Metagenome / Metatranscriptome Family F029499

Basic Information
Family ID	F029499
Family Type	Metagenome / Metatranscriptome
Number of Sequences	188
Average Sequence Length	40 residues
Representative Sequence	MRKSTTDRMNDYDAVVMGVLEPILVLSVMAVIAFLVRLFW
Number of Associated Samples	148
Number of Associated Scaffolds	188

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	75.53 %
% of genes near scaffold ends (potentially truncated)	22.34 %
% of genes from short scaffolds (< 2000 bps)	93.62 %
Associated GOLD sequencing projects	141
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.49

Most Common Taxonomy
Group	Unclassified (66.489 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (11.170 % of family members)
Environment Ontology (ENVO)	Unclassified (25.000 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (41.489 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 51.47% β-sheet: 0.00% Coil/Unstructured: 48.53%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 188 Family Scaffolds
PF00027	cNMP_binding	1.60
PF00486	Trans_reg_C	1.06
PF05099	TerB	1.06
PF17200	sCache_2	0.53
PF00083	Sugar_tr	0.53
PF07721	TPR_4	0.53
PF02738	MoCoBD_1	0.53
PF01799	Fer2_2	0.53
PF13751	DDE_Tnp_1_6	0.53
PF01965	DJ-1_PfpI	0.53
PF14023	DUF4239	0.53
PF01757	Acyl_transf_3	0.53
PF00285	Citrate_synt	0.53
PF03092	BT1	0.53
PF13406	SLT_2	0.53
PF09361	Phasin_2	0.53
PF01431	Peptidase_M13	0.53
PF00359	PTS_EIIA_2	0.53
PF16576	HlyD_D23	0.53
PF00155	Aminotran_1_2	0.53
PF00581	Rhodanese	0.53
PF02245	Pur_DNA_glyco	0.53
PF00501	AMP-binding	0.53

COG ID	Name	Functional Category	% Frequency in 188 Family Scaffolds
COG3793	Tellurite resistance protein TerB	Inorganic ion transport and metabolism [P]	1.06
COG0372	Citrate synthase	Energy production and conversion [C]	0.53
COG2094	3-methyladenine DNA glycosylase Mpg	Replication, recombination and repair [L]	0.53
COG3590	Predicted metalloendopeptidase	Posttranslational modification, protein turnover, chaperones [O]	0.53

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.49 %
All Organisms	root	All Organisms	33.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.49 %
cellular organisms	root	All Organisms → cellular organisms	33.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.49 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	33.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.49 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	25.53 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.53 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.53 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.49 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	22.87 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	0.53 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.53 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.49 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	20.21 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	1.06 %
Acidobacteria bacterium 37-65-4	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 37-65-4	0.53 %
Thermoleophilia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	0.53 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.49 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	13.30 %
unclassified Hyphomicrobiales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales	2.66 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.06 %
Solirubrobacterales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	0.53 %
Methylocystaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae	0.53 %
Beijerinckiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae	0.53 %
Acidobacteria bacterium 37-65-4	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 37-65-4	0.53 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.49 %
unclassified Hyphomicrobiaceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae	9.04 %
Hyphomicrobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium	3.72 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	2.66 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.06 %
Methyloceanibacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter	0.53 %
unclassified Solirubrobacterales	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales	0.53 %
Methylocystis	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis	0.53 %
Methylocella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocella	0.53 %
Acidobacteria bacterium 37-65-4	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 37-65-4	0.53 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.49 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	9.04 %
Hyphomicrobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium	3.72 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	2.66 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.06 %
unclassified Methylocystis	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → unclassified Methylocystis	0.53 %
Solirubrobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium	0.53 %
Methyloceanibacter caenitepidi	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter caenitepidi	0.53 %
Methylocella silvestris	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocella → Methylocella silvestris	0.53 %
Acidobacteria bacterium 37-65-4	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 37-65-4	0.53 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.49 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	9.04 %
Hyphomicrobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium	3.72 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	2.66 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.06 %
Methylocystis sp. ATCC 49242	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → unclassified Methylocystis → Methylocystis sp. ATCC 49242	0.53 %
Solirubrobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium	0.53 %
Methyloceanibacter caenitepidi	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter caenitepidi	0.53 %
Methylocella silvestris	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocella → Methylocella silvestris	0.53 %
Acidobacteria bacterium 37-65-4	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 37-65-4	0.53 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2035918004\|FACENC_F56XM5W01A48ZY	Not Available	547	Open in IMG/M
2189573003\|GZIR7W402GNRJA	Not Available	508	Open in IMG/M
2209111006\|2214564396	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	1202	Open in IMG/M
3300004058\|Ga0055498_10068993	Not Available	662	Open in IMG/M
3300004157\|Ga0062590_102826052	Not Available	519	Open in IMG/M
3300004480\|Ga0062592_101801320	Not Available	599	Open in IMG/M
