_1118347523300029911BogMQVFHVRYRNSQGALMRILNAASRRGLDIPSVHAEASGADHA
Ga0311331_1094723023300029954BogMQIFHIRYRNMQGALMRILNAISRRALDLTTVHAEAD
Ga0265324_1010042613300029957RhizosphereMHIFHVRYRNTQGTLMRILSAASRRGIDLPYVQAEPVEHAHKVTL
Ga0302272_111970213300030001BogMHIFHIRYRNTQGTLMRILGATSRRGIDLPYVQAEPAEH
Ga0302306_1035091013300030043PalsaMGELEYMQVFHVRYRNTQGTLMRILNAASRRALDLP
Ga0302177_1024975113300030053PalsaMGELEYMQVFHVRYRNTQGTLMRILNAASRRALDLPSVLAEPVEQ
Ga0311370_1036954413300030503PalsaMQLFHIRYRNAQGALMRILNAVSRRGIDLNSVHAEEADHDH
Ga0310038_1049393413300030707Peatlands SoilMQIFQIRYRNTQGTLMRILNGASRRGLDITSVHAEECGN
Ga0265762_100043313300030760SoilMQMFHIRYRNAQGALMRILNAISRRGIDLTSVHAEARGQEY
Ga0170824_10716709223300031231Forest SoilMQLFHIRYRNAQGALMRILNAVSRRGLDLTSVHAEYAGQ
Ga0302307_1044144923300031233PalsaMQVFHVRYRNTQGTLMRILNAASRRALDLPSVLAEPVEQEHRVTLVLE
Ga0302326_1361217413300031525PalsaMQAFHVHYRNTQGTLMRILTAVSRRAVELTYVHAQAEADADEQTW
Ga0310915_1039042823300031573SoilMKVFHIYYRNTQGTLMRILTAVSRRGIEITYLHAAASENGHRLDL
Ga0318561_1065050523300031679SoilMHVFHIRYRNTQGTLMRILTAASRRGIDTPYVQAEPRGHEHK
Ga0310686_10910621823300031708SoilMQVFHIRYRNAQGALMRILNAISRRGLDLPSVHAEAAGQEHAVTL
Ga0307468_10227684813300031740Hardwood Forest SoilMNAFHIRYRNTQGTLMRILNGASRRGLDLHSVHAEAAERDHQV
Ga0306918_1010553813300031744SoilMQVFGIRYRNTQGTLLRILNAVSRRGIELPYVQATPA
Ga0307477_1009665713300031753Hardwood Forest SoilMQVFHIRYRNTQGTLMRILNAVSRRSLDLPSVQAQAVEQD
Ga0307475_1048124913300031754Hardwood Forest SoilMQVFHIRYRNAQGALMRILNAVSRRGIDLTSVHAEYAGH
Ga0307475_1136839613300031754Hardwood Forest SoilMHVFHIRYRNTQGTLMRILNAASRRGIDTPYVQAEPSGHEHKV
Ga0306925_1081515423300031890SoilMNNMNAFTIRYRNTQGTLMRILNAASRRGLDLHYVNAEA
Ga0306921_1184485913300031912SoilMHTFNIRYRNTQGTFMRILNAASRRGLDIFTVEAGPADRDHKATVQLEVNAKQVGQLTRD
Ga0308174_1176297323300031939SoilMQAFHIHYRNTQGTLMRILTAVSRRALEVPYMHAAASGHVHRVD
Ga0307479_1004962813300031962Hardwood Forest SoilMQLFHIRYRNAQGALMRILNAVSRRGLDLTSVHAEYAGQDHVVTL
Ga0307479_1063609813300031962Hardwood Forest SoilMQGFHIRYRNTQGTLMRILNAVSRRGLDLPSVQAEA
Ga0310911_1030003113300032035SoilMQVFGIRYRNTQGTLLRILNAVSRRGIELPYVQATPAEHSHTVTL
Ga0318504_1034520413300032063SoilMQVFGIRYRNTQGTLLRILNAVSRRGIELPYVQATPAEH
Ga0307471_10020744313300032180Hardwood Forest SoilMNAFHIRYRNTQGTLMRILNGASRRALDLHSVHAEAA
Ga0307472_10123411613300032205Hardwood Forest SoilMQLFHIRYRNAQGALMRILNAVSRRGLDLTSVHAEYAG
Ga0348332_1182923823300032515Plant LitterMQVFHIHYRNTQGTLMRILNAASRRALDLPSVLAEPAER
Ga0335079_1204589013300032783SoilMQSFHIRYRNTQGTLMRILNAASRRGLDLPFVQAEQG
Ga0335081_1156998623300032892SoilMQTFHIRYRNTQGTLMRILNAASRRGLDIPVVRAEP
Ga0316212_102352413300033547RootsMQSFHIRYRNTQGTLMRILNAASRRALDLPVVQAEPAEHDHQV
Ga0370492_0118630_950_10813300034282Untreated Peat SoilMQAFHIRYRNTQGTLMRILNAASRRGLDLSAVQAGAAERDHHLT


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.