NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F029460

Metagenome / Metatranscriptome Family F029460

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F029460
Family Type Metagenome / Metatranscriptome
Number of Sequences 188
Average Sequence Length 83 residues
Representative Sequence NKCAFFQFLALYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNSS
Number of Associated Samples 165
Number of Associated Scaffolds 188

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 12.97 %
% of genes near scaffold ends (potentially truncated) 57.45 %
% of genes from short scaffolds (< 2000 bps) 95.74 %
Associated GOLD sequencing projects 154
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (97.872 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(22.340 % of family members)
Environment Ontology (ENVO) Unclassified
(49.468 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(67.021 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 8.97%    β-sheet: 39.74%    Coil/Unstructured: 51.28%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 188 Family Scaffolds
PF00026Asp 50.53
PF01488Shikimate_DH 0.53
PF00238Ribosomal_L14 0.53

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 188 Family Scaffolds
COG0093Ribosomal protein L14Translation, ribosomal structure and biogenesis [J] 0.53


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.40 %
UnclassifiedrootN/A1.60 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000117|DelMOWin2010_c10192544All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium634Open in IMG/M
3300000130|SA_S2_NOR15_50mDRAFT_c10119340All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani917Open in IMG/M
3300000136|KGI_S1_ANT02_95mDRAFT_c10052376All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1229Open in IMG/M
3300001263|BBAY83_10027139All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1900Open in IMG/M
3300003860|Ga0031658_1098846All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani528Open in IMG/M
3300003909|JGI26087J52781_1012374All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium958Open in IMG/M
3300004685|Ga0065177_1068762All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium660Open in IMG/M
3300004765|Ga0007745_1124048All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani526Open in IMG/M
3300004771|Ga0007797_1195645All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium509Open in IMG/M
3300005043|Ga0071100_1079318All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium764Open in IMG/M
3300005516|Ga0066831_10027757All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1535Open in IMG/M
3300005662|Ga0078894_10345809All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1347Open in IMG/M
3300006122|Ga0007837_1024976All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1015Open in IMG/M
3300006355|Ga0075501_1288406All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1445Open in IMG/M
3300006357|Ga0075502_1573245All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium914Open in IMG/M
3300006397|Ga0075488_1611333All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1897Open in IMG/M
3300006803|Ga0075467_10532783All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani603Open in IMG/M
3300007513|Ga0105019_1065887All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium2092Open in IMG/M
3300007523|Ga0105052_10690242All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium648Open in IMG/M
3300007543|Ga0102853_1049942All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani732Open in IMG/M
3300007545|Ga0102873_1088736All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani938Open in IMG/M
3300007552|Ga0102818_1018178All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1388Open in IMG/M
3300007552|Ga0102818_1029526All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1083Open in IMG/M
3300007692|Ga0102823_1195304All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium541Open in IMG/M
3300007718|Ga0102852_1061778All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani717Open in IMG/M
3300007725|Ga0102951_1166299All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani622Open in IMG/M
3300007954|Ga0105739_1078074All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae742Open in IMG/M
3300008259|Ga0114841_1125063All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1067Open in IMG/M
3300008936|Ga0103739_1036204All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium678Open in IMG/M
3300008952|Ga0115651_1129311All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1818Open in IMG/M
3300008993|Ga0104258_1012883All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1544Open in IMG/M
3300008993|Ga0104258_1110970All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium513Open in IMG/M
3300009002|Ga0102810_1026965All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1908Open in IMG/M
3300009002|Ga0102810_1037747All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1577Open in IMG/M
3300009071|Ga0115566_10726113All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium549Open in IMG/M
3300009130|Ga0118729_1108602All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1331Open in IMG/M
3300009172|Ga0114995_10690042All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium558Open in IMG/M
3300009193|Ga0115551_1212828All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani865Open in IMG/M
3300009265|Ga0103873_1070072All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani696Open in IMG/M
3300009420|Ga0114994_11051184All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium526Open in IMG/M
3300009434|Ga0115562_1275033All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium581Open in IMG/M
3300009441|Ga0115007_10278872All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1083Open in IMG/M
3300009442|Ga0115563_1046164All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium2106Open in IMG/M
3300009592|Ga0115101_1744079All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1960Open in IMG/M
3300009606|Ga0115102_10138400All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1072Open in IMG/M
3300009606|Ga0115102_10444538All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1701Open in IMG/M
3300009606|Ga0115102_10802424All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium807Open in IMG/M
3300009677|Ga0115104_10927164All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum595Open in IMG/M
3300009679|Ga0115105_10564300All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1063Open in IMG/M
3300009679|Ga0115105_10958009All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani710Open in IMG/M
3300010299|Ga0129342_1038044All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1920Open in IMG/M
3300010883|Ga0133547_10662433All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium2074Open in IMG/M
3300010981|Ga0138316_10687835All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1030Open in IMG/M
3300010981|Ga0138316_10966918All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1938Open in IMG/M
3300010985|Ga0138326_10306807All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani710Open in IMG/M
3300010985|Ga0138326_11336602All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium612Open in IMG/M
3300010987|Ga0138324_10465622All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium624Open in IMG/M
3300012036|Ga0136600_1018116All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1831Open in IMG/M