3300005093\|Ga0062594_100840464	Not Available	856	Open in IMG/M
3300005093\|Ga0062594_102448562	Not Available	572	Open in IMG/M
3300005093\|Ga0062594_102699296	Not Available	550	Open in IMG/M
3300005105\|Ga0066812_1002083	Not Available	1022	Open in IMG/M
3300005158\|Ga0066816_1008886	Not Available	715	Open in IMG/M
3300005169\|Ga0066810_10007019	Not Available	1545	Open in IMG/M
3300005276\|Ga0065717_1016783	Not Available	506	Open in IMG/M
3300005294\|Ga0065705_10552162	Not Available	738	Open in IMG/M
3300005328\|Ga0070676_10907435	Not Available	657	Open in IMG/M
3300005328\|Ga0070676_11566062	Not Available	509	Open in IMG/M
3300005332\|Ga0066388_100468119	Not Available	1900	Open in IMG/M
3300005332\|Ga0066388_101194676	Not Available	1299	Open in IMG/M
3300005332\|Ga0066388_104609462	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium	701	Open in IMG/M
3300005332\|Ga0066388_105339414	Not Available	652	Open in IMG/M
3300005332\|Ga0066388_106242007	Not Available	601	Open in IMG/M
3300005347\|Ga0070668_100493876	Not Available	1058	Open in IMG/M
3300005365\|Ga0070688_101034261	Not Available	654	Open in IMG/M
3300005367\|Ga0070667_100597488	All Organisms → cellular organisms → Bacteria → Proteobacteria	1016	Open in IMG/M
3300005406\|Ga0070703_10240554	Not Available	730	Open in IMG/M
3300005439\|Ga0070711_100643060	Not Available	888	Open in IMG/M
3300005455\|Ga0070663_101180838	Not Available	672	Open in IMG/M
3300005459\|Ga0068867_101821792	Not Available	573	Open in IMG/M
3300005539\|Ga0068853_101005949	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	802	Open in IMG/M
3300005547\|Ga0070693_101452678	Not Available	535	Open in IMG/M
3300005564\|Ga0070664_101492604	Not Available	640	Open in IMG/M
3300005614\|Ga0068856_101902231	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium	606	Open in IMG/M
3300005713\|Ga0066905_100023360	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	3348	Open in IMG/M
3300005713\|Ga0066905_100604800	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	928	Open in IMG/M
3300005713\|Ga0066905_101796185	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium	565	Open in IMG/M
3300005713\|Ga0066905_102144499	Not Available	520	Open in IMG/M
3300005713\|Ga0066905_102188509	Not Available	515	Open in IMG/M
3300005719\|Ga0068861_102250683	Not Available	546	Open in IMG/M
3300005764\|Ga0066903_101294258	All Organisms → cellular organisms → Bacteria	1361	Open in IMG/M
3300005764\|Ga0066903_105401461	Not Available	674	Open in IMG/M
3300005841\|Ga0068863_102453489	Not Available	531	Open in IMG/M
3300005843\|Ga0068860_100568998	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	1136	Open in IMG/M
3300005983\|Ga0081540_1238127	Not Available	639	Open in IMG/M
3300006175\|Ga0070712_100593765	Not Available	937	Open in IMG/M
3300006175\|Ga0070712_100993872	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium	726	Open in IMG/M
3300006196\|Ga0075422_10291549	Not Available	697	Open in IMG/M
3300006358\|Ga0068871_102233797	Not Available	521	Open in IMG/M
3300006573\|Ga0074055_11266528	Not Available	548	Open in IMG/M
3300006845\|Ga0075421_100278101	All Organisms → cellular organisms → Bacteria	2043	Open in IMG/M
3300006845\|Ga0075421_100959844	Not Available	971	Open in IMG/M
3300006845\|Ga0075421_102518258	Not Available	536	Open in IMG/M
3300006847\|Ga0075431_100887577	All Organisms → cellular organisms → Bacteria	862	Open in IMG/M
3300006852\|Ga0075433_10104179	Not Available	2514	Open in IMG/M
3300006854\|Ga0075425_101794602	Not Available	689	Open in IMG/M
3300006904\|Ga0075424_102054356	Not Available	603	Open in IMG/M
3300009092\|Ga0105250_10203688	Not Available	835	Open in IMG/M
3300009093\|Ga0105240_11846529	Not Available	629	Open in IMG/M
3300009094\|Ga0111539_11970215	Not Available	677	Open in IMG/M
3300009146\|Ga0105091_10026017	All Organisms → cellular organisms → Bacteria	2531	Open in IMG/M
3300009147\|Ga0114129_11286189	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	907	Open in IMG/M
3300009147\|Ga0114129_12416237	Not Available	629	Open in IMG/M
3300009156\|Ga0111538_10305615	All Organisms → cellular organisms → Bacteria	2013	Open in IMG/M
3300009156\|Ga0111538_12145551	All Organisms → cellular organisms → Bacteria	702	Open in IMG/M
3300009167\|Ga0113563_13009384	Not Available	571	Open in IMG/M
3300009304\|Ga0116588_1070987	Not Available	800	Open in IMG/M
3300009545\|Ga0105237_11319534	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	728	Open in IMG/M
3300009545\|Ga0105237_11932305	Not Available	598	Open in IMG/M
3300009551\|Ga0105238_10792729	Not Available	963	Open in IMG/M
3300009553\|Ga0105249_12638920	Not Available	575	Open in IMG/M
3300009810\|Ga0105088_1076382	Not Available	596	Open in IMG/M
3300010043\|Ga0126380_10356665	Not Available	1067	Open in IMG/M
3300010046\|Ga0126384_11554377	Not Available	621	Open in IMG/M
3300010154\|Ga0127503_10026071	Not Available	610	Open in IMG/M
3300010154\|Ga0127503_10347064	Not Available	765	Open in IMG/M
3300010358\|Ga0126370_10573344	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → unclassified Methylocystis → Methylocystis sp. ATCC 49242	969	Open in IMG/M
3300010359\|Ga0126376_10060162	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	2731	Open in IMG/M
3300010359\|Ga0126376_10894346	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	877	Open in IMG/M
3300010360\|Ga0126372_11594109	Not Available	691	Open in IMG/M
3300010362\|Ga0126377_12962579	Not Available	548	Open in IMG/M
3300010371\|Ga0134125_10767490	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium	1062	Open in IMG/M
3300010371\|Ga0134125_11095090	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	872	Open in IMG/M
3300010373\|Ga0134128_11228694	Not Available	826	Open in IMG/M
3300010375\|Ga0105239_11465822	Not Available	788	Open in IMG/M
3300010396\|Ga0134126_10659874	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	1192	Open in IMG/M
3300010398\|Ga0126383_10697965	Not Available	1093	Open in IMG/M
3300011119\|Ga0105246_11218363	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	694	Open in IMG/M
3300012508\|Ga0157315_1004194	Not Available	1017	Open in IMG/M
3300012510\|Ga0157316_1005940	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	983	Open in IMG/M
3300012908\|Ga0157286_10310454	Not Available	581	Open in IMG/M
3300012938\|Ga0162651_100038732	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium	723	Open in IMG/M
3300012948\|Ga0126375_10993765	Not Available	682	Open in IMG/M
3300012951\|Ga0164300_10054167	All Organisms → cellular organisms → Bacteria	1598	Open in IMG/M
3300012951\|Ga0164300_10554724	Not Available	669	Open in IMG/M
3300012951\|Ga0164300_10897748	Not Available	560	Open in IMG/M
3300012955\|Ga0164298_10103021	All Organisms → cellular organisms → Bacteria → Proteobacteria	1515	Open in IMG/M
3300012955\|Ga0164298_10656312	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	729	Open in IMG/M
3300012957\|Ga0164303_10059342	Not Available	1736	Open in IMG/M
3300012957\|Ga0164303_10339368	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	903	Open in IMG/M
3300012958\|Ga0164299_10006543	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4035	Open in IMG/M
3300012958\|Ga0164299_10344391	Not Available	935	Open in IMG/M
3300012960\|Ga0164301_10410146	Not Available	951	Open in IMG/M
3300012960\|Ga0164301_11783281	Not Available	517	Open in IMG/M
3300012961\|Ga0164302_10313806	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1030	Open in IMG/M
3300012987\|Ga0164307_10685801	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	801	Open in IMG/M
3300012988\|Ga0164306_10296592	Not Available	1178	Open in IMG/M
3300013297\|Ga0157378_11493996	Not Available	720	Open in IMG/M
3300013306\|Ga0163162_10789605	Not Available	1067	Open in IMG/M
3300013306\|Ga0163162_12104269	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	647	Open in IMG/M
3300013308\|Ga0157375_11690822	Not Available	749	Open in IMG/M
3300014326\|Ga0157380_10774764	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	973	Open in IMG/M
3300014745\|Ga0157377_10983125	Not Available	638	Open in IMG/M
3300015371\|Ga0132258_10957009	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	2163	Open in IMG/M
3300015371\|Ga0132258_12352443	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium	1335	Open in IMG/M
3300015371\|Ga0132258_12403598	All Organisms → cellular organisms → Bacteria → Proteobacteria	1320	Open in IMG/M
3300015372\|Ga0132256_100960521	Not Available	970	Open in IMG/M
3300015373\|Ga0132257_102338665	All Organisms → cellular organisms → Bacteria	693	Open in IMG/M
3300015373\|Ga0132257_103604644	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium	563	Open in IMG/M
3300015374\|Ga0132255_101715960	Not Available	953	Open in IMG/M
3300017792\|Ga0163161_10160549	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	1714	Open in IMG/M
3300017947\|Ga0187785_10216285	All Organisms → cellular organisms → Bacteria	842	Open in IMG/M
3300017997\|Ga0184610_1291811	Not Available	538	Open in IMG/M
3300018028\|Ga0184608_10373988	Not Available	622	Open in IMG/M
3300018054\|Ga0184621_10074917	Not Available	1169	Open in IMG/M
3300018072\|Ga0184635_10377133	Not Available	540	Open in IMG/M
3300018078\|Ga0184612_10414160	Not Available	675	Open in IMG/M
3300018081\|Ga0184625_10102781	All Organisms → cellular organisms → Bacteria → Proteobacteria	1477	Open in IMG/M
3300018465\|Ga0190269_10301749	Not Available	934	Open in IMG/M
3300018469\|Ga0190270_11125690	Not Available	819	Open in IMG/M
3300019356\|Ga0173481_10190791	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	880	Open in IMG/M
3300019362\|Ga0173479_10608864	Not Available	573	Open in IMG/M
3300019458\|Ga0187892_10000791	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter caenitepidi	79355	Open in IMG/M
3300019767\|Ga0190267_11448017	Not Available	525	Open in IMG/M
3300021080\|Ga0210382_10553869	Not Available	510	Open in IMG/M
3300021081\|Ga0210379_10456091	Not Available	567	Open in IMG/M
3300022726\|Ga0242654_10291599	Not Available	597	Open in IMG/M
3300025904\|Ga0207647_10098043	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocella → Methylocella silvestris	1742	Open in IMG/M
3300025913\|Ga0207695_11537242	Not Available	546	Open in IMG/M
3300025918\|Ga0207662_10386440	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	946	Open in IMG/M
3300025926\|Ga0207659_11112513	Not Available	680	Open in IMG/M
3300025931\|Ga0207644_11209645	Not Available	635	Open in IMG/M
3300025936\|Ga0207670_11244942	Not Available	630	Open in IMG/M
3300025938\|Ga0207704_11546090	Not Available	570	Open in IMG/M
3300025949\|Ga0207667_11884944	Not Available	560	Open in IMG/M
3300025960\|Ga0207651_10910016	Not Available	784	Open in IMG/M
3300026075\|Ga0207708_10079470	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	2519	Open in IMG/M
3300026075\|Ga0207708_11563932	Not Available	579	Open in IMG/M
3300026118\|Ga0207675_102330705	Not Available	549	Open in IMG/M
3300027332\|Ga0209861_1068610	Not Available	521	Open in IMG/M
3300027401\|Ga0208637_1008304	Not Available	1018	Open in IMG/M
3300027523\|Ga0208890_1004638	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 37-65-4	1619	Open in IMG/M
3300027665\|Ga0209983_1068338	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	790	Open in IMG/M
3300027743\|Ga0209593_10216665	All Organisms → cellular organisms → Bacteria	671	Open in IMG/M
3300027821\|Ga0209811_10444092	Not Available	503	Open in IMG/M
3300027876\|Ga0209974_10067351	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	1218	Open in IMG/M
3300027915\|Ga0209069_10445378	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	719	Open in IMG/M
3300028380\|Ga0268265_10914692	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	862	Open in IMG/M
3300028592\|Ga0247822_10178612	All Organisms → cellular organisms → Bacteria	1577	Open in IMG/M
3300028597\|Ga0247820_11028935	Not Available	589	Open in IMG/M
3300028608\|Ga0247819_10972858	Not Available	535	Open in IMG/M
3300028889\|Ga0247827_10926926	Not Available	587	Open in IMG/M
3300031170\|Ga0307498_10001121	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3901	Open in IMG/M
3300031547\|Ga0310887_10121873	Not Available	1327	Open in IMG/M
3300031562\|Ga0310886_10992042	Not Available	538	Open in IMG/M
3300031677\|Ga0307480_1021996	Not Available	520	Open in IMG/M
3300031720\|Ga0307469_11513669	Not Available	643	Open in IMG/M
3300031720\|Ga0307469_11575465	Not Available	631	Open in IMG/M
3300031740\|Ga0307468_101637235	Not Available	603	Open in IMG/M
3300031820\|Ga0307473_11148196	Not Available	575	Open in IMG/M
3300031847\|Ga0310907_10860337	Not Available	511	Open in IMG/M
3300031854\|Ga0310904_10538739	Not Available	788	Open in IMG/M
3300031858\|Ga0310892_10189378	Not Available	1228	Open in IMG/M
3300031943\|Ga0310885_10592458	Not Available	614	Open in IMG/M
3300031944\|Ga0310884_10392267	All Organisms → cellular organisms → Bacteria	796	Open in IMG/M
3300031944\|Ga0310884_10929738	Not Available	538	Open in IMG/M
3300032013\|Ga0310906_10002210	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	6102	Open in IMG/M
3300032180\|Ga0307471_102170088	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	699	Open in IMG/M
3300032205\|Ga0307472_101257275	Not Available	710	Open in IMG/M