3300012417|Ga0138262_1565400All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1123Open in IMG/M
3300012419|Ga0138260_10948650All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1359Open in IMG/M
3300012470|Ga0129329_1048393All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani577Open in IMG/M
3300012516|Ga0129325_1157452All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium515Open in IMG/M
3300012518|Ga0129349_1386493All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani784Open in IMG/M
3300012525|Ga0129353_1561396All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium755Open in IMG/M
3300012714|Ga0157601_1229883All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium612Open in IMG/M
3300012725|Ga0157610_1151396All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium519Open in IMG/M
3300012752|Ga0157629_1020621All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium594Open in IMG/M
3300012765|Ga0138274_1205764All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum819Open in IMG/M
3300012935|Ga0138257_1684726All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium555Open in IMG/M
3300013295|Ga0170791_11359853All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium880Open in IMG/M
3300016723|Ga0182085_1381398All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani935Open in IMG/M
3300016731|Ga0182094_1244358All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1158Open in IMG/M
3300016731|Ga0182094_1381536All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani591Open in IMG/M
3300017719|Ga0181390_1117456All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium696Open in IMG/M
3300017740|Ga0181418_1126709All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium616Open in IMG/M
3300017772|Ga0181430_1220610All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium538Open in IMG/M
3300017957|Ga0181571_10214760All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1241Open in IMG/M
3300017964|Ga0181589_10681709All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani646Open in IMG/M
3300017986|Ga0181569_10730800All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani653Open in IMG/M
3300018049|Ga0181572_10174323All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1403Open in IMG/M
3300018418|Ga0181567_10340538All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1001Open in IMG/M
3300018684|Ga0192983_1052250All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani562Open in IMG/M
3300018842|Ga0193219_1023862All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani919Open in IMG/M
3300018846|Ga0193253_1096263All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani695Open in IMG/M
3300018905|Ga0193028_1024869All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1162Open in IMG/M
3300018926|Ga0192989_10055680All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1016Open in IMG/M
3300018977|Ga0193353_10187798All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani608Open in IMG/M
3300018980|Ga0192961_10178598All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium643Open in IMG/M
3300018980|Ga0192961_10217806All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium569Open in IMG/M
3300018982|Ga0192947_10014856All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1950Open in IMG/M
3300018982|Ga0192947_10017078All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1870Open in IMG/M
3300018982|Ga0192947_10060184All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1207Open in IMG/M
3300018989|Ga0193030_10082074All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium956Open in IMG/M
3300019010|Ga0193044_10264845All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium525Open in IMG/M
3300019024|Ga0193535_10046936All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1317Open in IMG/M
3300019031|Ga0193516_10021441All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1926Open in IMG/M
3300019031|Ga0193516_10087620All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1058Open in IMG/M
3300019045|Ga0193336_10024432All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1294Open in IMG/M
3300019045|Ga0193336_10154841All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium861Open in IMG/M
3300019048|Ga0192981_10138411All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum963Open in IMG/M
3300019095|Ga0188866_1006178All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1103Open in IMG/M
3300019095|Ga0188866_1022777All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani659Open in IMG/M
3300019118|Ga0193157_1006256All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1053Open in IMG/M
3300019149|Ga0188870_10080401All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium793Open in IMG/M
3300020013|Ga0182086_1054391All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1048Open in IMG/M
3300020048|Ga0207193_1176345All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1735Open in IMG/M
3300020161|Ga0211726_10897490All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium722Open in IMG/M
3300020441|Ga0211695_10436499All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani500Open in IMG/M
3300021353|Ga0206693_1132092All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani570Open in IMG/M
3300021365|Ga0206123_10079166All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1613Open in IMG/M
3300021389|Ga0213868_10083793All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium2094Open in IMG/M
3300021872|Ga0063132_132870All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani568Open in IMG/M
3300021910|Ga0063100_1003710All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1775Open in IMG/M
3300021910|Ga0063100_1032061All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1663Open in IMG/M
3300021925|Ga0063096_1003549All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium988Open in IMG/M
3300021925|Ga0063096_1019612All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium852Open in IMG/M
3300021964|Ga0222719_10701038All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani572Open in IMG/M
3300023087|Ga0255774_10285767All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium799Open in IMG/M
3300023696|Ga0228687_1047735All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium509Open in IMG/M
3300025388|Ga0208503_1012152All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1015Open in IMG/M
3300025640|Ga0209198_1129321All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani733Open in IMG/M
3300025773|Ga0208104_1023172All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani767Open in IMG/M
3300025897|Ga0209425_10291524All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium823Open in IMG/M
3300026182|Ga0208275_1010190All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium2079Open in IMG/M
3300026418|Ga0247564_1027029All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1042Open in IMG/M
3300026419|Ga0247575_1071691All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani674Open in IMG/M
3300026443|Ga0247559_1107219All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani576Open in IMG/M
3300026447|Ga0247607_1082276All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani569Open in IMG/M
3300026448|Ga0247594_1008597All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1548Open in IMG/M
3300026458|Ga0247578_1071241All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani673Open in IMG/M