3300032205\|Ga0307472_101545423	Not Available	650	Open in IMG/M
3300032205\|Ga0307472_101716667	Not Available	621	Open in IMG/M
3300032205\|Ga0307472_102631463	Not Available	513	Open in IMG/M
3300032211\|Ga0310896_10793100	Not Available	542	Open in IMG/M
3300033551\|Ga0247830_10525325	All Organisms → cellular organisms → Bacteria	932	Open in IMG/M
3300033551\|Ga0247830_10535504	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	923	Open in IMG/M
3300033551\|Ga0247830_10916417	All Organisms → cellular organisms → Bacteria → Proteobacteria	698	Open in IMG/M
3300033551\|Ga0247830_11412069	Not Available	556	Open in IMG/M
3300034414\|Ga0373905_088243	Not Available	515	Open in IMG/M
3300034661\|Ga0314782_155735	Not Available	564	Open in IMG/M
3300034817\|Ga0373948_0205001	Not Available	516	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	64.89%
Host-Associated	Host-Associated	34.57%
Engineered	Engineered	0.53%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	56.38%
Plants	Host-Associated → Plants	34.57%
Aquatic	Environmental → Aquatic	8.51%
Bioremediation	Engineered → Bioremediation	0.53%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	55.32%
Rhizosphere	Host-Associated → Plants → Rhizosphere	19.68%
Rhizoplane	Host-Associated → Plants → Rhizoplane	14.36%
Sediment	Environmental → Aquatic → Sediment	4.26%
Freshwater	Environmental → Aquatic → Freshwater	3.72%
Marine	Environmental → Aquatic → Marine	0.53%
Cave	Environmental → Terrestrial → Cave	0.53%
Agricultural Field	Environmental → Terrestrial → Agricultural Field	0.53%
Roots	Host-Associated → Plants → Roots	0.53%
Metal	Engineered → Bioremediation → Metal	0.53%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	42.02%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	13.83%
Loam	Environmental → Terrestrial → Soil → Loam	11.70%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	10.11%
Soil	Host-Associated → Plants → Rhizosphere → Soil	5.85%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	4.26%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	4.26%
Sediment	Environmental → Aquatic → Freshwater → Sediment	2.13%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	1.06%
Sand	Environmental → Terrestrial → Soil → Sand	1.06%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	0.53%
Wetlands	Environmental → Aquatic → Marine → Wetlands	0.53%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.53%
Unclassified	Environmental → Terrestrial → Cave → Unclassified	0.53%
Unclassified	Environmental → Terrestrial → Agricultural Field → Unclassified	0.53%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.53%
Unclassified	Engineered → Bioremediation → Metal → Unclassified	0.53%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	23.40%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	13.83%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	10.11%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	10.11%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	6.38%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	5.85%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	5.85%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	5.32%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	4.26%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	4.26%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	2.66%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	2.13%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	1.06%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	1.06%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	0.53%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	0.53%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.53%
Unclassified	Environmental → Terrestrial → Cave → Unclassified → Unclassified	0.53%
Unclassified	Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified	0.53%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.53%
Unclassified	Engineered → Bioremediation → Metal → Unclassified → Unclassified	0.53%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	11.17%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	10.11%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	6.91%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	6.38%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	5.32%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	4.79%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	4.26%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	3.72%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	3.72%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	3.19%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	3.19%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	2.66%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.66%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	2.13%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	2.13%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	2.13%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	1.60%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.60%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.60%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	1.60%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	1.06%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	1.06%
Soil	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil	1.06%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	1.06%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	1.06%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.06%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere	1.06%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.06%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	1.06%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	0.53%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	0.53%
Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment	0.53%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	0.53%
Grass Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil	0.53%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	0.53%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere	0.53%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.53%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.53%
Bio-Ooze	Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze	0.53%
Soil	Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil	0.53%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.53%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.53%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.53%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.53%
Rhizosphere Soil	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil	0.53%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.53%
Sediment Slurry	Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry	0.53%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2035918004	Soil microbial communities from sample at FACE Site 2 North Carolina CO2-	Environmental	Open in IMG/M
2189573003	Grass soil microbial communities from Rothamsted Park, UK - FE2 (NaCl 30g/L 5ml)	Environmental	Open in IMG/M
2209111006	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0	Host-Associated	Open in IMG/M
3300004058	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1	Environmental	Open in IMG/M
3300004157	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2	Environmental	Open in IMG/M
3300004480	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4	Environmental	Open in IMG/M
3300005093	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks	Environmental	Open in IMG/M
3300005105	Soil and rhizosphere microbial communities from Laval, Canada - mgHPC	Environmental	Open in IMG/M
3300005158	Soil and rhizosphere microbial communities from Laval, Canada - mgHAA	Environmental	Open in IMG/M
3300005169	Soil and rhizosphere microbial communities from Laval, Canada - mgHPA	Environmental	Open in IMG/M
3300005276	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5	Host-Associated	Open in IMG/M
3300005294	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil	Environmental	Open in IMG/M
3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Host-Associated	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Host-Associated	Open in IMG/M
3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Environmental	Open in IMG/M
3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Host-Associated	Open in IMG/M
3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Environmental	Open in IMG/M
3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Environmental	Open in IMG/M
3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Host-Associated	Open in IMG/M
3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Host-Associated	Open in IMG/M
3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Host-Associated	Open in IMG/M
3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Environmental	Open in IMG/M
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated	Open in IMG/M
3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Host-Associated	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Host-Associated	Open in IMG/M
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental	Open in IMG/M
3300006196	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1	Host-Associated	Open in IMG/M
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated	Open in IMG/M
3300006573	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006847	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Host-Associated	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Host-Associated	Open in IMG/M
3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Host-Associated	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009146	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015	Environmental	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009167	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)	Environmental	Open in IMG/M
3300009304	Microbial communities from sediment of the River Tyne Estuary, UK ? Pasteurized_176d_2 SPAdes	Environmental	Open in IMG/M
3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Host-Associated	Open in IMG/M
3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300009810	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30	Environmental	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010154	Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental	Open in IMG/M
3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Host-Associated	Open in IMG/M
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated	Open in IMG/M
3300012508	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510	Host-Associated	Open in IMG/M
3300012510	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610	Host-Associated	Open in IMG/M
3300012908	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1	Environmental	Open in IMG/M
3300012938	Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015	Environmental	Open in IMG/M
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental	Open in IMG/M
3300012951	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG	Environmental	Open in IMG/M
3300012955	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG	Environmental	Open in IMG/M
3300012957	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG	Environmental	Open in IMG/M
3300012958	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG	Environmental	Open in IMG/M
3300012960	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG	Environmental	Open in IMG/M
3300012961	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG	Environmental	Open in IMG/M
3300012987	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG	Environmental	Open in IMG/M
3300012988	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG	Environmental	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated	Open in IMG/M
3300017947	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG	Environmental	Open in IMG/M
3300017997	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex	Environmental	Open in IMG/M
3300018028	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex	Environmental	Open in IMG/M
3300018054	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1	Environmental	Open in IMG/M
3300018072	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2	Environmental	Open in IMG/M
3300018078	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex	Environmental	Open in IMG/M
3300018081	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1	Environmental	Open in IMG/M
3300018465	Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS	Environmental	Open in IMG/M
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental	Open in IMG/M
3300019356	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)	Environmental	Open in IMG/M
3300019362	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)	Environmental	Open in IMG/M
3300019458	Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG	Environmental	Open in IMG/M
3300019767	Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T	Environmental	Open in IMG/M
3300021080	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo	Environmental	Open in IMG/M
3300021081	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo	Environmental	Open in IMG/M