3300026466|Ga0247598_1101324All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani739Open in IMG/M
3300026500|Ga0247592_1095703All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani717Open in IMG/M
3300026500|Ga0247592_1107313All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani672Open in IMG/M
3300027159|Ga0208020_1009611All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1908Open in IMG/M
3300027159|Ga0208020_1041245All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium876Open in IMG/M
3300027183|Ga0208798_1028355All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium649Open in IMG/M
3300027248|Ga0208176_1042778All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium586Open in IMG/M
3300027366|Ga0208556_1096015All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani537Open in IMG/M
3300027753|Ga0208305_10130123All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani931Open in IMG/M
3300027810|Ga0209302_10199727All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium958Open in IMG/M
3300027983|Ga0209284_10426209All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium649Open in IMG/M
3300028106|Ga0247596_1042530All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1004Open in IMG/M
3300028106|Ga0247596_1107423All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani632Open in IMG/M
3300028134|Ga0256411_1156816All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani743Open in IMG/M
3300028250|Ga0247560_117247All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium548Open in IMG/M
3300028282|Ga0256413_1363142All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium506Open in IMG/M
3300028334|Ga0247597_1043233All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani607Open in IMG/M
3300030671|Ga0307403_10045587All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1856Open in IMG/M
3300030699|Ga0307398_10162126All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1163Open in IMG/M
3300030702|Ga0307399_10079565All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1329Open in IMG/M
3300030720|Ga0308139_1074087All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani519Open in IMG/M
3300030722|Ga0308137_1022436All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1124Open in IMG/M
3300030856|Ga0073990_11980786All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1164Open in IMG/M
3300030857|Ga0073981_11661457All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani533Open in IMG/M
3300030859|Ga0073963_11194087All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium712Open in IMG/M
3300030912|Ga0073987_11175885All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani542Open in IMG/M
3300030958|Ga0073971_10900752All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani578Open in IMG/M
3300031038|Ga0073986_12019993All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani745Open in IMG/M
3300031062|Ga0073989_13221810All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium882Open in IMG/M
3300031120|Ga0073958_11271640All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1279Open in IMG/M
3300031216|Ga0307980_1038972All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1069Open in IMG/M
3300031398|Ga0307979_1111364All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani590Open in IMG/M
3300031523|Ga0307492_10080068All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1111Open in IMG/M
3300031540|Ga0308143_128727All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium554Open in IMG/M
3300031557|Ga0308148_1029102All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani625Open in IMG/M
3300031558|Ga0308147_1009227All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1189Open in IMG/M
3300031569|Ga0307489_10075049All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1903Open in IMG/M
3300031710|Ga0307386_10038284All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1744Open in IMG/M
3300031710|Ga0307386_10040981All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1708Open in IMG/M
3300031725|Ga0307381_10174799All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium744Open in IMG/M
3300031725|Ga0307381_10410356All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium501Open in IMG/M
3300031734|Ga0307397_10121183All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1102Open in IMG/M
3300031738|Ga0307384_10123332All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1084Open in IMG/M
3300031739|Ga0307383_10522725All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani593Open in IMG/M
3300032360|Ga0315334_10658334All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani905Open in IMG/M
3300032517|Ga0314688_10625664All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani581Open in IMG/M
3300032519|Ga0314676_10104052All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1428Open in IMG/M
3300032651|Ga0314685_10784025All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium507Open in IMG/M
3300032708|Ga0314669_10072909All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1447Open in IMG/M
3300032723|Ga0314703_10234479All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium761Open in IMG/M
3300032728|Ga0314696_10275007All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium863Open in IMG/M
3300032743|Ga0314707_10218578All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum973Open in IMG/M
3300032746|Ga0314701_10147935All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1024Open in IMG/M
3300033572|Ga0307390_10275721All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium996Open in IMG/M
3300033572|Ga0307390_10390708All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani848Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine22.34%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine14.89%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater9.04%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine7.45%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh5.85%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater4.79%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous4.79%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater2.66%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake2.66%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine2.66%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.60%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.60%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater1.60%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine1.60%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.06%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater1.06%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine1.06%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water1.06%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water1.06%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.53%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton0.53%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.53%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment0.53%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.53%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.53%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.53%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.53%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine0.53%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.53%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.53%
Marine Subseafloor AquiferEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine Subseafloor Aquifer0.53%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.53%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.53%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.53%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine0.53%
Saline LakeEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake0.53%
WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water0.53%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface0.53%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water0.53%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica0.53%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300000130Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 2 sample NOR 15_50mEnvironmentalOpen in IMG/M
3300000136Marine microbial communities from chronically polluted sediments in Antarctica - King George Island site S1 sample ANT 02_9.5mEnvironmentalOpen in IMG/M
3300001263Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY83Host-AssociatedOpen in IMG/M
3300003860Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PLEnvironmentalOpen in IMG/M
3300003909Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_133SG_5_DNAEnvironmentalOpen in IMG/M
3300004685Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Jul08 (version 2)EnvironmentalOpen in IMG/M
3300004765Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004771Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA2.5MEnvironmentalOpen in IMG/M
3300005043Mid-Atlantic Ridge North Pond Expedition - Sample 1382AEnvironmentalOpen in IMG/M
3300005516Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49BEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300006122Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE31Jul07EnvironmentalOpen in IMG/M
3300006355Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006357Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006397Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300007513Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300007523Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-03EnvironmentalOpen in IMG/M
3300007543Estuarine microbial communities from the Columbia River estuary - metaG 1370B-3EnvironmentalOpen in IMG/M
3300007545Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3EnvironmentalOpen in IMG/M
3300007552Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.571EnvironmentalOpen in IMG/M
3300007692Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743EnvironmentalOpen in IMG/M
3300007718Estuarine microbial communities from the Columbia River estuary - metaG 1370A-3EnvironmentalOpen in IMG/M
3300007725Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MGEnvironmentalOpen in IMG/M
3300007954Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373B_0.2umEnvironmentalOpen in IMG/M
3300008259Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NAEnvironmentalOpen in IMG/M
3300008936Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 3BEnvironmentalOpen in IMG/M
3300008952Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7umEnvironmentalOpen in IMG/M
3300008993Marine microbial communities from eastern North Pacific Ocean - P1 free-livingEnvironmentalOpen in IMG/M
3300009002Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573EnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009130Combined Assembly of Gp0139511, Gp0139512EnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009193Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321EnvironmentalOpen in IMG/M
3300009265Eukaryotic communities of water from the North Atlantic ocean - ACM8EnvironmentalOpen in IMG/M
3300009420Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152EnvironmentalOpen in IMG/M
3300009434Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516EnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009442Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519EnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010299Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNAEnvironmentalOpen in IMG/M
3300010883western Arctic Ocean co-assemblyEnvironmentalOpen in IMG/M
3300010981Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 4)EnvironmentalOpen in IMG/M
3300010985Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 8)EnvironmentalOpen in IMG/M
3300010987Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6)EnvironmentalOpen in IMG/M
3300012036Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 2 #698EnvironmentalOpen in IMG/M
3300012417Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA13.B_72.20151113 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012419Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA10.B_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012470Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012516Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012518Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012525Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012714Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES125 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012725Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES137 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012752Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES162 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012765Freshwater microbial communities from Lake Croche, Canada - C_131016_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012935Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA5.ICE_1m.20151110 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012967Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300016723Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041405ZT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016727Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011510BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016731Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041412AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017740Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13EnvironmentalOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300017957Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017964Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017986Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018049Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018418Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018684Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782225-ERR1712160)EnvironmentalOpen in IMG/M
3300018842Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_046 - TARA_N000000267 (ERX1789679-ERR1719218)EnvironmentalOpen in IMG/M
3300018846Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503)EnvironmentalOpen in IMG/M
3300018905Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002775 (ERX1789358-ERR1719472)EnvironmentalOpen in IMG/M
3300018926Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001309 (ERX1789376-ERR1719276)EnvironmentalOpen in IMG/M
3300018977Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001816 (ERX1782322-ERR1711977)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019010Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809462-ERR1739838)EnvironmentalOpen in IMG/M
3300019024Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002797 (ERX1789427-ERR1719237)EnvironmentalOpen in IMG/M