3300022726	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)	Host-Associated	Open in IMG/M
3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)	Environmental	Open in IMG/M
3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300027332	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_30_40 (SPAdes)	Environmental	Open in IMG/M
3300027401	Soil and rhizosphere microbial communities from Laval, Canada - mgLAC (SPAdes)	Environmental	Open in IMG/M
3300027523	Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes)	Environmental	Open in IMG/M
3300027665	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes)	Host-Associated	Open in IMG/M
3300027743	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes)	Environmental	Open in IMG/M
3300027821	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes)	Host-Associated	Open in IMG/M
3300027915	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)	Environmental	Open in IMG/M
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028592	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30	Environmental	Open in IMG/M
3300028597	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14	Environmental	Open in IMG/M
3300028608	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6	Environmental	Open in IMG/M
3300028889	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2	Environmental	Open in IMG/M
3300031170	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S	Environmental	Open in IMG/M
3300031547	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4	Environmental	Open in IMG/M
3300031562	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3	Environmental	Open in IMG/M
3300031677	Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300031820	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515	Environmental	Open in IMG/M
3300031847	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4	Environmental	Open in IMG/M
3300031854	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1	Environmental	Open in IMG/M
3300031858	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2	Environmental	Open in IMG/M
3300031943	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2	Environmental	Open in IMG/M
3300031944	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1	Environmental	Open in IMG/M
3300032013	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M
3300032211	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1	Environmental	Open in IMG/M
3300033551	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5	Environmental	Open in IMG/M
3300034414	Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B1A4.3	Engineered	Open in IMG/M
3300034661	Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R3 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300034817	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
FACENCA_5243010	2035918004	Soil	MRKSTTDRMNDYDVVVIGVLEPILVLSVMAVIAFLVRLFW
FE2_02423870	2189573003	Grass Soil	REMRKSTTDRMNDYDAVVMGVLEPILVLSVMAVIGFLVRLSW
2213609365	2209111006	Arabidopsis Rhizosphere	MRKSTTVRMNDYDAVVMGVLEPILVLSVMAVIAFLVW
Ga0055498_100689931	3300004058	Natural And Restored Wetlands	MLKSPTDRMNDYDAVVMGVLEPILVLSVMALIPFLVWLFW*
Ga0062590_1028260522	3300004157	Soil	MRKSTTDRMNDYDAVVMGVLEPILVLSVMADIAFLARLFW*
Ga0062592_1018013201	3300004480	Soil	MRKSTTDRMDDYDAVVIGVLEPILVLSVMAVVAYLVRIFW*
Ga0062594_1008404642	3300005093	Soil	MRKSTTDGMNDDNAVVMGVLEPILVLSVMAVIAFLVRLFW*
Ga0062594_1024485621	3300005093	Soil	KREMRKSTTDRMDDYDAVVIGVLEPILVLSVMAVVAYLVRIFW*
Ga0062594_1026992961	3300005093	Soil	MRKSTTDSMNDYDAVVMGVLEPILVLSVMAVSAFLVRPFW*
Ga0066812_10020832	3300005105	Soil	MLKYTTDRMNDHDAVLMGVLEPILVLSVMAVVAFLVRLFW*
Ga0066816_10088862	3300005158	Soil	MLKSPTDRMNDYDAVVMGVLEPILVLSVMAVIGFLVRLSW*
Ga0066810_100070192	3300005169	Soil	MRKSTTDRMNDYDAVVMGVLEPILVLSVMAVIAFLVRLSW*
Ga0065717_10167831	3300005276	Arabidopsis Rhizosphere	MWKSTTDRMNDYDAVLMGVLEPILVLSLMAVTTFLVRLFW*
Ga0065705_105521621	3300005294	Switchgrass Rhizosphere	MLKSTTDRMNDYDAVVMGVLEPILVLSVMAVIAFLVRLFW*
Ga0070676_109074353	3300005328	Miscanthus Rhizosphere	MRKSTTDRMNDYDAVMMGVLEPIFVLSVMAVIGALLGLL*
Ga0070676_115660621	3300005328	Miscanthus Rhizosphere	MRKSPTDRMNDYDAVVMGVLEPILVLSVMAVIAFLVPLSW*
Ga0066388_1004681192	3300005332	Tropical Forest Soil	MLKSTIDRTNDSHALVMGVLEPFLVLSVMAGSAFLVQLFL*
Ga0066388_1011946763	3300005332	Tropical Forest Soil	MLKSPTDRMNEYVTVVMGVLEPILVLSVMAVIAFLMRIF*
Ga0066388_1046094621	3300005332	Tropical Forest Soil	LEMWKSTTHRMNDYDAVVMGVLEPILVLSVMAVSVFLAQLFW*
Ga0066388_1053394142	3300005332	Tropical Forest Soil	MLKSPTDRMNDFVAVVMGVLEPILVLSVMADIAFLVRLFW*
Ga0066388_1062420072	3300005332	Tropical Forest Soil	MRTSTTDRMNDYDAVVMGVLEPILVLSVMAVIAFLVRLFW*
Ga0070668_1004938761	3300005347	Switchgrass Rhizosphere	MRKSTTDRMNDYDVVVIGVLEPILVLSVMAVIAFLVRLSW*
Ga0070688_1010342611	3300005365	Switchgrass Rhizosphere	MRKPTTERMNDYNAVVMGVLEPILVLSVMAVIAFLVPLSW*
Ga0070667_1005974883	3300005367	Switchgrass Rhizosphere	MRKSTTDRMNDYDVVVMGVLEPILVLSVMAVIAFLVPLSW*
Ga0070703_102405541	3300005406	Corn, Switchgrass And Miscanthus Rhizosphere	MRKSTTDRMNDYDVVVMGVLEPILVLSVMAVMAFLVPLSW*
Ga0070711_1006430601	3300005439	Corn, Switchgrass And Miscanthus Rhizosphere	MRKSTTDRMNDYYAVVMGVLEPILVLSVMAVIAFLVRVF*
Ga0070663_1011808382	3300005455	Corn Rhizosphere	MRKSTTDRMNDYDVVVMGVLEPILVLSVMAVITFLVRLPW*
Ga0068867_1018217921	3300005459	Miscanthus Rhizosphere	MWKSTTDRMNDYDVVVMGVLEPILVLSVMAVITFLVPLPW*
Ga0068853_1010059491	3300005539	Corn Rhizosphere	MWKSTTDRMNDYDVVVMGVLEPILVLSVMAVITFLVRLPW*
Ga0070693_1014526782	3300005547	Corn, Switchgrass And Miscanthus Rhizosphere	MRKSTTDRMNDYDVVVMGVLEPILVLSVMAVITFLVPLPW*
Ga0070664_1014926042	3300005564	Corn Rhizosphere	MRKSTTDRMDDYDAVVIGVLEPILVLSVMAVITFLVRLPW*
Ga0068856_1019022312	3300005614	Corn Rhizosphere	MRNSTTDRMNENDAVVMGVLEPIVVLSVMAVIALMVRPFW*
Ga0066905_1000233602	3300005713	Tropical Forest Soil	MRTSTTDRMNDYDAVVMGVLEPILVLSVMAVIASLVRLFW*
Ga0066905_1006048001	3300005713	Tropical Forest Soil	MWKSTTHRMNDDDAVVMGVLEPILVLSVMAVSAFLVQLFC*
Ga0066905_1017961851	3300005713	Tropical Forest Soil	MWKSTTDRMNDYDVMVMGVLEPILVLSVMAVIAFLVRLFW*
Ga0066905_1021444992	3300005713	Tropical Forest Soil	MWKSTTDRMNDYDAVVMGVLEPILVLSVMAVSAFLVQLF
Ga0066905_1021885092	3300005713	Tropical Forest Soil	MRKSTTDRMNDYDAVVMGVLEPILVLSVMADIASLVRIFW*
Ga0068861_1022506832	3300005719	Switchgrass Rhizosphere	MRKSTTDTMNDYDVVVMGVLEPILVLSVMAVITFLVRLPW*
Ga0066903_1012942583	3300005764	Tropical Forest Soil	MQKYTTDRMNDYVTVVMGVLEPILVLSVMAVIAFLMRIF*
Ga0066903_1054014612	3300005764	Tropical Forest Soil	MWKSTTDRMNDYDAVVMGVLEPILVLSLMAVITFLVRLFW*
Ga0068863_1024534892	3300005841	Switchgrass Rhizosphere	MRKSAIDRMNDYDAVMMGVLEPILVLSVMAVIAFLVPLSW*