3300019031Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019095Metatranscriptome of marine microbial communities from Baltic Sea - GS694_3p0_dTEnvironmentalOpen in IMG/M
3300019118Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000396 (ERX1782223-ERR1711898)EnvironmentalOpen in IMG/M
3300019149Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dTEnvironmentalOpen in IMG/M
3300020013Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041406CT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020048Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915EnvironmentalOpen in IMG/M
3300020161Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1EnvironmentalOpen in IMG/M
3300020441Marine prokaryotic communities collected during Tara Oceans survey from station TARA_078 - TARA_B100000524 (ERX556088-ERR599006)EnvironmentalOpen in IMG/M
3300021353Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021389Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127EnvironmentalOpen in IMG/M
3300021872Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021910Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-87M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021925Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-51M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021964Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34DEnvironmentalOpen in IMG/M
3300023087Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaGEnvironmentalOpen in IMG/M
3300023696Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 52R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025388Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE31Jul07 (SPAdes)EnvironmentalOpen in IMG/M
3300025640Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 (SPAdes)EnvironmentalOpen in IMG/M
3300025773Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29May09 (SPAdes)EnvironmentalOpen in IMG/M
3300025897Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes)EnvironmentalOpen in IMG/M
3300026182Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49B (SPAdes)EnvironmentalOpen in IMG/M
3300026418Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 12R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026419Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 30R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026443Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 4R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026447Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 125R_r (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026448Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 57R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026458Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 36R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026466Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 70R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026500Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 54R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027159Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573 (SPAdes)EnvironmentalOpen in IMG/M
3300027183Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.571 (SPAdes)EnvironmentalOpen in IMG/M
3300027248Estuarine microbial communities from the Columbia River estuary - metaG 1558A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027366Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027753Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 (SPAdes)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027983Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-03 (SPAdes)EnvironmentalOpen in IMG/M
3300028106Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 66R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028134Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_12 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028250Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 8R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028334Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 68R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030702Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030720Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_952_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030722Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_943_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030856Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S23_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030857Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S5_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030859Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_R_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030912Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S15_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030958Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_X_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031038Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S14_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031062Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S21_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031120Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E5_V_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031216Marine microbial communities from Ellis Fjord, Antarctic Ocean - #1060EnvironmentalOpen in IMG/M
3300031398Marine microbial communities from Ellis Fjord, Antarctic Ocean - #1058EnvironmentalOpen in IMG/M
3300031523Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SI3LEnvironmentalOpen in IMG/M
3300031540Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB9_544_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031557Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_328_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031558Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_325_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032360Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 34915EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032519Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032651Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032708Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032723Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032728Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032743Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032744Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb9_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032746Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
DelMOWin2010_1019254423300000117MarineLALYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGEGPYALFGGYNSS*
SA_S2_NOR15_50mDRAFT_1011934033300000130MarineMSNVQLKMQLKGNKCAFFQFLALYKSQGLGHDSDGILGLSPHKDWKKKKLHYLWSLKDNKIIDRAIVSFSITSKDMGETPYALFGGYNSSQIVGGAEGLKTFRNFDN
KGI_S1_ANT02_95mDRAFT_1005237633300000136MarineMSNVQLKMQLKGNKCAFFQFLALYKSQGLGHDSDGILGLSPHKDWKKKKLHYLWSLKDNGIIDRAMVSFSITSKDMGETPYALFGGYNSSQIVGGAEGLKTFKNFENWL
BBAY83_1002713933300001263Macroalgal SurfaceLALYKSQGLGHDSDGILGLSPHKDWKKKKLHYLWSLKDNGIIDRAMVSFSITSKDMGETPYALFGGYNSS*
Ga0031658_109884623300003860Freshwater Lake SedimentSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNSS*
JGI26087J52781_101237433300003909MarineLALYKAQGLGKKSDGILGLSPHKDPSKQKLHYLWSXKDNGIIDHAMVSFSVTSQDMGETPYALFGGYNSSQIVGGAN
Ga0065177_106876213300004685FreshwaterVHISNFWLYINRGLGQNSDGILGLSPHKDMSKKKLHYLWSLKDNGIIDHAMVSFSVTSKEMNETPY
Ga0007745_112404823300004765Freshwater LakeDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNSS*
Ga0007797_119564513300004771FreshwaterMHLANKILTKSLVELKLQLKENKVHISNFWLYINRKLGQNSDGILGLSPHKDMSKKKLHYLWSLKDNGIIDHAMVSFSVTSKEMNETPY
Ga0071100_107931823300005043Marine Subseafloor AquiferLKENKCAYFQFLSLYKSQGLGNNSDGILGLSPHKDMSKKKLHYLWSLKDNGIIDNAVVSFSVTSKEMGDSPYALFGGFNSS*
Ga0066831_1002775723300005516MarineLALYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMNEGPYALFGGYNST*
Ga0078894_1034580933300005662Freshwater LakeLYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNSS*
Ga0007837_102497633300006122FreshwaterGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNSS*
Ga0075501_128840633300006355AqueousMQLKGNKCAFFQFLALYKSQGLGHDSDGILGLSPHKDWKKKKLHYLWSLKDNGIIDRAMVSFSITSKD*
Ga0075502_157324523300006357AqueousVNSKSLVEIKMRLKENKCAYFQFLALYKSQGLGQKSDGILGLSPHKDMSKKKLHYLWSLKDNGIIDHAMVSFSVTSKEMNETPYALFGGYNSS*
Ga0075488_161133333300006397AqueousLALYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNST*
Ga0075467_1053278323300006803AqueousMNKAEGSTSMVELKLQLKENKCAFFQFLSLYKSEGLGHDSDGILGLSPHKDMGKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGG
Ga0105019_106588733300007513MarineLKGSTSNAVQLKLELKANKCAFFQFLALYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNST*
Ga0105052_1069024223300007523FreshwaterLALYKSEGLGHDSDGILGLSPHKDLKKNKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNST*
Ga0102853_104994213300007543EstuarineSAVQLRMELKNNKCAFFQFLSLYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGESPYALFGGYNSSQIVNGAEYLKTFKNF*
Ga0102873_108873613300007545EstuarineNKCAFFQFLALYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNSS*
Ga0102818_101817833300007552EstuarineMELQHNKCAFFQFLALYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNSS*
Ga0102818_102952613300007552EstuarineMQLKNNKCAFFQFLSLYKSEVLGHDSDGILGLSPHKDMSKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNSS*
Ga0102823_119530413300007692EstuarineKPQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNST*
Ga0102852_106177813300007718EstuarineLKEEAKQFSAVQLRMELKNNKCAFFQFLSLYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGESPYALFGGYNSSQIVNGAEGLKTFKNF*
Ga0102951_116629923300007725WaterWEDYTCIQPLKMTSKSTVDMKLQLKQNKCALFQFLALYKSQGLGKKSDGILGLSPHKDMNKKKLHYLWSLKDNGIIDRAMVSFSVTSKDMGETPYALFGGYNST*
Ga0105739_107807413300007954Estuary WaterMELKNNKCAFFQFLSLYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGESPYALFGGYNSSQIVNGAEGLKTFKNF*
Ga0114841_112506313300008259Freshwater, PlanktonLYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSISITSKEMGETPYALFGGYNSS*
Ga0103739_103620413300008936Ice Edge, Mcmurdo Sound, AntarcticaVCAFITFQLNKNTKSLVDLKLQLKSNKCAYFQFLALYKSQGLGNNSDGILGLSPHKDMSKKKLHYLWSLKDNGIIDHAMVSFSVTSKEMNETPYALFGGYNSSQIVNGADGLKTFKNFPNWLGTWALEG*
Ga0115651_112931123300008952MarineLKNSTTSLVELKLELKNNKCAYFQFLALYKSQGLGQNSDGILGLSPHKDMSKKKLHYLWSLKDNGIIDHAIVSFSVTSKEMGETPYALFGGYNSSQIVNGAQGLKSFKNFPNWLGTWALEG*
Ga0104258_101288323300008993Ocean WaterLALYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGEGPYALFGGYNST*
Ga0104258_111097013300008993Ocean WaterLALYKSQGLGKKSDGILGLSPHKDVSKKKLHYLWSLKENGIIAHAQVSFSVTSQDMGETPYALFGGYNSTQIVGGAQGLKTFKNYPNWLGTWALEGQGMYYGAQPMQKPGE
Ga0102810_102696533300009002EstuarineLKSQGKSLVELKMQLKDNKCAYFQFLSLYKSQGLGQNSDGILGLSPHKDMSKKKLHYLWSLKDNGIIDHAMVSFSVTSKEMGETPYALFGGYNSS*
Ga0102810_103774723300009002EstuarineMQLKNNKCAFFQFLSLYKSEGLGHDSDGILGLSPHKDMSKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNSS*
Ga0115566_1072611323300009071Pelagic MarineLALYKSQGVRPDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALF
Ga0118729_110860233300009130MarineLKGTTTNAVQLKLELKNNKCAFFQFLALYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNST*
Ga0114995_1069004213300009172MarineALYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNST*
Ga0115551_121282813300009193Pelagic MarineMRLKENKCAYFQFLALYKSQGLGQKSDGILGLSPHKDMSKKKLHYLWSLKDNGIIDHAMVSFSVTSKEMNETPYALFGG
Ga0103873_107007223300009265Surface Ocean WaterLKTAEKTTPEQLKTDLKNNKCAFFQFLALYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNQIIDRAMVSFSITSREMGETPYALFGGYNSTQIVGGAEGLKTFKNFENWLGTWALEG*
Ga0114994_1105118423300009420MarineGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPCALFGGYNST*
Ga0115562_127503313300009434Pelagic MarineLYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGEGPYALFGGYNSS*
Ga0115007_1027887233300009441MarineNKCAYFQFLALYKSQGLGNNSDGILGLSPHKDMSKKKLHYLWSMKDNGIIDHAMVSFSVTSKEMGETPYALFGGYNSS*
Ga0115563_104616433300009442Pelagic MarineLYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGEGPYALFGGYNST*
Ga0115101_174407923300009592MarineMQLKNNKCAYFQFLALYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSHEMGETPYALFGGYNST*
Ga0115102_1013840013300009606MarineMQLQNNKCAFFQFLALYKSQGLGHDSDGILGLSPHKDWKKKKLHYLWSLKDNGIIDRAMVSFSITSKDMGETPYA
Ga0115102_1044453833300009606MarineLRDGKSQSAVELKMQLKNNKCAYFQFLALYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSHEMGETPYALFGGYNST*
Ga0115102_1080242433300009606MarineGKNSDGILGLSPHKDMTKKKLHYLWSLKDNGIIDHAMVSFSITSKEMGETPYALFGGYNSS*
Ga0115104_1092716423300009677MarineAFFQFLALYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLRDNGIIDRAMVSFSITSKEMGETPYALFGGYNSTQIVGGAEGLKTFKNF*
Ga0115105_1056430013300009679MarineLALYKSQGLGKNSDGILGLSPHKDMSKKKLHYLWSMKDNGIIDHAMVSFSVTSKEMGETPYALFGGYNSS*
Ga0115105_1095800913300009679MarineLALYKSQGLGHDSDGILGLSPHKDWKKKKLHYLWSLKDNGIIDRAMVSFSITSKDMGETPYALFGGYNSSQIVGGADGLKTFRNFENWLGTWALEGQGMYYGAKPMQKPGEDTSYPA
Ga0129342_103804433300010299Freshwater To Marine Saline GradientLKTAEKTTPEQLKTDLKTNKCAFFQFLALYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNQIIDRAMVSFSITSREMGETPYALFGGYNST*
Ga0133547_1066243333300010883MarineLKGTNSNAVQLKLELKANKCAFFQFLALYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNST*
Ga0138316_1068783523300010981MarineLALYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNQIIDRAMVSFSITSREMGETPYALFGGYNSTQIVGGAEGLKTFKNFENWLGTWALEG*
Ga0138316_1096691833300010981MarineLKLELKENKCAFFQFLALYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLRDNGIIDRAMVSFSITSKEMGETPYALFGGYNSTQIVGGAEGLKTFKNF*
Ga0138326_1030680723300010985MarineLELKSNKCAFFQFLALYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNST*
Ga0138326_1133660223300010985MarineLALYKSQGLGQKSDGILGLSPHKDMSKKKLHYLWSLKDNGIIEHAMVSFSVTSKEMNETPYALFGGYNSS*
Ga0138324_1046562213300010987MarineLALYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDKAIVSFSITSREMGETPYALFGGYNST*
Ga0136600_101811633300012036Saline LakeMNKSSNTSVVELKIELKNNKCAFFQFLTLYKAEGLGHDSDGILGLSPHKDMSKKKLHYLWSLKDNGIIDRAMVSFSITSNEMGETPYALFGGYNSS*
Ga0138262_156540013300012417Polar MarineMQLKNNKCALFQFLALYKAQGLGKHSDGILGLSPHKDMGKNKLHYLWSLKDNGIIDHSMVSFSVTSKDMGETPYALFGGYNSSQIVGGASGLKTFKNYPNWLGTWALEGQGMYYGAEPMQ
Ga0138260_1094865023300012419Polar MarineLKDNKCAYFQFLALYKSQGLGNNSDGILGLSPHKDLTKKKLHYLWSLKDNGIIDHALVSFSVTSKEMNETPYALFGGYNSSQIVDGAAGLKTFKNFPNWLGTWALEGQGMTYG*
Ga0129329_104839313300012470AqueousDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGEGPYALFGGYNSS*
Ga0129325_115745213300012516AqueousKKSDGILGLSPHKDPSKQKLHYLWSLKDNGIIDHAMVSFSVTSQEMGETPYALFGGYNSS
Ga0129349_138649333300012518AqueousLKNNKCAFFQFLALYKSQVLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNQIIDRAMVSFSITSREMGETPYALFGGYNS
Ga0129353_156139613300012525AqueousLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNQIIDRAMVSFSITSREMGETPYALFGGYNST*
Ga0157601_122988313300012714FreshwaterKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYPLFGGYNSS*
Ga0157610_115139623300012725FreshwaterHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNSS
Ga0157629_102062123300012752FreshwaterGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNSS*
Ga0138274_120576413300012765Freshwater LakeNSDGILGLSPHKDMSKKKLHYLWSLKDNGIIDHAMVSFSVTSKEMNETPYALFGGYNSS*
Ga0138257_168472623300012935Polar MarineMQLKNNKCALFQFLALYKAQGLGKHSDGILGLSPHKDMGKKKLHYLWSLKYNGIIDHSMVSFSVTSKDMGE
Ga0129343_117573823300012967AqueousMELKDNKCAFFQFLALYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSK
Ga0170791_1135985313300013295FreshwaterVKKEKCAYFQFLSLYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDHAMVSFSITSKEMNEGPYALFGGYNSS*
Ga0182085_138139823300016723Salt MarshDSTLNAVQQKLELKENKCAFFQFLALYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNST
Ga0182051_105979623300016727Salt MarshVQLKLKLKQNKCAYFQFLALYKSQGLGANSDGILGLSPHKDMTKKKLHYLWSLKDNGIIDHAMVSFSVTSK
Ga0182094_124435813300016731Salt MarshMNKSPDTSLVELKIELKNNKCAFFQFLSLYKAEGLGHDSDGILGLSPHKDMSKKKLHYLWSLKDNGIIDRAMVSFSITSNEMGETPYALFGGYNSSQIVNGAEGLKTFKNFQNW
Ga0182094_138153623300016731Salt MarshVQLKLDLKQNKCAYFQFLALYKSQGLGNKSDGILGLSPHKDVTKKKLHYLWSLKDNGIIDHAMVSFSVTSKEMNETPYALFGG
Ga0181390_111745623300017719SeawaterMGHDSDGILGLSPHKDMKKKKLHYLWSLKDNQIIDRAMVSFSITSREMGETPYALFGGYNSTQIVG
Ga0181418_112670913300017740SeawaterLKNNKCAFFQFLALYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNQIIDRAMVSFSITSREMGETPYALFGGYNSSQIVGGTQGLKTFKSFPNWLGTWALE
Ga0181430_122061013300017772SeawaterDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGEGPYALFGGYNST
Ga0181571_1021476013300017957Salt MarshLELKENKCAFFQFLALYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGG
Ga0181589_1068170923300017964Salt MarshMSLVELKVSLKTNKCAYFQFLALYKAQGLGKDSDGILGLSPHKDMSKKKLHYLWSLKDNGIIDNAIVSFSVSSHEQ
Ga0181569_1073080023300017986Salt MarshHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNST
Ga0181572_1017432313300018049Salt MarshLELKENKCAFFQFLALYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNST
Ga0181567_1034053813300018418Salt MarshCAFFQFLALYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNST
Ga0192983_105225013300018684MarineYTCIQPLEAANANTVELNLAIKQNKCAFFQFLALYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGEGPYALFGGYNST
Ga0193219_102386223300018842MarineLNAVQQKVELKNNKCAFFQFLALYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNRIIDRAMVSFSITSKEMGETPYALFGGYNST
Ga0193253_109626313300018846MarineLNEQEGVDAKQLDAKIKENKCAFFQFLALYRSQGLGHDSDGILGLSPHKDMKKRKLHYLWSLRENGIIDRAMVSFSITSKEMNEVPYALFGGYNSTQIVGGPEGLKTFKNF
Ga0193028_102486913300018905MarineLKNNKCAFFQFLALYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNQIIDRAMVSFSITSREMGETPYALFGGYNSTQIVGGAEGLKT
Ga0192989_1005568013300018926MarineLNEQEGVDAKQLDAKIKENKCAFFQFLALYRSQGLGHDSDGILGLSPHKDMKKRKLHYLWSLRENGIIDRAMVSFSITSKEMNEVPYALFGGYNSTQIVGGPEGLKTFKNFENWLGTWALEGQGMFYGGKPMQKPGEDTSYPA
Ga0193353_1018779813300018977MarineLKLELKENKCAFFQFLALYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLRDNGIIDRAMVSFSITSKEMGETPYALFGGYNSTQIVGGAEGLKTFKNF
Ga0192961_1017859823300018980MarineALYKSQGLGKKSDGILGLSPHKDMGKKKLHYLWSLKDNGIIDHAMVSFSVTSQEMGETPYALFGGYNSTQIVNGAEGLKTFKNFPNWLGTWALEG
Ga0192961_1021780613300018980MarineMTETTLPAEIKKQKCALFEFLALYQAQGLGRGSDGILGLSPHKDVRKKKLHYLWSLKHSGIVDHAMVSFSINSKNMDDKPYALFGGYNSSQIIGGASGLKT
Ga0192947_1001485623300018982MarineLALYKSQGLGKNSDGILGLSPHKDMSKKKLHYLWSMKDNGIIDHAMVSFSVTSKEMGETPYALFGGYNSS
Ga0192947_1001707823300018982MarineMSNVQLKMQLKNNKCAFFQFLALYKSQGLGHDSDGILGLSPHKDWKKKKLHYLWSLKDNGIIDRAMVSFSITSKDMGEGPYALFGGYNSS
Ga0192947_1006018423300018982MarineMNKSSETSLVELKMELKNNKCAFFQFLALYKAEGLGHDSDGILGLSPHKDMSKKKLHYLWSLKDNGIIDRAMVSFSITSNEMGETPYALFGGYNSS
Ga0193030_1008207423300018989MarineLALYKSQGLGQKSGGILGLSPHKDMSKKKLHYLWSLKDNGIIDHAMVSFSVTSKEMNETPYALFGGYNSSQIVNGADGLKTFKNFPNWLGTWALEG
Ga0193044_1026484513300019010MarineLNEPEGTALTQLDAKIKENKCAFFQFLALYKSQGLGHDSDGILGLSPHKDMKKRKLHYLWSLRENGIIDRAMVSFSITSKEMNEVPYALFGGYNSTQIVGGPEG
Ga0193535_1004693623300019024MarineLKNNKCAFFQFLALYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNQIIDRAMVSFSITSREMGETPYALFGGYNST
Ga0193516_1002144133300019031MarineLKGTTTNAVQLKLELKNNKCAFFQFLALYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNST
Ga0193516_1008762023300019031MarineLQLKDNKCAYFQFLALYKSQGLGKNSDGILGLSPHKDMSKKKLHYLWSMKDNGIIDHAMVSFSVTSKEMGETPYALFGGYNSS
Ga0193336_1002443233300019045MarineLGKKSDGILGLSPHKDMGKKKLHYLWSLKDNGIIDHAMVSFSVTSQEMNETPYALFGGYNST
Ga0193336_1015484113300019045MarineLYKAEGLGHDSDGILGLSPHKDMSKKKLHYLWSLKDNGIIDRAMVSFSITSNEMNEGPYALFGGYNSS
Ga0192981_1013841113300019048MarineSQGLGHDSHGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGEGPYALFGGYNST
Ga0188866_100617823300019095Freshwater LakeLALYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGEGPYALFGGYNSS
Ga0188866_102277723300019095Freshwater LakeLNEQEGVDAKQLDAKIKENKCAFFQFLALYRSQGLGHDSDGILGLSPHKDMKKRKLHYLWSLRENGIIDRAMVSFSITSKEMNEVPYALFGGYNSTQIVGGPEGL
Ga0193157_100625613300019118MarineKCAFFQFLALYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLRDNGIIDRAMVSFSITSKEMGETPYALFGGYNSTQIVGGAEGLKTFKNF
Ga0188870_1008040113300019149Freshwater LakeSDGILGLSPHKDLTKKKLHYLWSLKDNGIIDHALVSFSVTSKEMNETPYALFGGYNSS
Ga0182086_105439113300020013Salt MarshLELKENKCAFFQFLALYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALIGGYNST
Ga0207193_117634513300020048Freshwater Lake SedimentLYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNSS
Ga0211726_1089749013300020161FreshwaterQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNSS
Ga0211695_1043649913300020441MarineLKVNSKSLVEIKLRLKENKCAYFQFLALYKSQGLGQKSDGILGLSPHKDMSKKKLHYLWSLKDNGIIDHAMVSFSVTSKEMNETPYALF
Ga0206693_113209213300021353SeawaterAANANTVELNLAIKQNKCAFFQFLALYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGEGPYALFGGYNST
Ga0206123_1007916633300021365SeawaterLALYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNST
Ga0213868_1008379333300021389SeawaterLYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGEGPYALFGGYNSS
Ga0063132_13287013300021872MarineNSPNSNSVELQLEVKKNKCAFFQFLALYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGEGPYALFGGYNSTQIVDGADGLKTFKNF
Ga0063100_100371013300021910MarineLKGTNSNAVQLKLELKANKCAFFQFLALYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNST
Ga0063100_103206123300021910MarineMQLKDNKCAYFQFLALYKSQGLGNNSDGILGLSPHKDMSKKKLHYLWSMKDNGIIDHAMVSFSVTSKEMGETPYALFGGYNSS
Ga0063096_100354913300021925MarineYTCIQPLKGTNSNAVQLKLELKANKCAFFQFLALYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNST
Ga0063096_101961213300021925MarineSQGLGNNSDGILGLSPHKDMSKKKLHYLWSMKDNGIIDHAMVSFSVTSKEMGETPYALFGGYNSS
Ga0222719_1070103813300021964Estuarine WaterMNLKQNKCAFFQFLALYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITAKD
Ga0255774_1028576723300023087Salt MarshLALYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGG
Ga0228687_104773523300023696SeawaterKSQGLGKKSDGILGLSPHKDVSKKKLHYLWSLKENGIIAHAQVSFSVTSQDMGETPYALFGGYNST
Ga0208503_101215223300025388FreshwaterGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNS
Ga0209198_112932133300025640Pelagic MarineNLAIKQNKCAFFQFLALYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGEGPYALFGGYNST
Ga0208104_102317223300025773FreshwaterGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNSS
Ga0209425_1029152413300025897Pelagic MarineMNAANANAVEQQLEIKKNKCAFFQFLALYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDHALVSFSVTSKEMNETPYALFGGYNSS
Ga0208275_101019023300026182MarineLALYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMNEGPYALFGGYNST
Ga0247564_102702923300026418SeawaterVRLLLILALYKSQGLGQKSDGILGLSPHKDMSKKKLHYLWSLKDNGIIDHAMVSFSVTSKEMNETPYALFGGYNSS