Ga0068860_1005689983	3300005843	Switchgrass Rhizosphere	MRKSAIDRMNDDDAVMMGVLEPILVLSVMAVIAFLVPLSW*
Ga0081540_12381271	3300005983	Tabebuia Heterophylla Rhizosphere	MWKSTTDRMNDYDAVVMGVLEPILVLSVMAVIAFLVRLLW*
Ga0070712_1005937653	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	MWKSATVRMNDYDAVVMGVLEPILVLSVMAVIGALLGLL*
Ga0070712_1009938722	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	MLKSTTDRMNDYDAVVMGVLEPILVPSMLAVIAFLVRLFW*
Ga0075422_102915492	3300006196	Populus Rhizosphere	MRKSTTDRMNDYDVVVMGVLEPILVLSVMAVIAFLMRLFW*
Ga0068871_1022337971	3300006358	Miscanthus Rhizosphere	MRKSTTDRMNDYDVVVMGVLEPILVLSVMAVIGALLGLL*
Ga0074055_112665282	3300006573	Soil	MRKSTTDRMDDYDAVVMGVSEPILVLSVMADIAFLVRLFW*
Ga0075421_1002781013	3300006845	Populus Rhizosphere	MRKSTTDRMNDYDAVVMGVLEPILPLLCIALIGAVLGLL*
Ga0075421_1009598441	3300006845	Populus Rhizosphere	MRQSTTDRMNDYDAVVMGVLEPILVLSVMAVIAFPMRLFW*
Ga0075421_1025182581	3300006845	Populus Rhizosphere	LVLKPEMRKSTTDRTMNDYDAVVMGVLEPILVLSVMAVIAFLVRLSW*
Ga0075431_1008875771	3300006847	Populus Rhizosphere	QRKREMRKSTTDRMNDYDAVVMGVLEPILPLLCIALIGAVLGLL*
Ga0075433_101041793	3300006852	Populus Rhizosphere	MRKSTTDTMNDYDVVVMGVLEPILVLSVMAVIAFLVRLSW*
Ga0075425_1017946021	3300006854	Populus Rhizosphere	MRKSTTDRTMNDYDAVVMGVLEPILVLSVMAVIAFLVRLSW*
Ga0075424_1020543561	3300006904	Populus Rhizosphere	MRKSTTDTMNDYDVVVMGVLEPILVLSVMAVIAFLVRLFW*
Ga0105250_102036881	3300009092	Switchgrass Rhizosphere	MNDYDAYDTIVMGVLEPILVLSVMAVIAFLVPLSW*
Ga0105240_118465291	3300009093	Corn Rhizosphere	MNDYDAYDAVVMGILEPILVLSVMAVIAFLVRLSW*
Ga0111539_119702151	3300009094	Populus Rhizosphere	MRKSMTDTMNDYDVYDAVVMGVLEPILVLSVMAVIAALLRLL*
Ga0105091_100260171	3300009146	Freshwater Sediment	TDRMNDYDAVVMGVLEPILPLLCIALIGAVLGLL*
Ga0114129_112861891	3300009147	Populus Rhizosphere	LVLKPEMRKSTTDRTMNDYDAVVMGVLEPILVLSVMAVI
Ga0114129_124162371	3300009147	Populus Rhizosphere	MRKSTTDTMNDYDVYDAVVMGVLEPILVLSVMAVIAALLRLL*
Ga0111538_103056151	3300009156	Populus Rhizosphere	STTDRMNDYDAVVMGVLEPILVLSVMAVIAFPMRLFW*
Ga0111538_121455511	3300009156	Populus Rhizosphere	MRKSTTDSTNDYDAVMMGVLEPIFVLSVMAVIGALLGLL*
Ga0113563_130093842	3300009167	Freshwater Wetlands	MNDYDAYDAVVMGVLEPILVLSVMAVIAFLVRLFW*
Ga0116588_10709872	3300009304	Sediment	MNDYDAVVMGVLEPILVLSVMAVIAFLVRNNLCC*
Ga0105237_113195341	3300009545	Corn Rhizosphere	MNDYDAYDAVVMGVLEPILVLSVMAVIAFLVRLTW*
Ga0105237_119323052	3300009545	Corn Rhizosphere	MRKSTTDTMNDYDVVVMGVLEPILVLSVMAVMAFLVPLSW*
Ga0105238_107927291	3300009551	Corn Rhizosphere	KQRKREMWKSTTDRMNNYDVVVMGVLEPILVLSVMAVIAFLVPLSW*
Ga0105249_126389201	3300009553	Switchgrass Rhizosphere	KSPTDRMNDCDAVVMAVLEPIVVLSVMAVIAFLVRLSW*
Ga0105088_10763821	3300009810	Groundwater Sand	MRKSTTDRMNDYDVVVMGVLEPILVLSIAVIGALLGLL*
Ga0126380_103566652	3300010043	Tropical Forest Soil	LKGITEMLKSTIDRTNDSHALVMGVLEPFLVLSVMAGSAFLVQLFL*
Ga0126384_115543772	3300010046	Tropical Forest Soil	MNDYDAVVMGVLEPFLVLSVMAVIVFLARLFWTA*
Ga0127503_100260712	3300010154	Soil	MRKSTTDRMNDYDAYDAVVMGVLEPILVLSMAVIGALLGLL*
Ga0127503_103470642	3300010154	Soil	MRKSTTDRMNDYDAVVMGVLEPILVLSVMAVIAFGWLS*
Ga0126370_105733443	3300010358	Tropical Forest Soil	MQKYTTDRMNDYVTVVMGVLEPLLVLSVMAVIAFLMQIF*
Ga0126376_100601625	3300010359	Tropical Forest Soil	MWKSTTDRMNNYDTVVMGVLEPILVLSVMAVIASLVRLFW*
Ga0126376_108943463	3300010359	Tropical Forest Soil	MNDYDAVVMGVLEPFLVLSVMAAIVFLLRLFWTA*
Ga0126372_115941091	3300010360	Tropical Forest Soil	MQKYTTDRMNDYFTVVMGVLEPILVLSVMAVIAFLMRIF*
Ga0126377_129625791	3300010362	Tropical Forest Soil	TIDRMNDDDGVMMGVLEPILVLSVMAVIAFLVRLFW*
Ga0134125_107674903	3300010371	Terrestrial Soil	MWTAKTDRMNDYDAVVMGILEPILVLSVMAVIASMVRLFW*
Ga0134125_110950902	3300010371	Terrestrial Soil	KSTTDRMNDYDVVVMGVLEPILVLSVMAVISFLVRLPW*
Ga0134128_112286941	3300010373	Terrestrial Soil	MRKSTTDRMNDYYAVVMGVLEPILVLSVMAVITFLVPLSW*
Ga0105239_114658221	3300010375	Corn Rhizosphere	KSTTDRMNDYDVVVMGVLEPILVLSVMAVIAFLMRLFW*
Ga0134126_106598743	3300010396	Terrestrial Soil	MNDYDAYDAVVMGILEPILVLSVMAVIASMVRLFW*
Ga0126383_106979653	3300010398	Tropical Forest Soil	MLKSPTDRMNDYDTVVMGVLEPILVMSVMAVIASLVRLFW*
Ga0105246_112183631	3300011119	Miscanthus Rhizosphere	MRKSTTDRMNDYDAYDAVVMGVLEPILVLSVMAVIGALLGLL*
Ga0157315_10041942	3300012508	Arabidopsis Rhizosphere	MLKSTTDRMNDYDAVVMGVLEPILVLSVMAVIAFLVW*
Ga0157316_10059402	3300012510	Arabidopsis Rhizosphere	MRKPTTERMNDYDAVVMGVLEPILVLSVMAVIAFLVW*
Ga0157286_103104541	3300012908	Soil	MRKSTTDTMNDYDVVVMGVLEPILVLSVMAVIAALLRLL*
Ga0162651_1000387323	3300012938	Soil	MLKSTTDRMNDHDAVLMGVLEHILVLSVMAVIAFLVRLFW*
Ga0126375_109937651	3300012948	Tropical Forest Soil	MRKSTTDRMNDYYAVVMGVLEPIFVLSVMAVIAFLMRIF*
Ga0164300_100541671	3300012951	Soil	MWKSTTDRMNDYDVVVMGVLEPILVLSVMAVIAFLMPLSW*
Ga0164300_105547242	3300012951	Soil	MRKSTTDRMNDYYAVVMGVLEPILVLSVMAVIAFLVRVSW*
Ga0164300_108977481	3300012951	Soil	MWKSTTDRMNDYDVVVMGVLEPILVLSVMAVIAFLVPLSW*
Ga0164298_101030211	3300012955	Soil	MLKSPTDRMNDFVAVVMGVLEPILVLSVMAVIAFLMRTLW*
Ga0164298_106563123	3300012955	Soil	MRNSTTDRMNDYDAVVMGVLEPILVLSVMAVIAALLRLL*
Ga0164303_100593421	3300012957	Soil	KSTTDRMNDYDVVVMGVLEPILVLSVMAVITFLVRLPW*
Ga0164303_103393682	3300012957	Soil	MWTAKTDRMNDYDAVVMGILEPMLVLSMMAVIGFLMRLFW*
Ga0164299_100065433	3300012958	Soil	MLKSPTDRMNDFVAVVMGVLEPILVLSVMADIAFLVRILW*
Ga0164299_103443911	3300012958	Soil	KQRKREMWKSTTDRMNDYDVVVMGVLEPILVLSVMAVIAFLMPLSW*
Ga0164301_104101461	3300012960	Soil	KSATDRMDEYDAVMMGVLEPILVLSVMAVIAFLVPLSW*
Ga0164301_117832811	3300012960	Soil	MRKSTTDSMNDYDAVVRGVLEPILVLSVMAVIAFLVW*
Ga0164302_103138061	3300012961	Soil	EMRKSTTDRMNDYYAVVMGVLEPILVLSIAVIGALLALL*
Ga0164307_106858012	3300012987	Soil	MRESTTDRMNDYDAYDAVVMGVLEPILVLSVMAVIAFLVRLFW*
Ga0164306_102965923	3300012988	Soil	MRKSTTDRMNDYYAVVMGVLEPILVLSVMAVIAFLVLDL*
Ga0157378_114939962	3300013297	Miscanthus Rhizosphere	MWKSTTDRMNDYDVVVMGVLEPILVLSVMAVMAFLVPLSW*
Ga0163162_107896051	3300013306	Switchgrass Rhizosphere	TDRMNDYDAVVMGVLEPILVLSVMAVIGFLVRLSW*
Ga0163162_121042691	3300013306	Switchgrass Rhizosphere	EMRKSTTDRMNDYDVVVMGVLEPILVLSVMAVIAFLVPLSW*
Ga0157375_116908221	3300013308	Miscanthus Rhizosphere	MLKSTTDRTNDYDAVVMGVLEPMLVLSVMAVIAFLVPLSW*
Ga0157380_107747641	3300014326	Switchgrass Rhizosphere	RKREMRKSTTDRMKDYDAVMMGVLEPSFVLSVMAVIGALLGLL*
Ga0157377_109831252	3300014745	Miscanthus Rhizosphere	MLKSTTDRTNDYDAVVMGVLEPMLVLSVMAVIAFLVRLFW*
Ga0132258_109570091	3300015371	Arabidopsis Rhizosphere	MRKSTIDRMNDYDAYDAVVMGALEPILVLSVMAVIAALLRLL*
Ga0132258_123524431	3300015371	Arabidopsis Rhizosphere	MDPEMWNSTTDRMNDYNAVVMGVLEPILVLSVMAVIASLVRLFW*
Ga0132258_124035982	3300015371	Arabidopsis Rhizosphere	MWKSTTDRVNDYDAVVMGVLEPILVLSLMAVIAFLVRLSW*
Ga0132256_1009605211	3300015372	Arabidopsis Rhizosphere	RKSTTDRMNDYDVVVIGVLEPILVLSVMAVIAFLVPLSW*