Ga0247575_107169123300026419SeawaterMELKNNKCAFFQFLSLYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNS
Ga0247559_110721913300026443SeawaterLKNNKCAFFQFLALYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNQIIDRAMVSFSITSREMGETPYALFGGYNSTQIVGGAE
Ga0247607_108227613300026447SeawaterLELKSNKCAFFQFLALYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNS
Ga0247594_100859743300026448SeawaterLYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGEGPYALFGGYNST
Ga0247578_107124113300026458SeawaterLVEIKLQLKENKCAYFQFLALYKAQGLGKNSDGILGLSPHKDMTKKKLHYLWSLKDNGIIDNAMVSFSVTSKEMGETPYALFGGYNSS
Ga0247598_110132413300026466SeawaterLKGESTNAVQTKLELKNNKCAFFQFLALYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPY
Ga0247592_109570313300026500SeawaterLNEQEGVDAKQLDAKIKENKCAFFQFLALYRSQGLGHDSDGILGLSPHKDMKKRKLHYLWSLRENGIIDRAMVSFSITSKEMNEVPYALFGGYNSTQIVGGPEGLKTFKNFENWLGTWAL
Ga0247592_110731323300026500SeawaterKVDLKNNKCAFFQFLALYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNQIIDRAMVSFSITSREMGETPYALFGGYNSTQIVGGAEGLKTFKNFENWLGTWALEG
Ga0208020_100961133300027159EstuarineMQLKDNKCAYFQFLSLYKSQGLGQNSDGILGLSPHKDMSKKKLHYLWSLKDNGIIDHAMVSFSVTSKEMGETPYALFGGYNSS
Ga0208020_104124513300027159EstuarineMQLKNNKCAFFQFLSLYKSEGLGHDSDGILGLSPHKDMSKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYA
Ga0208798_102835523300027183EstuarineMQLKNNKCAFFQFLSLYKSEVLGHDSDGILGLSPHKDMSKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNSS
Ga0208176_104277813300027248EstuarineLALYKAQGLGKKSDGILGLSPHKDPSKQKLHYLWSLKDNGIIDHAMVSFSVTSQDMGETPYALFGGY
Ga0208556_109601513300027366EstuarineDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNSS
Ga0208305_1013012313300027753EstuarineYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNSS
Ga0209302_1019972723300027810MarineLKGTNTNAVQLKLELKANKCAFFQFLALYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNST
Ga0209284_1042620913300027983FreshwaterLALYKSEGLGHDSDGILGLSPHKDLKKNKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNST
Ga0247596_104253023300028106SeawaterLKENKCAYFQFLALYKAQGLGKNSDGILGLSPHKDMTKKKLHYLWSLKDNGIIDNAMVSFSVTSKEMGETPYALFGGYNSS
Ga0247596_110742313300028106SeawaterLELKSNKCAFFQFLALYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNST
Ga0256411_115681613300028134SeawaterMQLKDNKCAYFQFLALYKSQGLGKNSDGILGLSPHKDMSKKKLHYLWSMKDNGIIDHAMVSFSVTSKEMGETPYALFGGYNSS
Ga0247560_11724713300028250SeawaterKSQGLGKKSDGISGLSPHKDVSKKKLHYLWSLKENGIIAHAQVSFSVTSQDMGETPYALFGGYNST
Ga0256413_136314223300028282SeawaterAYFQFLALYKSQGLGEKSDGILGLSPHKEMSKKKLHYLWSLKDNGIIDNAIVSFSVTSKEMGETPYALFGGYNSS
Ga0247597_104323313300028334SeawaterMRLKENKCAYFQFLALYKSQGLGQKSDGILGLSPHKDMSKKKLHYLWSLKDNGIIDHAMVSFSVTSKEMNETPYALFGGYNSS
Ga0307403_1004558733300030671MarineLYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDIAMVSFSITSKEMGEGPYALFGGYNST
Ga0307398_1016212633300030699MarineLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNQIIDRAMVSFSITSREMGETPYALFGGYNSTQIVGGA
Ga0307399_1007956523300030702MarineLALYKSQGLGKKSDGILGLSPHKDMGKKKLHYLWSLKDNGIIDHAMVSFSVTSQDMGETPYALFGGYNSTQIVNGADGLKTFKNFANWLGTWALEG
Ga0308139_107408713300030720MarineLYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGET
Ga0308137_102243613300030722MarineLKSELKENKCAFFQFLALYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGE
Ga0073990_1198078613300030856MarineLKVDLKNNKCAFFQFLALYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNQIIDRAMVSFSITSREMGETPYALFGGYNSTQIVGGAEGLKTFKNFENWLGTWALEG
Ga0073981_1166145723300030857MarineKLELKSNKCAFFQFLALYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNST
Ga0073963_1119408713300030859MarinePQEAALSQLQDELKKDKCAFFQFLSLYKSQGLGHDSDGILGLSPHKDMKKKRLHYLWSLKNNGIIDRAMVSFSITSKEMGETPYALFGGYNST
Ga0073987_1117588523300030912MarineHDSDGILGLLSYKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGEVPYALFGGYNST
Ga0073971_1090075223300030958MarineLNEPDGTALAQLDAKIKENKCAFFQFLALYKSQGLGHDSDGILGLSPHKDMKKRKLHYLWSLRENGIIDRAMVSFSITSKEMNETPYALFGGYNSTQIVGGPEGLKTFKNF
Ga0073986_1201999313300031038MarineLKVNSKSLVEIKLRLKENKCAYFQFLALYKSQGLGQKSDGILGLSPHKDMSKKKLHYLWSLKDNGIIDHAMVSFSVTSKEMNETPYALFGGYNST
Ga0073989_1322181013300031062MarineLALYKSQGLGNNSDGILGLSPHKDQGKKKLHYLWSLKDNGIIDHAIVSFSVTSKEMNETPYALFGGYNSSQIADGANGLKTFKNFPNWLGTWALEG
Ga0073958_1127164023300031120MarineMKENKCAFFQFLALYKSQGLGHDSDGILGLSPHKDMKKRKLHYLWSLRENGIIDHAMVSFSITSKEMGETPYALFGGYNST
Ga0307980_103897213300031216Saline WaterMNKSSNTSVVELKIELKNNKCAFFQFLTLYKAEGLGHDSDGILGLSPHKDMSKKKLHYLWSLKDNGIIDRAMVSFSITSNEMGETPYALFGGYNSS
Ga0307979_111136423300031398Saline WaterLKGNKCAFFQFLALYKSQGLGHDSDGILGLSPHKDIKKKKLHYLWSLKDNGIIDRAMVSFSITSKDMGETPYALFGGYNSS
Ga0307492_1008006823300031523Sea-Ice BrineMNKSPDTTLVELKMELKNNKCAFFQFLSLYKAEGLGHESDGILGLSPHKDMSKKKLHYLWSLKDNGIIDRAMVSFSITSNEMGETPYALFGGYNSSQIVNGAEGLKTFKNF
Ga0308143_12872713300031540MarineTELKANKCAFFQFLALYKSQGLGHDSDGIFPLSPHKDLKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNSTQIVGGAAGLKTFKNFPNWLGTWALEGQGMYYG
Ga0308148_102910213300031557MarineMRLKENKCAYFQFLALYKSQGLGQKSDGILGLSPHKDMSKKKLHYLWSLKDNGIIDHAMVSFSVTSKEMNETPFALFGGFNSSQIVNGAEGLKTFKNFPNWLGTWALEG
Ga0308147_100922713300031558MarineLKSELKENKCAFFQFLALYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNSTQIV
Ga0307489_1007504913300031569Sackhole BrineLKENKCAYFQFLALYKSQGLGQNSDGILGLSPHKDMSKKKLHYLWSLKDNGIIDHAMVSFSVTSKEMGETPYALFGGYNSS
Ga0307386_1003828423300031710MarineMSNVQLKMQLKSNKCAFFQFLALYKSQGLGHDSDGILGLSPHKDWKKKKLHYLWSLKDNGIIDRAMVSFSITSKDMGEGPYALFGGYNSS
Ga0307386_1004098133300031710MarineMQLKDNKCAYFQFLALYKSQGLGEKSDGILGLSPHKEMGKKKLHYLWSLKDNGIIDNAMVSFSVTSKEMGETPYALFGGYNSS
Ga0307381_1017479923300031725MarineSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNST
Ga0307381_1041035623300031725MarineYKSQGLGQKSDGILGLSPHKDMSKKKLHYLWSLKDNGIIDHAMVSFSVTSKEMNETPYALFGGYNSS
Ga0307397_1012118323300031734MarineLKLELKANKCAFFQFLALYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGET
Ga0307384_1012333223300031738MarineMQLKDNKCAYFQFLALYKSQGLGEKSDGILVLSPHKEMGKKKLHYLWSLKDNGIIDNAMVSFSVTSKEMGETPYALFGGYNSS
Ga0307383_1052272513300031739MarineMANTQMKMQLKSNKCAFFQFLALYKSQGLGHDSDGILGLSPHKDWKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGEMPYALFGGYNSSQIVGGGEGLKTFSNFENWLGTWALEGQGMFYGGQAMQKPGEDTSYPA
Ga0315334_1065833423300032360SeawaterLKNKKCAYFQFLALYKSQGLGNNSDGILGLSPHKDMSKKKLHYLWSLKDNGIIDHAMVSFSVTSKEMNETPYALFGGYNSS
Ga0314688_1062566413300032517SeawaterMRLKENKCAYFQFLALYKSQGLGQKSDGILGLSPHKDMSKKKLHYLWSLKDNGIIDHAMVSFSVTSKEMNE
Ga0314676_1010405223300032519SeawaterLALYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGEGPYALFGGYNST
Ga0314685_1078402513300032651SeawaterKKSDGILGLSPHKDQSKQKLHYLWSLKDNGIIDHAVVSFSVTSQDMGENPYALFGGYNST
Ga0314669_1007290923300032708SeawaterLALYKSQGLGNNSDGILGLSPHKDLTKKKLHYLWSLKDNGIIDHALVSFSVTSKEMNETPYALFGGYNSS
Ga0314703_1023447933300032723SeawaterMRLKENKCAYFQFLALYKSQGLGQKSDGILGLSPHKDMSKKKLHYLWSLKDNGIIDHAMVSFSVTSKEMN
Ga0314696_1027500733300032728SeawaterGLGKGSDGILGLSPHKDMRKKKLHYLWSLKHNKIIDHAIVSFSINAKNMNDKPYALFGGYNSSQIIGGA
Ga0314707_1021857813300032743SeawaterSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGEGPYALFGGYNST
Ga0314705_1057317813300032744SeawaterQDYACLQPLKASTGGNGQKASLVELKLKLKENKCAYFQFLALYKAQGLGANSDGILGLSPHKDASKKKLHYLWSLKDNGIIDNAIVSFSVTSKEMNEVPYALFGGYNSS
Ga0314701_1014793513300032746SeawaterTCIQPLEAANANTVELNLAIKQNKCAFFQFLALYKSQGLGHDSDGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGEGPYALFGGYNST
Ga0307390_1027572113300033572MarineLYKSQGLGKKSDGILGLSPHKDMGKKKLHYLWSLKDNGIIDHAMVSFSVTSQDMGETPYALFGGYNST
Ga0307390_1039070813300033572MarineLSNSTGKTSLVQLKLQLKDNKCAYFQFLALYKSQGLGNNSDGILGLSPHKDKSKMKLHYLWSLKDNGIIDHALVSFSVTSK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.