Ga0132257_1023386651	3300015373	Arabidopsis Rhizosphere	MRKSTTDRMNDYDAVVMGVLEPILVLSLMAVIAFLVRLSW*
Ga0132257_1036046441	3300015373	Arabidopsis Rhizosphere	SSREVMDPEMWNSTTDRMNDYNAVVMGVLEPILVLSVMAVIASLVRLFW*
Ga0132255_1017159603	3300015374	Arabidopsis Rhizosphere	MRKSMTYRMNDYDNVVMGVLEPILVLSVMAVIASLVRLFW*
Ga0163161_101605492	3300017792	Switchgrass Rhizosphere	MRKSTTDRMNDYDVVMIGVLEPILVLSVMAVIAFLVPLSW
Ga0187785_102162852	3300017947	Tropical Peatland	EMRKSTTDRMNDYVPVVMGVLEPILVLSVMAVIAFLMRIF
Ga0184610_12918112	3300017997	Groundwater Sediment	MRKSTTDRMNDYDVVVMGVLEPILVLSVMAVITFLVRLPW
Ga0184608_103739881	3300018028	Groundwater Sediment	MLKSTTDRINDYDAVAMGVLEPILVLSVMAVSAFLLRLFW
Ga0184621_100749172	3300018054	Groundwater Sediment	MRKSATDRMNGYDAVMMGVLEPILVLSVMAVIAFLVRLFW
Ga0184635_103771331	3300018072	Groundwater Sediment	MRKSTTDRMNDYDAVVMAVLEPILVLSVMAVIAFLVRLSW
Ga0184612_104141601	3300018078	Groundwater Sediment	MLKSTTDRMNDHDAVLMGVLEPILVLSVMAVIAFLVRLSW
Ga0184625_101027812	3300018081	Groundwater Sediment	MLKSTTDRMNDHDAVLMGVLEPILVLSVMAVIAFLVRLFW
Ga0190269_103017491	3300018465	Soil	MRKSTTDRMNDYDAYDAVVMGVLEPILVLSVMAVIAFVRRILW
Ga0190270_111256902	3300018469	Soil	MRKSTTDRMDDYDAVVMGVLEPILVLSIVVIGALLGLL
Ga0173481_101907913	3300019356	Soil	MRKSTTDRMNDYDVVVMGVLEPILVLSVMAVIAFLMRILW
Ga0173479_106088641	3300019362	Soil	MRKSTTDRMDDYDAVVIGVLEPILVLSVMAVVAYLVRIFW
Ga0187892_1000079171	3300019458	Bio-Ooze	MWKSTTHRMNDYDAVVMGVLEPILVLSVMAMSVFLAQLFW
Ga0190267_114480171	3300019767	Soil	MRKSTTDRMNDYDAVVMGVLEPILVLSIAVIGAALLGLL
Ga0210382_105538691	3300021080	Groundwater Sediment	MRKSTIHRMNDYDAVVMGVLEPILVLSVMAVSAFLVRLFW
Ga0210379_104560911	3300021081	Groundwater Sediment	MLKSTTDRTNDYDAVVMGVLEPILVLSVMAVIAFLVRLFW
Ga0242654_102915991	3300022726	Soil	EMLKSPTDRMNDFVAVVMRVLEPILVLSVMAVIAFLMRTLW
Ga0207647_100980432	3300025904	Corn Rhizosphere	MRKSATDRMNDYDAVMMGVLEPIFVLSVMAVIGALLGLL
Ga0207695_115372421	3300025913	Corn Rhizosphere	MRKSTTDRMNDYDVVVMGVLEPILVLSVMAVIAFLVRLFW
Ga0207662_103864403	3300025918	Switchgrass Rhizosphere	MRKSTTDRMNDYDVVVMGVLEPILVLSVMAVIAFLVPLSW
Ga0207659_111125132	3300025926	Miscanthus Rhizosphere	MWKSTTDRMNDYDVVVMGVLEPILVLSVMAVMAFLVPLSW
Ga0207644_112096452	3300025931	Switchgrass Rhizosphere	MRKSTTDRMNDYDVVVMGVLEPILVLSVMAVMAFLVPLSW
Ga0207670_112449421	3300025936	Switchgrass Rhizosphere	MRKSAIDRMNDYDAVMMGVLEPILVLSVMAVIAFLVPLSW
Ga0207704_115460901	3300025938	Miscanthus Rhizosphere	MRKSTTDRMNDYDAYDAVVMGVLEPILVLSVMAVIAFLVRLSW
Ga0207667_118849441	3300025949	Corn Rhizosphere	MRKSTTDRMNDYDVVVMGVLEPILVLSVMAVIAFLVRLSW
Ga0207651_109100161	3300025960	Switchgrass Rhizosphere	MWKSTTDRMNDYDVVVMGVLEPILVLSVMAVVAYLVRIFW
Ga0207708_100794703	3300026075	Corn, Switchgrass And Miscanthus Rhizosphere	MWKSTTDRMNDYDVVVMGVLEPILVLSVMAVITFLVPLLR
Ga0207708_115639321	3300026075	Corn, Switchgrass And Miscanthus Rhizosphere	MWTAKTDRMNDYDAVVMGILEPILVLSVMAVIASMVRLFW
Ga0207675_1023307052	3300026118	Switchgrass Rhizosphere	LKSTTDRMNDHDAVLMGILEPILVLSVMAVIAFLVRLFW
Ga0209861_10686102	3300027332	Groundwater Sand	MRKSTTDRMNDYDVVVMGVLEPILVLSVMAVIAFLLRLFW
Ga0208637_10083041	3300027401	Soil	MRKSATDRMNDYDAVMMGVLEPILVLSVMAVIAFLVRLFW
Ga0208890_10046382	3300027523	Soil	MRKSTTDRMNDYDAVVMGVLEPILVLSVMAVIAFLVRLFW
Ga0209983_10683383	3300027665	Arabidopsis Thaliana Rhizosphere	MRKSTTDRMNDYDVVVMGVLEPILVLSVMAVIAFLMRLFW
Ga0209593_102166652	3300027743	Freshwater Sediment	MRKSTTDRMNDYDAVVMGVLEPILPLLYIALIGAVLGLL
Ga0209811_104440922	3300027821	Surface Soil	MWKSTTDRMNDYDVVVMGVLEPILVLSVMAVIAFLVPLSW
Ga0209974_100673513	3300027876	Arabidopsis Thaliana Rhizosphere	MRKSTTDRTMNDYDAVVMGVLEPILVLSVMAVIAW
Ga0209069_104453782	3300027915	Watersheds	MRKSTTDRMNDYDAVVMGVLEPILVLSIAVIGALLG
Ga0268265_109146921	3300028380	Switchgrass Rhizosphere	MRKSTTDRMNDYDVYDAVVMGVLEPILVLSVMAVIGALLGLL
Ga0247822_101786121	3300028592	Soil	MLKSTTDRMNDHDAVLMGILEPILVLSVMAVIAFLVRLFW
Ga0247820_110289351	3300028597	Soil	MRKSTTDRMNDYDAVVMGVLEPIFVLSVMAVVAYLVRIFW
Ga0247819_109728581	3300028608	Soil	MLKSTTDRMNDYDAVVMGVLEPILVLSVMAVIAFLVRLFW
Ga0247827_109269261	3300028889	Soil	MLKSPTDRMNDYDAVVMAVLEPIVVLSVMAVIAFLVRLFW
Ga0307498_100011211	3300031170	Soil	MRKSATDRMNDYDAVMMGVLEPILVLSVMAVIAFLVPLSW
Ga0310887_101218733	3300031547	Soil	MWKSTTDRMNDYDVVVMGVLEPILVLSVMAVIAFLMPLSW
Ga0310886_109920422	3300031562	Soil	MRKSTTDRMDDYDAVVMAVLEPILVLSVMAVIAFLV
Ga0307480_10219962	3300031677	Hardwood Forest Soil	MRKSTTDRMNDYDAVMMGVLEPFFLLSVMATSAFLLRLFW
Ga0307469_115136692	3300031720	Hardwood Forest Soil	MRKSTTDTMNDYDVVVMGVLEPILVLSVMAVITFLVRLPW
Ga0307469_115754651	3300031720	Hardwood Forest Soil	MRKSTTVRMNDYDAVVMGVLEPILVLSVMAVIAFLVRLFW
Ga0307468_1016372352	3300031740	Hardwood Forest Soil	MRKSTTDRMNDYDAVVMGVLEPILVLSVMAVIAFLVRLSW
Ga0307473_111481961	3300031820	Hardwood Forest Soil	THLKQRKREMWKSATVRMNDYDAVVMGVLEPILVLSVMAVIGALLGLL
Ga0310907_108603372	3300031847	Soil	MRKSTTVRMNDYDAVVMGVLEPILVLSVMAVIAFLVRLSW
Ga0310904_105387391	3300031854	Soil	MRKPMTDRMDDYDVVVMGVLEPILVLSVMAVIAFLVQRFAM
Ga0310892_101893782	3300031858	Soil	MRKSTTDRMNDYDAVVMGVLEPILVLSVMAVIAFLVPLSW
Ga0310885_105924581	3300031943	Soil	MRKSTTDRMDDYDAVMMGVLEPIFVLSVMAVIGALLGLL
Ga0310884_103922672	3300031944	Soil	STTVRMNDYEAVVMGVLEPILVLSVMAVIAFLVRLSW
Ga0310884_109297381	3300031944	Soil	MRKSTIDRMNDYDAYDAVVMGILEPILVLSVMAVIAFLVRLSW
Ga0310906_100022109	3300032013	Soil	EMRKSTTDRMDDYDGVVIGVLEPILVLSVMAVVAYLVRIFW
Ga0307471_1021700883	3300032180	Hardwood Forest Soil	MRKSATVRMNDYDAVVMGVLEPILVLSVMAVIGALLGLL
Ga0307472_1012572751	3300032205	Hardwood Forest Soil	MRKSTTDRMNDYDAVVMGVLEPILVLSVMAVIGFLVRLSW
Ga0307472_1015454231	3300032205	Hardwood Forest Soil	STTDTMNDYDAVVMGVLEPILVLSVMAVIAFLVPLSW
Ga0307472_1017166672	3300032205	Hardwood Forest Soil	MRKSTTDTMNDYDVVVMGVLEPILVLSVMAVITFLVRLSW
Ga0307472_1026314632	3300032205	Hardwood Forest Soil	MPEMRKSTTSMNNYDAVVMGVLEPILVLSVMAVIAFLVRLSW
Ga0310896_107931002	3300032211	Soil	MRKSTTDRMNDYDAVMMGVLEPIFVLSVMAVIGALLGLL
Ga0247830_105253252	3300033551	Soil	SLIALLAALAVQRKREMRKSTTDRMNDYDAVMMGVLEPIFVLSVMAVIGALLGLL
Ga0247830_105355041	3300033551	Soil	STTDRMDDYDAVVIGVLEPILVLSVMAVVAYLVRIFW
Ga0247830_109164172	3300033551	Soil	MRKSTTDRMNDYDDYDAVVMGVLEPVLVLSVMAVIAFLVR
Ga0247830_114120691	3300033551	Soil	MLKSPTDRMNDCDAVVMAVLEPIVVLSVMAVIAFLVRLFW
Ga0373905_088243_396_503	3300034414	Sediment Slurry	MNDYDAYDAVVMGVLEPILVLSVMAVIAFLVRLSW
Ga0314782_155735_267_395	3300034661	Soil	MRKSTTDRMNDYDAYDAVVMGVLEPILVLSVMAVIGALLGLL
Ga0373948_0205001_396_515	3300034817	Rhizosphere Soil	MQKSTTDRMNDYDAVVMGVLEPILVLSVMADIAFLVGLFW

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.49
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.49
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F029499

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign