| Basic Information | |
|---|---|
| Family ID | F029434 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 188 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MKKYTFGVWLDIDAEDEDMALSLFDSVVKNTFVSDSYCFEWKEVADEIAI |
| Number of Associated Samples | 125 |
| Number of Associated Scaffolds | 188 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 85.64 % |
| % of genes near scaffold ends (potentially truncated) | 22.34 % |
| % of genes from short scaffolds (< 2000 bps) | 76.06 % |
| Associated GOLD sequencing projects | 107 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (49.468 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (25.532 % of family members) |
| Environment Ontology (ENVO) | Unclassified (53.723 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (69.149 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 15.38% β-sheet: 0.00% Coil/Unstructured: 84.62% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 188 Family Scaffolds |
|---|---|---|
| PF06067 | DUF932 | 4.26 |
| PF01807 | zf-CHC2 | 0.53 |
| PF08007 | JmjC_2 | 0.53 |
| PF00011 | HSP20 | 0.53 |
| PF13884 | Peptidase_S74 | 0.53 |
| PF09834 | DUF2061 | 0.53 |
| PF01634 | HisG | 0.53 |
| PF13578 | Methyltransf_24 | 0.53 |
| PF00210 | Ferritin | 0.53 |
| PF00085 | Thioredoxin | 0.53 |
| PF01464 | SLT | 0.53 |
| PF04860 | Phage_portal | 0.53 |
| COG ID | Name | Functional Category | % Frequency in 188 Family Scaffolds |
|---|---|---|---|
| COG0040 | ATP phosphoribosyltransferase | Amino acid transport and metabolism [E] | 0.53 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.53 |
| COG0358 | DNA primase (bacterial type) | Replication, recombination and repair [L] | 0.53 |
| COG2850 | Ribosomal protein L16 Arg81 hydroxylase, contains JmjC domain | Translation, ribosomal structure and biogenesis [J] | 0.53 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 50.53 % |
| Unclassified | root | N/A | 49.47 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352004|2199816734 | Not Available | 6242 | Open in IMG/M |
| 2199352004|2199909971 | Not Available | 652 | Open in IMG/M |
| 3300000736|JGI12547J11936_1017523 | All Organisms → Viruses → Predicted Viral | 1757 | Open in IMG/M |
| 3300000756|JGI12421J11937_10019815 | All Organisms → Viruses → Predicted Viral | 2488 | Open in IMG/M |
| 3300000929|NpDRAFT_10069297 | Not Available | 530 | Open in IMG/M |
| 3300002195|metazooDRAFT_1228306 | Not Available | 902 | Open in IMG/M |
| 3300002835|B570J40625_100000380 | Not Available | 72625 | Open in IMG/M |
| 3300003277|JGI25908J49247_10020471 | All Organisms → Viruses → Predicted Viral | 1972 | Open in IMG/M |
| 3300003277|JGI25908J49247_10093983 | Not Available | 727 | Open in IMG/M |
| 3300003413|JGI25922J50271_10098441 | Not Available | 621 | Open in IMG/M |
| 3300003429|JGI25914J50564_10051984 | All Organisms → Viruses → Predicted Viral | 1102 | Open in IMG/M |
| 3300003430|JGI25921J50272_10019345 | All Organisms → Viruses → Predicted Viral | 1857 | Open in IMG/M |
| 3300003430|JGI25921J50272_10074769 | Not Available | 736 | Open in IMG/M |
| 3300003490|JGI25926J51410_1050521 | Not Available | 720 | Open in IMG/M |
| 3300003493|JGI25923J51411_1007376 | All Organisms → Viruses → Predicted Viral | 2405 | Open in IMG/M |
| 3300004112|Ga0065166_10325898 | Not Available | 631 | Open in IMG/M |
| 3300004793|Ga0007760_11408968 | Not Available | 543 | Open in IMG/M |
| 3300005517|Ga0070374_10317112 | Not Available | 790 | Open in IMG/M |
| 3300005583|Ga0049085_10170097 | Not Available | 730 | Open in IMG/M |
| 3300005584|Ga0049082_10074277 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1193 | Open in IMG/M |
| 3300005662|Ga0078894_11505744 | Not Available | 558 | Open in IMG/M |
| 3300005941|Ga0070743_10039824 | Not Available | 1610 | Open in IMG/M |
| 3300005941|Ga0070743_10046704 | All Organisms → Viruses → Predicted Viral | 1479 | Open in IMG/M |
| 3300005941|Ga0070743_10119636 | Not Available | 881 | Open in IMG/M |
| 3300006484|Ga0070744_10136706 | Not Available | 704 | Open in IMG/M |
| 3300007550|Ga0102880_1156263 | Not Available | 597 | Open in IMG/M |
| 3300007559|Ga0102828_1074596 | Not Available | 808 | Open in IMG/M |
| 3300007590|Ga0102917_1271987 | Not Available | 586 | Open in IMG/M |
| 3300007600|Ga0102920_1233090 | Not Available | 592 | Open in IMG/M |
| 3300007617|Ga0102897_1072727 | All Organisms → Viruses → Predicted Viral | 1076 | Open in IMG/M |
| 3300007618|Ga0102896_1188896 | Not Available | 650 | Open in IMG/M |
| 3300007630|Ga0102903_1039701 | All Organisms → Viruses → Predicted Viral | 1322 | Open in IMG/M |
| 3300007634|Ga0102901_1093873 | Not Available | 859 | Open in IMG/M |
| 3300007651|Ga0102900_1068666 | Not Available | 755 | Open in IMG/M |
| 3300007667|Ga0102910_1017702 | All Organisms → Viruses → Predicted Viral | 1600 | Open in IMG/M |
| 3300007862|Ga0105737_1212969 | Not Available | 512 | Open in IMG/M |
| 3300007962|Ga0102907_1081359 | Not Available | 853 | Open in IMG/M |
| 3300007973|Ga0105746_1164054 | Not Available | 752 | Open in IMG/M |
| 3300007973|Ga0105746_1301025 | Not Available | 556 | Open in IMG/M |
| 3300007974|Ga0105747_1202918 | Not Available | 654 | Open in IMG/M |
| 3300008021|Ga0102922_1165572 | Not Available | 698 | Open in IMG/M |
| 3300008066|Ga0110927_1242046 | Not Available | 555 | Open in IMG/M |
| 3300008107|Ga0114340_1080435 | Not Available | 1348 | Open in IMG/M |
| 3300008107|Ga0114340_1194395 | Not Available | 690 | Open in IMG/M |
| 3300008110|Ga0114343_1131952 | Not Available | 822 | Open in IMG/M |
| 3300008111|Ga0114344_1059395 | All Organisms → Viruses → Predicted Viral | 2594 | Open in IMG/M |
| 3300008113|Ga0114346_1168606 | Not Available | 912 | Open in IMG/M |
| 3300008116|Ga0114350_1006526 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 5613 | Open in IMG/M |
| 3300008116|Ga0114350_1040732 | All Organisms → Viruses → Predicted Viral | 1761 | Open in IMG/M |
| 3300008261|Ga0114336_1208472 | Not Available | 815 | Open in IMG/M |
| 3300008261|Ga0114336_1251248 | Not Available | 704 | Open in IMG/M |
| 3300008953|Ga0104241_1001038 | All Organisms → Viruses → Predicted Viral | 2197 | Open in IMG/M |
| 3300008953|Ga0104241_1006530 | Not Available | 817 | Open in IMG/M |
| 3300008962|Ga0104242_1056402 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 660 | Open in IMG/M |
| 3300008964|Ga0102889_1186113 | Not Available | 605 | Open in IMG/M |
| 3300008999|Ga0102816_1027530 | All Organisms → Viruses → Predicted Viral | 1654 | Open in IMG/M |
| 3300009049|Ga0102911_1045668 | All Organisms → Viruses → Predicted Viral | 1286 | Open in IMG/M |
| 3300009050|Ga0102909_1056270 | Not Available | 978 | Open in IMG/M |
| 3300009057|Ga0102892_1022916 | Not Available | 1161 | Open in IMG/M |
| 3300009059|Ga0102830_1005063 | All Organisms → Viruses → Predicted Viral | 4506 | Open in IMG/M |
| 3300009059|Ga0102830_1035538 | All Organisms → Viruses → Predicted Viral | 1534 | Open in IMG/M |
| 3300009059|Ga0102830_1190257 | Not Available | 601 | Open in IMG/M |
| 3300009068|Ga0114973_10036456 | All Organisms → Viruses → Predicted Viral | 2951 | Open in IMG/M |
| 3300009068|Ga0114973_10054981 | All Organisms → Viruses → Predicted Viral | 2341 | Open in IMG/M |
| 3300009068|Ga0114973_10281890 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 889 | Open in IMG/M |
| 3300009068|Ga0114973_10382053 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 740 | Open in IMG/M |
| 3300009086|Ga0102812_10593523 | Not Available | 607 | Open in IMG/M |
| 3300009141|Ga0102884_1202547 | Not Available | 507 | Open in IMG/M |
| 3300009151|Ga0114962_10007902 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8051 | Open in IMG/M |
| 3300009152|Ga0114980_10002755 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12244 | Open in IMG/M |
| 3300009152|Ga0114980_10189255 | Not Available | 1213 | Open in IMG/M |
| 3300009158|Ga0114977_10222422 | All Organisms → Viruses → Predicted Viral | 1099 | Open in IMG/M |
| 3300009158|Ga0114977_10236270 | Not Available | 1059 | Open in IMG/M |
| 3300009159|Ga0114978_10290164 | All Organisms → Viruses → Predicted Viral | 1005 | Open in IMG/M |
| 3300009159|Ga0114978_10375086 | Not Available | 856 | Open in IMG/M |
| 3300009180|Ga0114979_10684631 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 581 | Open in IMG/M |
| 3300009180|Ga0114979_10722880 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 562 | Open in IMG/M |
| 3300009180|Ga0114979_10842427 | Not Available | 512 | Open in IMG/M |
| 3300009181|Ga0114969_10731343 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 530 | Open in IMG/M |
| 3300009183|Ga0114974_10002650 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13751 | Open in IMG/M |
| 3300009183|Ga0114974_10062367 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 2466 | Open in IMG/M |
| 3300009183|Ga0114974_10111416 | Not Available | 1750 | Open in IMG/M |
| 3300009183|Ga0114974_10294344 | Not Available | 957 | Open in IMG/M |
| 3300009184|Ga0114976_10115067 | All Organisms → Viruses → Predicted Viral | 1525 | Open in IMG/M |
| 3300009184|Ga0114976_10119705 | Not Available | 1490 | Open in IMG/M |
| 3300009184|Ga0114976_10124632 | All Organisms → Viruses → Predicted Viral | 1456 | Open in IMG/M |
| 3300009184|Ga0114976_10163483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 1241 | Open in IMG/M |
| 3300009184|Ga0114976_10173068 | All Organisms → Viruses → Predicted Viral | 1200 | Open in IMG/M |
| 3300009194|Ga0114983_1086745 | Not Available | 699 | Open in IMG/M |
| 3300009419|Ga0114982_1073082 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1067 | Open in IMG/M |
| 3300010885|Ga0133913_10005939 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 31479 | Open in IMG/M |
| 3300010885|Ga0133913_10462354 | All Organisms → Viruses → Predicted Viral | 3347 | Open in IMG/M |
| 3300010885|Ga0133913_11964165 | All Organisms → Viruses → Predicted Viral | 1455 | Open in IMG/M |
| 3300012000|Ga0119951_1063389 | Not Available | 995 | Open in IMG/M |
| 3300012000|Ga0119951_1107267 | Not Available | 658 | Open in IMG/M |
| 3300012006|Ga0119955_1172423 | Not Available | 555 | Open in IMG/M |
| 3300012663|Ga0157203_1049941 | Not Available | 567 | Open in IMG/M |
| 3300012666|Ga0157498_1030145 | Not Available | 840 | Open in IMG/M |
| 3300012772|Ga0138287_1212331 | All Organisms → Viruses → Predicted Viral | 1025 | Open in IMG/M |
| 3300012779|Ga0138284_1091933 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 867 | Open in IMG/M |
| 3300012781|Ga0138286_1321626 | Not Available | 748 | Open in IMG/M |
| 3300013295|Ga0170791_10199364 | Not Available | 544 | Open in IMG/M |
| 3300013372|Ga0177922_11282333 | Not Available | 723 | Open in IMG/M |
| 3300014050|Ga0119952_1057863 | Not Available | 1023 | Open in IMG/M |
| 3300014050|Ga0119952_1124948 | Not Available | 576 | Open in IMG/M |
| 3300016699|Ga0180058_1219951 | Not Available | 580 | Open in IMG/M |
| 3300019784|Ga0181359_1064080 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1402 | Open in IMG/M |
| 3300019784|Ga0181359_1068151 | All Organisms → Viruses → Predicted Viral | 1351 | Open in IMG/M |
| 3300020048|Ga0207193_1777194 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 614 | Open in IMG/M |
| 3300020141|Ga0211732_1069667 | All Organisms → Viruses → Predicted Viral | 2404 | Open in IMG/M |
| 3300020161|Ga0211726_10858316 | Not Available | 794 | Open in IMG/M |
| 3300020172|Ga0211729_10881181 | Not Available | 824 | Open in IMG/M |
| 3300021438|Ga0213920_1001123 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15966 | Open in IMG/M |
| 3300021519|Ga0194048_10007053 | Not Available | 5276 | Open in IMG/M |
| 3300021519|Ga0194048_10073755 | Not Available | 1339 | Open in IMG/M |
| 3300021956|Ga0213922_1010077 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2642 | Open in IMG/M |
| 3300021962|Ga0222713_10026874 | All Organisms → Viruses → Predicted Viral | 4713 | Open in IMG/M |
| 3300021962|Ga0222713_10032217 | All Organisms → Viruses → Predicted Viral | 4210 | Open in IMG/M |
| 3300021962|Ga0222713_10049632 | All Organisms → Viruses → Predicted Viral | 3215 | Open in IMG/M |
| 3300021962|Ga0222713_10289253 | All Organisms → Viruses → Predicted Viral | 1049 | Open in IMG/M |
| 3300021962|Ga0222713_10527959 | Not Available | 701 | Open in IMG/M |
| 3300022752|Ga0214917_10228206 | Not Available | 889 | Open in IMG/M |
| 3300022752|Ga0214917_10461238 | Not Available | 504 | Open in IMG/M |
| 3300023174|Ga0214921_10000248 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae | 107027 | Open in IMG/M |
| 3300023174|Ga0214921_10002176 | Not Available | 32260 | Open in IMG/M |
| 3300023174|Ga0214921_10007126 | All Organisms → Viruses | 15016 | Open in IMG/M |
| 3300023174|Ga0214921_10016496 | Not Available | 8305 | Open in IMG/M |
| 3300023174|Ga0214921_10019147 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7434 | Open in IMG/M |
| 3300023174|Ga0214921_10125719 | All Organisms → Viruses → Predicted Viral | 1825 | Open in IMG/M |
| 3300023174|Ga0214921_10137338 | All Organisms → Viruses → Predicted Viral | 1702 | Open in IMG/M |
| 3300023174|Ga0214921_10217847 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1166 | Open in IMG/M |
| 3300023174|Ga0214921_10267589 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 984 | Open in IMG/M |
| 3300023179|Ga0214923_10032014 | All Organisms → Viruses → Predicted Viral | 4354 | Open in IMG/M |
| 3300023184|Ga0214919_10318506 | Not Available | 1059 | Open in IMG/M |
| 3300024289|Ga0255147_1096130 | Not Available | 546 | Open in IMG/M |
| 3300024289|Ga0255147_1106735 | Not Available | 512 | Open in IMG/M |
| 3300024343|Ga0244777_10110076 | All Organisms → Viruses → Predicted Viral | 1778 | Open in IMG/M |
| 3300024343|Ga0244777_10455555 | Not Available | 790 | Open in IMG/M |
| 3300024343|Ga0244777_10647584 | Not Available | 636 | Open in IMG/M |
| 3300024346|Ga0244775_10001871 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 23645 | Open in IMG/M |
| 3300024346|Ga0244775_10070702 | Not Available | 2992 | Open in IMG/M |
| 3300024346|Ga0244775_10243122 | All Organisms → Viruses → Predicted Viral | 1501 | Open in IMG/M |
| 3300027190|Ga0208674_1014913 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1241 | Open in IMG/M |
| 3300027227|Ga0208929_1002551 | Not Available | 4638 | Open in IMG/M |
| 3300027240|Ga0208444_1003813 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 2413 | Open in IMG/M |
| 3300027246|Ga0208931_1030034 | All Organisms → Viruses → Predicted Viral | 1095 | Open in IMG/M |
| 3300027278|Ga0208439_1099513 | Not Available | 519 | Open in IMG/M |
| 3300027295|Ga0255126_1038336 | Not Available | 981 | Open in IMG/M |
| 3300027365|Ga0209300_1023472 | All Organisms → Viruses → Predicted Viral | 1326 | Open in IMG/M |
| 3300027541|Ga0255158_1038260 | Not Available | 1096 | Open in IMG/M |
| 3300027578|Ga0255075_1014374 | All Organisms → Viruses → Predicted Viral | 1576 | Open in IMG/M |
| 3300027578|Ga0255075_1048066 | Not Available | 775 | Open in IMG/M |
| 3300027579|Ga0255068_123975 | Not Available | 654 | Open in IMG/M |
| 3300027621|Ga0208951_1035217 | All Organisms → Viruses → Predicted Viral | 1513 | Open in IMG/M |
| 3300027627|Ga0208942_1003166 | Not Available | 5758 | Open in IMG/M |
| 3300027631|Ga0208133_1015811 | All Organisms → Viruses → Predicted Viral | 1997 | Open in IMG/M |
| 3300027644|Ga0209356_1022299 | All Organisms → Viruses → Predicted Viral | 2128 | Open in IMG/M |
| 3300027659|Ga0208975_1030234 | All Organisms → Viruses → Predicted Viral | 1734 | Open in IMG/M |
| 3300027708|Ga0209188_1000085 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae | 107984 | Open in IMG/M |
| 3300027708|Ga0209188_1002274 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 14370 | Open in IMG/M |
| 3300027710|Ga0209599_10002364 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7842 | Open in IMG/M |
| 3300027720|Ga0209617_10049438 | All Organisms → Viruses → Predicted Viral | 1771 | Open in IMG/M |
| 3300027733|Ga0209297_1050693 | All Organisms → Viruses → Predicted Viral | 1876 | Open in IMG/M |
| 3300027733|Ga0209297_1145810 | Not Available | 977 | Open in IMG/M |
| 3300027733|Ga0209297_1150139 | Not Available | 959 | Open in IMG/M |
| 3300027733|Ga0209297_1251600 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 677 | Open in IMG/M |
| 3300027733|Ga0209297_1261801 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 659 | Open in IMG/M |
| 3300027734|Ga0209087_1000716 | Not Available | 20648 | Open in IMG/M |
| 3300027734|Ga0209087_1162898 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 886 | Open in IMG/M |
| 3300027734|Ga0209087_1255575 | Not Available | 645 | Open in IMG/M |
| 3300027759|Ga0209296_1002329 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13728 | Open in IMG/M |
| 3300027759|Ga0209296_1084302 | All Organisms → Viruses → Predicted Viral | 1557 | Open in IMG/M |
| 3300027760|Ga0209598_10033631 | All Organisms → Viruses → Predicted Viral | 2800 | Open in IMG/M |
| 3300027760|Ga0209598_10201453 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 841 | Open in IMG/M |
| 3300027763|Ga0209088_10069676 | All Organisms → Viruses → Predicted Viral | 1666 | Open in IMG/M |
| 3300027769|Ga0209770_10229240 | Not Available | 725 | Open in IMG/M |
| 3300027770|Ga0209086_10080121 | All Organisms → Viruses → Predicted Viral | 1724 | Open in IMG/M |
| 3300027770|Ga0209086_10168885 | All Organisms → Viruses → Predicted Viral | 1038 | Open in IMG/M |
| 3300027782|Ga0209500_10099912 | All Organisms → Viruses → Predicted Viral | 1439 | Open in IMG/M |
| 3300027797|Ga0209107_10010754 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5153 | Open in IMG/M |
| 3300027805|Ga0209229_10000176 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 24904 | Open in IMG/M |
| 3300027805|Ga0209229_10298702 | Not Available | 710 | Open in IMG/M |
| 3300027892|Ga0209550_10196255 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1382 | Open in IMG/M |
| 3300031758|Ga0315907_10241616 | All Organisms → Viruses → Predicted Viral | 1500 | Open in IMG/M |
| 3300031857|Ga0315909_10090674 | All Organisms → Viruses → Predicted Viral | 2666 | Open in IMG/M |
| 3300033418|Ga0316625_102789370 | Not Available | 500 | Open in IMG/M |
| 3300033992|Ga0334992_0004996 | Not Available | 9534 | Open in IMG/M |
| 3300034013|Ga0334991_0077014 | All Organisms → Viruses → Predicted Viral | 1655 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 25.53% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 15.96% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 9.04% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 8.51% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.91% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 4.79% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 4.26% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 3.72% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.66% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.66% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 2.13% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 2.13% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.60% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.60% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 1.06% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 1.06% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 1.06% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 1.06% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 1.06% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.53% |
| Freshwater, Surface Ice | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice | 0.53% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.53% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.53% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.53% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.53% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352004 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
| 3300000736 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 | Environmental | Open in IMG/M |
| 3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
| 3300000929 | Marine plume microbial communities from the Columbia River - 15 PSU | Environmental | Open in IMG/M |
| 3300002195 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - AUG 2013 | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003413 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD | Environmental | Open in IMG/M |
| 3300003429 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003430 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD | Environmental | Open in IMG/M |
| 3300003490 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003493 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
| 3300004793 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300007550 | Estuarine microbial communities from the Columbia River estuary - metaG 1549A-3 | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007590 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-02 | Environmental | Open in IMG/M |
| 3300007600 | Estuarine microbial communities from the Columbia River estuary - metaG 1568A-3 | Environmental | Open in IMG/M |
| 3300007617 | Estuarine microbial communities from the Columbia River estuary - metaG 1554B-02 | Environmental | Open in IMG/M |
| 3300007618 | Estuarine microbial communities from the Columbia River estuary - metaG 1554A-02 | Environmental | Open in IMG/M |
| 3300007630 | Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02 | Environmental | Open in IMG/M |
| 3300007634 | Estuarine microbial communities from the Columbia River estuary - metaG 1555A-02 | Environmental | Open in IMG/M |
| 3300007651 | Estuarine microbial communities from the Columbia River estuary - metaG 1555C-3 | Environmental | Open in IMG/M |
| 3300007667 | Estuarine microbial communities from the Columbia River estuary - metaG 1558A-3 | Environmental | Open in IMG/M |
| 3300007862 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_0.2um | Environmental | Open in IMG/M |
| 3300007962 | Estuarine microbial communities from the Columbia River estuary - metaG 1556B-02 | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300008021 | Estuarine microbial communities from the Columbia River estuary - metaG 1569A-3 | Environmental | Open in IMG/M |
| 3300008066 | Freshwater microbial communities from catchments in Singapore - Site BH | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008953 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT4 | Environmental | Open in IMG/M |
| 3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
| 3300008964 | Estuarine microbial communities from the Columbia River estuary - metaG 1551A-02 | Environmental | Open in IMG/M |
| 3300008999 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 | Environmental | Open in IMG/M |
| 3300009049 | Estuarine microbial communities from the Columbia River estuary - metaG 1558A-02 | Environmental | Open in IMG/M |
| 3300009050 | Estuarine microbial communities from the Columbia River estuary - metaG 1557A-02 | Environmental | Open in IMG/M |
| 3300009057 | Estuarine microbial communities from the Columbia River estuary - metaG 1553A-3 | Environmental | Open in IMG/M |
| 3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009086 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 | Environmental | Open in IMG/M |
| 3300009141 | Estuarine microbial communities from the Columbia River estuary - metaG 1550A-3 | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009194 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
| 3300012006 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1101B | Environmental | Open in IMG/M |
| 3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
| 3300012666 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2 | Environmental | Open in IMG/M |
| 3300012772 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130826_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012779 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130206_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012781 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130712_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014050 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007B | Environmental | Open in IMG/M |
| 3300016699 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES160 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300021438 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300027190 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.733 (SPAdes) | Environmental | Open in IMG/M |
| 3300027227 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027240 | Estuarine microbial communities from the Columbia River estuary - metaG 1555A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027246 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027278 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 (SPAdes) | Environmental | Open in IMG/M |
| 3300027295 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepA_8d | Environmental | Open in IMG/M |
| 3300027365 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT (SPAdes) | Environmental | Open in IMG/M |
| 3300027541 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8h | Environmental | Open in IMG/M |
| 3300027578 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8h | Environmental | Open in IMG/M |
| 3300027579 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_8h | Environmental | Open in IMG/M |
| 3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027627 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
| 3300027720 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027760 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
| 3300034013 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2199990796 | 2199352004 | Freshwater | MKRYTFGVWLDIDAEDEEMAISLFDSVVKNAFVSDSYCFEWKEVADEIAV |
| 2200092895 | 2199352004 | Freshwater | MKKYTFGVWLDIDAEDEEMALSLFDSVVKNAFVSDSYCFEWKEVADEIAV |
| JGI12547J11936_10175236 | 3300000736 | Freshwater And Sediment | MKKYTFGVWLDIDAEDEDMALSLFDSVVKNAFVSDSYCFEWKEVADEIAI* |
| JGI12421J11937_100198155 | 3300000756 | Freshwater And Sediment | MKRYTFGVWLDIDAEDENQAVSLFDSVVKNTFVSDSYCFEWKEVADEIAI* |
| NpDRAFT_100692973 | 3300000929 | Freshwater And Marine | MKKYTFGVWLDIDAEDEDMALSLFDSVVKNAFVSESYCFEWKEVADEIAI* |
| metazooDRAFT_12283062 | 3300002195 | Lake | MKKFTFGVWLDIDAEDENSAVMLFDSVVKNSFVSDSYCFEWKEVSE* |
| B570J40625_1000003802 | 3300002835 | Freshwater | MKKYTFGVWLDIDAEDEEMALSLFDSVVKNAFVSDSYCFEWKEVADEIAV* |
| JGI25908J49247_100204718 | 3300003277 | Freshwater Lake | MKKYTFGVWLDIDAEDEDMALSLFDSVVKNPFVSDSFCFEWKEVADEIAI* |
| JGI25908J49247_100939833 | 3300003277 | Freshwater Lake | MKKYTFGVWLDIDAEDEEMALSLFDSVVKNAFVSESYCFEWKEVADEIAV* |
| JGI25922J50271_100984412 | 3300003413 | Freshwater Lake | MKKYTFGVWIDIDAEDEEMALSLFDSVVKNTFVSDSYCFEWKEVADEIAV* |
| JGI25914J50564_100519841 | 3300003429 | Freshwater Lake | MKKYTFGVWLDIDAEDEEMALSLFDSVVKNAFVSDSYCFEWKEVANV* |
| JGI25921J50272_100193451 | 3300003430 | Freshwater Lake | TRFRNWIISGRCALMKRYTFGVWLDIDAEDEEMAISLFDSVVKNAFVSDSYCFEWKEVADEIAV* |
| JGI25921J50272_100747691 | 3300003430 | Freshwater Lake | TRFRNWIISGRCALMKRYTFGVWLDIDAEDEEMALSLFDSVVKNAFVSDSYCFEWKEVADEIAV* |
| JGI25926J51410_10505215 | 3300003490 | Freshwater Lake | MKRYTFGVWLDIDAEDEDMALSLFDSVVKNAFVSDSYCFEWKEVADEIAI*KR |
| JGI25923J51411_10073765 | 3300003493 | Freshwater Lake | MKKYTFGVWLDIDAEDEXMALSLFDSVVKNAFVSESYCFEWKEVADEIAV* |
| Ga0065166_103258984 | 3300004112 | Freshwater Lake | MKKYTFGVWIDIDAEDEEMALSLFDSVVKNTFVSDSYCFEWKEV |
| Ga0007760_114089682 | 3300004793 | Freshwater Lake | MKKYTFGVWLDIDAEDEDMALSLFDSVVKNAFVSDSFCFEWKEVADEIAI* |
| Ga0070374_103171122 | 3300005517 | Freshwater Lake | MKRYTFGVWLDIDAEDEDMALSLFDSVVKNAFVSDSYCFEWKEVADEIAI* |
| Ga0049085_101700973 | 3300005583 | Freshwater Lentic | MKKYTFGVWLDIDAEDEDMALSLFDSVVKNTFVSDSFCFEWKEVADEIAI* |
| Ga0049082_100742771 | 3300005584 | Freshwater Lentic | EWRKRMNKYTFGVWLDIDAEDEEMALSLFDSVVKNTFVSDSYCFEWKEVANEIAV* |
| Ga0078894_115057442 | 3300005662 | Freshwater Lake | MKKYTFGVWLDIDAEDEEMALSLFDEVVKKSPFVSDSYCFEWKEVADEIAV* |
| Ga0070743_100398247 | 3300005941 | Estuarine | MKKYTFGVWLDIDAEDENQAVSLFDSVVKNTFVSDSYCFEWKEVADEIAV* |
| Ga0070743_100467045 | 3300005941 | Estuarine | MKKYTFGVWLDIDAEDENQALSLFDSVVKNTFVSDSYCFEWKEVADEIAI* |
| Ga0070743_101196361 | 3300005941 | Estuarine | MKKYTFGVWLDIDAEDEEMALSLFDSVVKNAFVSDSFCFEWKEVADE |
| Ga0070744_101367062 | 3300006484 | Estuarine | MKKYTFGVWLDIDAEDEDMALSLFDSVVKNTFVSDSYCFEWKEVADEIAI* |
| Ga0102880_11562632 | 3300007550 | Estuarine | MKKYTFGVWLDIDAEDEDMALSLFDSVVKNPFVSESYCFEWKEVADEIAI* |
| Ga0102828_10745962 | 3300007559 | Estuarine | MKKYTFGVWLDIDAEDEDMAVSLFDSVVKNTFVSDSYCFEWKEVADEIAI* |
| Ga0102917_12719871 | 3300007590 | Estuarine | VWLDIDAEDEEMALSLFDSVVKNTFVSDSYCFEWKEVADEIAI* |
| Ga0102920_12330901 | 3300007600 | Estuarine | MKKYTFGVWLDIDAEDEDMALSLFDSVVKNTFVSDSYCFEWKEV |
| Ga0102897_10727275 | 3300007617 | Estuarine | MKKYTFGVWLDIDAEDEDQALSLFDDVIKNNWVSDSYCFEWKEVADEIAI* |
| Ga0102896_11888963 | 3300007618 | Estuarine | MKKYTFGVWLDIDAEDEEMALSLFDSVVKNTFVSDSYCFEWKEVADEIAI* |
| Ga0102903_10397011 | 3300007630 | Estuarine | KKYTFGVWLDIDAEDEDMALSLFDSVVKNAFVSESYCFEWKEVADEIAI* |
| Ga0102901_10938731 | 3300007634 | Estuarine | MKKYTFGVWLDIDAEDEDMALSLFDSVVKNAFVSDSYCF |
| Ga0102900_10686664 | 3300007651 | Estuarine | WLDIDAEDEEMALSLFDSVVKNAFVSDSYCFEWKEVADEIAI* |
| Ga0102910_10177023 | 3300007667 | Estuarine | MKKYTFGVWLDIDAEDENQAVSLFDSVVKNTFVSDSYCFEWKEVADEIAI* |
| Ga0105737_12129691 | 3300007862 | Estuary Water | MKRYTFGVWLDIDAEDENQAVSLFDSVVKNPFVSDSYCFEWKE |
| Ga0102907_10813594 | 3300007962 | Estuarine | MKKYTFGVWLDIDAEDENQAVSLFDSVVKNTFVSDSYCF |
| Ga0105746_11640541 | 3300007973 | Estuary Water | MKKYTFGVWLDIDAEDENQALSLFDSVVKNTFVSDSYC |
| Ga0105746_13010253 | 3300007973 | Estuary Water | WLDIDAEDEDMALSLFDSVVKNAFVSDSFCFEWKEVADEIAI* |
| Ga0105747_12029183 | 3300007974 | Estuary Water | MKKYTFGVWLDIDAEDEDMALSLFDSVVKNAFVSDSYCFEWKEVADEIAV* |
| Ga0102922_11655724 | 3300008021 | Estuarine | MKKYTFGVWLDIDAEDEDMALSLFDSVVKNVFVSESYCFEWKEV |
| Ga0110927_12420462 | 3300008066 | Freshwater | LDKKYTFGVWLDIDAEDEEQALRLFDNVIKNSFVKDSYCFEWKEVE* |
| Ga0114340_10804353 | 3300008107 | Freshwater, Plankton | LNKYTFGVWLDIDAEDENQAISIFNSVVKENNLISNSYCFDWKEIE* |
| Ga0114340_11943953 | 3300008107 | Freshwater, Plankton | MKRYTFGVWLDIDAEDEEMALSLFDSVVKNAFVSDSYCFEWKEVADEIAV* |
| Ga0114343_11319522 | 3300008110 | Freshwater, Plankton | MKKYTFGVWLDIDAEDEDMAVSLFDSVVKNAFVSDSYCFEWKEVADEIAV* |
| Ga0114344_10593954 | 3300008111 | Freshwater, Plankton | MNKYTFGVWLDIDAEDEEMALSLFDSVVKNTFVSDSYCFEWKEVANEIAV* |
| Ga0114346_11686063 | 3300008113 | Freshwater, Plankton | MKRYTFGVWLDIDAEDEEMAISLFDSVVKNAFVSDSYCFEWKEVADEIAV* |
| Ga0114350_10065269 | 3300008116 | Freshwater, Plankton | LNKTYRFGVWLDIDAEDDDMALSLFDSIVKNTFVKDSYCFNWEEVE* |
| Ga0114350_10407322 | 3300008116 | Freshwater, Plankton | MKKYTFGVWLDIEAEDESMALSLFNSVVKENNLISDSYCFEWNEVE* |
| Ga0114336_12084723 | 3300008261 | Freshwater, Plankton | MKKYTFGVWLDINAEDEEMAVSLFDEVVKNTFVSDSYCFEWKEVE* |
| Ga0114336_12512483 | 3300008261 | Freshwater, Plankton | TFGVWLVIDAEDEEMALSLFDSVVKNTFVSDSYCFEWKEVADEIAI* |
| Ga0104241_10010383 | 3300008953 | Freshwater | MKKYTFGVWLDIDAEDEDMALSMFDDVTKNLWVKDSYCFEWKEVE* |
| Ga0104241_10065301 | 3300008953 | Freshwater | MKKYTFGVWLDIDAEDEDMALSLFDEVVKKNPFVSDSYCFEWKEAE* |
| Ga0104242_10564022 | 3300008962 | Freshwater | MKKYTFGVWLDFDAEDEDQALSLFDNVIKNNFISDSYCFEWKEVADEISV* |
| Ga0102889_11861131 | 3300008964 | Estuarine | MKKYTFGVWLDIDAEDEDMALSLFDSVVKNAFVSQSYCFEWKEVADEIAI* |
| Ga0102816_10275302 | 3300008999 | Estuarine | MKRYTFGVWLDIDAEDENQAVSLFDSVVKNTFVSDSYCFEWKEVADEIAV* |
| Ga0102911_10456681 | 3300009049 | Estuarine | MKKYTFGVWLDIDAEDEDMALYLFDSVVKNAFVSESYCFEWKEVADEIAI* |
| Ga0102909_10562703 | 3300009050 | Estuarine | MKKYTFGVWLDIDAEDEDMALSLFDSVVKNVFVSESYCFEWKEVADEIAV* |
| Ga0102892_10229163 | 3300009057 | Estuarine | MKKYTFGVWLDIDAEDEDMALSLFDSVVKNVFVSESYCFEWKEVADEIAI* |
| Ga0102830_10050634 | 3300009059 | Estuarine | MKKYTFGVGLDIDAEDEDMALSLFDSVVKNAFVSESYCFEWKEVADEIAI* |
| Ga0102830_10355381 | 3300009059 | Estuarine | MKKYTFGVWLDIDAEDEEMALSLFDSVVKNAFVSDSFCFEWKEVADEIAI* |
| Ga0102830_11902571 | 3300009059 | Estuarine | KYTFGVWLDIDAEDEDMALSLFDSVVKNAFVSDSFCFEWKEVADEIAI* |
| Ga0114973_100364565 | 3300009068 | Freshwater Lake | MKKYTFGVWLDIDAEDENQALSLFDEVVKKNLFVSDSYCFEWKEVADEIAI* |
| Ga0114973_100549818 | 3300009068 | Freshwater Lake | MNKYTFGVWLDIDAEDEEMALSLFDSVVKHTFVSDSYCFEWKEVANEIAV* |
| Ga0114973_102818903 | 3300009068 | Freshwater Lake | MKKYTFGVWLDIDAEDEDQALSLFDDVIKNNWVSDSYCFEWKEVANV* |
| Ga0114973_103820533 | 3300009068 | Freshwater Lake | MNKYTFGVWLDIDAEDENQALSLFDEVVKKNPFVSDSYCFEWKEVANV* |
| Ga0102812_105935232 | 3300009086 | Estuarine | MKKYSFGVWLDIDAEDEDMALSLFDSVVKNAFVSESYCFEWKEVADEIAI* |
| Ga0102884_12025471 | 3300009141 | Estuarine | MKKYTFGVWLDIDAEDEEMALSLFDSVVKNAFVSESYCFEWKEVADEIAI* |
| Ga0114962_1000790216 | 3300009151 | Freshwater Lake | MKKYTFGVWLDIDAENDDQALSIFDNVIKNNFVSDSYCFEWKEVE* |
| Ga0114980_100027554 | 3300009152 | Freshwater Lake | MNKYTFGVWLDIDAEDENQALSLFDSVVKNTFVSDSYCFEWKEVANV* |
| Ga0114980_101892553 | 3300009152 | Freshwater Lake | MNKYTFGVWLDIDAEDEEMALSLFDEVVKKNPFVSDSYCFEWKEVANEIAV* |
| Ga0114977_102224223 | 3300009158 | Freshwater Lake | MKKYTFGVWLDIDAEDEEMALSLFDEVVKKNPFVSDSYCFEWKEVADEIAV* |
| Ga0114977_102362703 | 3300009158 | Freshwater Lake | MKKYTFGVWLDIDAEDEDMALSLFDEVVKKNLFVSDSYCFEWKEVADEIAI* |
| Ga0114978_102901643 | 3300009159 | Freshwater Lake | MKGKLMNKYTFGVWLDIDAEDEEMALSLFDSVVKNTFVSDSYCFEWKEVANV* |
| Ga0114978_103750862 | 3300009159 | Freshwater Lake | MKKYTFGVWLDIDAEDEEMALSLFDEVVKKSPFVSDSYCFEWKEVE* |
| Ga0114979_106846313 | 3300009180 | Freshwater Lake | MNKYTFGVWLDIDAEDEEMALSLFDEGVKKNPFVSDSDCFEWK |
| Ga0114979_107228802 | 3300009180 | Freshwater Lake | MNKYTFGVWLDIDAEDESQALSLFDNVVKNTFVSDSYCFEWKEVANV* |
| Ga0114979_108424271 | 3300009180 | Freshwater Lake | FGVWLDIDAEDESQALSLFDSVVKNTFVSDSYCFEWKEVADEIAI* |
| Ga0114969_107313433 | 3300009181 | Freshwater Lake | MKKYTFGVWLDIDAEDENQALSLFDSVVKNTFVSDSYCFEWKEVANV* |
| Ga0114974_1000265017 | 3300009183 | Freshwater Lake | MNKYTFGVWLDIDAEDEDMALSLFDSVINNTFVKDSYCFEWKEVDNV* |
| Ga0114974_100623673 | 3300009183 | Freshwater Lake | MKKYTFGVWLDIDAEDENQALSLFDEVVKKNPFVSDSYCFEWKEVANV* |
| Ga0114974_101114166 | 3300009183 | Freshwater Lake | MKKYTFGVWLDIDAEDEDQALSLFDEVVKKNLFVSDSYCFEWKEVE* |
| Ga0114974_102943442 | 3300009183 | Freshwater Lake | MKKYTFGVWLDIDAEDEEMALSLFDEVVKKNPFVSDSYCFEWKEVADEIAI* |
| Ga0114976_101150673 | 3300009184 | Freshwater Lake | MNKYTFGVWLDIDAEDEEMALSLFDEVVKKNPFVSDSYCFEWKEVANV* |
| Ga0114976_101197052 | 3300009184 | Freshwater Lake | MKKYTFGVWLDIDAEDENQALSLFDEVVKKNLFVSDSYCFEWKEVE* |
| Ga0114976_101246324 | 3300009184 | Freshwater Lake | MKKYTFGVWLDIDAEDEEMALSLFDEVVKKSPFVSDSYCFEWKEVADEIAI* |
| Ga0114976_101634833 | 3300009184 | Freshwater Lake | MNKYTFGVWLDIDAEDEEMALSLFDEVVKKNRFVSDSYCFEWKEVANEIAV* |
| Ga0114976_101730681 | 3300009184 | Freshwater Lake | MNKYTFGVWLDIDAEDEEMALSLFDEVVKKNPFVSDSYCFE |
| Ga0114983_10867453 | 3300009194 | Deep Subsurface | MKKYTFGVWLDIDAEDEDQALSLFDSVVKNAFVSDSYCFEWKEVADEIAV* |
| Ga0114982_10730821 | 3300009419 | Deep Subsurface | MKRYTFGVWLDIDAEDEEMALSLFDSVVKNTFVSDSYCFEWKEVADEIAI* |
| Ga0133913_1000593914 | 3300010885 | Freshwater Lake | MKKYTFGVWLDIDAENDDQALSIFDNVIKNNFVSDSYCFEGKEVE* |
| Ga0133913_104623542 | 3300010885 | Freshwater Lake | MNKYTFGVWLDIDAEDEDQALSLFDDVIKNNWVSDSYCFEWKEVANV* |
| Ga0133913_119641654 | 3300010885 | Freshwater Lake | MKKYTFGVWLDIDAEDEDQALSLFNDVTKHHWVSDSYCFEWKEVE* |
| Ga0119951_10633891 | 3300012000 | Freshwater | MKKYTFGVWLDIDAEDEDMALSLFDEVVKKNPFVSDSYCFEWKEVADEIAI* |
| Ga0119951_11072672 | 3300012000 | Freshwater | MKKYTFGVWLDFEAEDEDMALSMFDEVVKKNIFVSDSYCFDWKEVE* |
| Ga0119955_11724232 | 3300012006 | Freshwater | MKKYTFGVWLDIDAEDEDMALSLFDEVVKKNPFVSDSYCF |
| Ga0157203_10499412 | 3300012663 | Freshwater | MKRYTFGVWLDIDAEDENQAMSLFDSVVKNTFVSDSYCFEWKEVADEIAV* |
| Ga0157498_10301453 | 3300012666 | Freshwater, Surface Ice | MKKYTFGVWLDIDAEDEEMAISLFDSVVKNAFVSDSYCFEWKEVADEIAV* |
| Ga0138287_12123313 | 3300012772 | Freshwater Lake | MNKYTFGVWLDIDAEDENQALSLFDEVVKKNPFVSDSYCFEWKEVANEIAV* |
| Ga0138284_10919333 | 3300012779 | Freshwater Lake | MNKYTFGVWLDIDAEDESQALSLFDSVVKNTFVSDSYCFEWKEVANV* |
| Ga0138286_13216264 | 3300012781 | Freshwater Lake | MNKYTFGVWLDIDAEDENQALSLFDEVVKKNPFVSDSYCFEWKEVADEIAV* |
| Ga0170791_101993643 | 3300013295 | Freshwater | NKYTFGVWLDIDAEDENQALSLFDEVVKKNPFVSDSYCFEWKEVANV* |
| Ga0177922_112823333 | 3300013372 | Freshwater | MKKYTFGVWLDIDAEDEDMALSLFDSVVKNAFVSESYCFEWKEVADEIAV* |
| Ga0119952_10578632 | 3300014050 | Freshwater | MKKYTFGVWLDIDAEDEDMALSLFDSVVKNPFISDSYCFEWKEVE* |
| Ga0119952_11249481 | 3300014050 | Freshwater | LMKKYTFGVWLDIDAEDEDQALSLFDNVVKNTFVSDSYCFEWKEVADEIAI* |
| Ga0180058_12199511 | 3300016699 | Freshwater | LMKRYTFGVWLDIDAEDEEMAISLFDSVVKNAFVSDSYCFEWKEVADEIAV |
| Ga0181359_10640804 | 3300019784 | Freshwater Lake | MKKYTFGVWLDIDAEDEEMALSLFDSVVKNAFVSESYCFEWKEVADEIAV |
| Ga0181359_10681516 | 3300019784 | Freshwater Lake | MKKYTFGVWLDIDAEDEDMALSLFDSVVKNPFVSDSFCFEWKEVADEIAI |
| Ga0207193_17771942 | 3300020048 | Freshwater Lake Sediment | MNKYTFGVWLDIDAEDEEMALSLFDSVVKNTFVSDSYCFEWKEVANEIAV |
| Ga0211732_10696679 | 3300020141 | Freshwater | MKKYTFGVWLDIDAEDEEMALSLFDSVVKNAFVSDSYCFEWKEVADEIAI |
| Ga0211726_108583161 | 3300020161 | Freshwater | MKKYTFGVWLDIDAEDEEMALSLFDSVVKNAFVSDSYCF |
| Ga0211729_108811814 | 3300020172 | Freshwater | MKKYTFGVWLDIDAEDEEMALSLFDSVVKNAFVSDSYCFEW |
| Ga0213920_100112313 | 3300021438 | Freshwater | MKKYTFGVWLDIDAENDDDALHFFDSVIKNNLVSDSYCFEWKEVE |
| Ga0194048_100070533 | 3300021519 | Anoxic Zone Freshwater | MKKYTFGVWLDIDAEDEDMALSLFDSVVKHPFVSDSYCFEWKEVADEIAI |
| Ga0194048_100737553 | 3300021519 | Anoxic Zone Freshwater | MKKYTFGVWLDIDAEDENQALSLFDEVVKKNLFVSDSYCFEWKEVADEIAI |
| Ga0213922_10100773 | 3300021956 | Freshwater | MKKYTFGVWLDFEAEDEDMALSLFDEVVKKNTFVKDSYCFDWKEVE |
| Ga0222713_1002687413 | 3300021962 | Estuarine Water | MKKYTFGVWLDIDAEDEDMALSLFDSVVKNPFVSDSYCFEWKEVADEIAI |
| Ga0222713_1003221711 | 3300021962 | Estuarine Water | MKRYTFGVWLDIDAEDEEMALSLFDNVVKNNFVSDSYCFEWKEVADEIAI |
| Ga0222713_100496328 | 3300021962 | Estuarine Water | MKKYTFGVWLDIDAEDENQAISLFDSVVKNTFVSDSYCFEWKEVADEIAI |
| Ga0222713_102892532 | 3300021962 | Estuarine Water | MNKYTFGVWLDIDAEDEDMALSLFDSVVKNAFVSESYCFEWKEVANV |
| Ga0222713_105279593 | 3300021962 | Estuarine Water | MKKYTFGVWLDIDAEDEEMALSLFDSVVKNTFVSDSFCFEWKEVADEIAI |
| Ga0214917_102282062 | 3300022752 | Freshwater | MKKYTFGVWLDIDAEDEDMALSLFDEVVKKNPFVSDSYCFEWKEVADEIAI |
| Ga0214917_104612381 | 3300022752 | Freshwater | MKKYTFGVWLDIDAEDENQALSLFDSVVKNTFVSDSY |
| Ga0214921_10000248146 | 3300023174 | Freshwater | MKKYTFGVWLDIDAEDENQALSLFDSVVKNTFVSDSYCFEWKEVADEIAI |
| Ga0214921_1000217611 | 3300023174 | Freshwater | MKKYTFGVWLDIDAEDEEMALSLFDSVVKNTFVSDSYCFEWKEVEQ |
| Ga0214921_1000712613 | 3300023174 | Freshwater | MKKYTFGVWLDIDAEDEEMALSLFDSVVKHTFVSDSYCFEWKEVADEIAI |
| Ga0214921_100164967 | 3300023174 | Freshwater | MKKYTFGVWLDIDAEDEDQALSLFDEVVKKNPFVSDSYCFEWKEVADEIAI |
| Ga0214921_1001914711 | 3300023174 | Freshwater | MKKYTFGVWLDIDAEDENQALSLFDNVIKNNFVSDSYCFEWKEVADEIAI |
| Ga0214921_1012571910 | 3300023174 | Freshwater | MKKYTFGVWLDIDAEDEDQALSLFDDVIKNNWVSDSYCFEWKEVADEIAI |
| Ga0214921_101373381 | 3300023174 | Freshwater | MKKYTFGVWLDIDAEDEDMALSLFDEVVKKSPFVSDSYCFEWKEVADEIAI |
| Ga0214921_102178476 | 3300023174 | Freshwater | MKKYTFGVWLDIDAEDEDMALSLFDEVVKKNSFVSDSYCFEWKEVADEIAI |
| Ga0214921_102675892 | 3300023174 | Freshwater | MKKYTFGVWLDIDAEDEDMALSLFDSVVKNPFISDSYCFEWKEVADEIAI |
| Ga0214923_100320147 | 3300023179 | Freshwater | MKKYTFGVWLDFEAEDEDMALSMFDEVVKKNIFVSDSYCFDWKEVE |
| Ga0214919_103185063 | 3300023184 | Freshwater | MKKYTFGVWLDIDAEDEDQALSLFDDVIKNNWVSDSYCFEWKEVADEISI |
| Ga0255147_10961301 | 3300024289 | Freshwater | MAKYTFGVWLDIDAEDEEQAISLFDSVVKNSFVKDSYCFEWKEID |
| Ga0255147_11067351 | 3300024289 | Freshwater | MKKYTFGVWLDIDAENEEMAVSLFDEVVKNTFVSDSYCFEWKEVE |
| Ga0244777_101100767 | 3300024343 | Estuarine | MKKYTFGVWLDIDAEDENQAVSLFDSVVKNTFVSDSYCFEWKEVADEIAV |
| Ga0244777_104555553 | 3300024343 | Estuarine | MKKYTFGVWLDIDAEDEDMALSLFDSVVKNVFVSESYCFEWKEVADEIAI |
| Ga0244777_106475843 | 3300024343 | Estuarine | MKKYTFGVWLDIDAEDEDMALSLFDSVVKNAFVSESYCFEWKEVADEIAI |
| Ga0244775_1000187127 | 3300024346 | Estuarine | MKRYTFGVWLDIDAEDENQAVSLFDSVVKNTFVSDSYCFEWKEVADEIAI |
| Ga0244775_100707023 | 3300024346 | Estuarine | MKKYTFGVWLDIDAEDEDMAVSLFDSVVKNTFVSDSYCFEWKEVADEIAI |
| Ga0244775_102431226 | 3300024346 | Estuarine | MKKYTFGVWLDIDAEDENQAVSLFDSVVKNTFVSDSYCFE |
| Ga0208674_10149131 | 3300027190 | Estuarine | GVWLDIDAEDENQALSLFDSVVKNTFVSDSYCFEWKEVADEIAI |
| Ga0208929_100255114 | 3300027227 | Estuarine | TFGVWLDIDAEDEEMALSLFDSVVKNAFVSDSYCFEWKEVADEIAV |
| Ga0208444_10038138 | 3300027240 | Estuarine | WLDIDAEDENQAVSLFDSVVKNTFVSDSYCFEWKEVADEIAV |
| Ga0208931_10300341 | 3300027246 | Estuarine | LDIDAEDEDMALSLFDSVVKNVFVSESYCFEWKEVADEIAI |
| Ga0208439_10995131 | 3300027278 | Estuarine | FGVWLDIDAEDEDMALSLFDSVVKNAFVSESYCFEWKEVADEIAI |
| Ga0255126_10383365 | 3300027295 | Freshwater | MKKYTFGVWLDIDAEDEEMALSLFDSVVKNAFVSDSYCFEWKEV |
| Ga0209300_10234723 | 3300027365 | Deep Subsurface | MKKYTFGVWLDIDAEDEDQALSLFDSVVKNAFVSDSYCFEWKEVADEIAV |
| Ga0255158_10382604 | 3300027541 | Freshwater | MAKYTFGVWLDIDAEDEDQAISLFDSVVKNSFVKDSYCFEWKEID |
| Ga0255075_10143746 | 3300027578 | Freshwater | MKKYTFGVWLDIDAEDEEMALSLFDSVVKNAFVSDSYCFEWKEVADEIAVXN |
| Ga0255075_10480661 | 3300027578 | Freshwater | MKKYTFGVWLDIDAEDENQAVSLFDSVVKNTFVSDSY |
| Ga0255068_1239751 | 3300027579 | Freshwater | MKKYTFGVWLDIDAEDEDMALSLFDSVVKNAFVSES |
| Ga0208951_10352176 | 3300027621 | Freshwater Lentic | MNKYTFGVWLDIDAEDEEMALSLFDSVVKNAFVSDSYCFEWKEVANV |
| Ga0208942_10031666 | 3300027627 | Freshwater Lentic | MKKYTFGVWLDIDAEDEDMALSLFDSVVKNTFVSDSFCFEWKEVADEIAI |
| Ga0208133_10158118 | 3300027631 | Estuarine | MKKYTFGVWLDIDAEDEDMALSLFDSVVKNAFVSDSFCFEWKEVADEIAI |
| Ga0209356_10222991 | 3300027644 | Freshwater Lake | MKRYTFGVWLDIDAEDEDMALSLFDSVVKNAFVSDSY |
| Ga0208975_10302346 | 3300027659 | Freshwater Lentic | MKKYTFGVWLDIDAEDEDMALSLFDSVVKNAFVSDSYCFEWKEVADEIAV |
| Ga0209188_100008520 | 3300027708 | Freshwater Lake | MKKYTFGVWLDIDAENDDQALSIFDNVIKNNFVSDSYCFEWKEVE |
| Ga0209188_100227410 | 3300027708 | Freshwater Lake | MNKYTFGVWLDIDAEDENQALSLFDEVVKKNPFVSDSYCFEWKEVANV |
| Ga0209599_1000236414 | 3300027710 | Deep Subsurface | MKKYTFGVWLDIDAEDENQALSLFDGVVKNTFVSDSYCFEWKEVADEIAV |
| Ga0209617_100494386 | 3300027720 | Freshwater And Sediment | MKKYTFGVWLDIDAEDEDMAISLFDSVVKNAFVSDSYCFEWKEVADEIAV |
| Ga0209297_10506934 | 3300027733 | Freshwater Lake | MNKYTFGVWLDIDAEDEEMALSLFDSVVKHTFVSDSYCFEWKEVANEIAV |
| Ga0209297_11458103 | 3300027733 | Freshwater Lake | MKKYTFGVWLDIDAEDEDMALSLFDEVVKKNLFVSDSYCFEWKEVADEIAI |
| Ga0209297_11501393 | 3300027733 | Freshwater Lake | MKKYTFGVWLDIDAEDEEMALSLFDEVVKKNPFVSDSYCFEWKEVADEIAV |
| Ga0209297_12516004 | 3300027733 | Freshwater Lake | MNKYTFGVWLDIDAEDENQALSLFDSVVKNTFVSDSYCFEWKEVANV |
| Ga0209297_12618014 | 3300027733 | Freshwater Lake | MNKYTFGVWLDIDAEDESQALSLFDSVVKNTFVSDSYCFEWKEVANV |
| Ga0209087_10007163 | 3300027734 | Freshwater Lake | MNKYTFGVWLDIDAEDEEMALSLFDEVVKKNPFVSDSYCFEWKEVANEIAV |
| Ga0209087_11628981 | 3300027734 | Freshwater Lake | MNKYTFGVWLDIDAEDEEMALSLFDEVVKKNPFVSDSYCFEWKEVANV |
| Ga0209087_12555753 | 3300027734 | Freshwater Lake | MKKYTFGVWLDIDAEDEEMALSLFDEVVKKSPFVSDSYCFEWKEVADEIAI |
| Ga0209296_100232917 | 3300027759 | Freshwater Lake | MNKYTFGVWLDIDAEDEDMALSLFDSVINNTFVKDSYCFEWKEVDNV |
| Ga0209296_10843025 | 3300027759 | Freshwater Lake | MKKYTFGVWLDIDAEDEEMALSLFDEVVKKNPFVSDSYCFEWKEVADEIAI |
| Ga0209598_1003363110 | 3300027760 | Freshwater Lake | MKKYTFGVWLDIDAEDENQALSLFDEVVKKSPFVSDSYCFEWKEVADEIAI |
| Ga0209598_102014533 | 3300027760 | Freshwater Lake | MKKYTFGVWLDIDAEDEDQALSLFDDVIKNNWVSDSYCFEWKEVANV |
| Ga0209088_100696765 | 3300027763 | Freshwater Lake | MNKYTFGVWLDIDAEDEEMALSLFDSVVKNTFVSDSYCFEWKEVANV |
| Ga0209770_102292401 | 3300027769 | Freshwater Lake | MKKYTFGVWIDIDAEDEEMALSLFDSVVKNTFVSDSYCFEWKEVADEIAV |
| Ga0209086_100801215 | 3300027770 | Freshwater Lake | MKKYTFGVWLDIDAEDENQALSLFDSVVKNTFVSDSYCFEWKEVANEIAI |
| Ga0209086_101688852 | 3300027770 | Freshwater Lake | MKKYTFGVWLDIDAEDEDMALSLFDSVVKNTFVSDSYCFEWKEVADEIAI |
| Ga0209500_100999125 | 3300027782 | Freshwater Lake | MKKYTFGVWLDIDAEDEEMALSLFDEVVKKSPFVSDSYCFEWKEVE |
| Ga0209107_1001075410 | 3300027797 | Freshwater And Sediment | MKKYTFGVWLDIDAEDEDMALSLFDSVVKNAFVSDSYCFEWKEVADEIAI |
| Ga0209229_1000017646 | 3300027805 | Freshwater And Sediment | MKKYTFGVWLDINAEDEEMAVSLFDEVVKNTFVSDSYCFEWKEVE |
| Ga0209229_102987021 | 3300027805 | Freshwater And Sediment | MKKYTFGVWLDIDAEDEDMALSLFDGVVKNPFVSDSFCFEWKEVA |
| Ga0209550_101962552 | 3300027892 | Freshwater Lake | MKRYTFGVWLDIDAEDEDMALSLFDSVVKNAFVSDSYCFEWKEVADEIAI |
| Ga0315907_102416164 | 3300031758 | Freshwater | LNKTYRFGVWLDIDAEDDDMALSLFDSIVKNTFVKDSYCFNWEEVE |
| Ga0315909_100906744 | 3300031857 | Freshwater | MKKYTFGVWIDIEAENEDDAVLAFDSVLENSLVKDRYCFEIKEV |
| Ga0316625_1027893701 | 3300033418 | Soil | LNKYTFGVWLDIDAEDENQAISIFNSVVKENNLISNSYCFDWKEIE |
| Ga0334992_0004996_8673_8825 | 3300033992 | Freshwater | MKKYTFGVWLDIDAEDENQAISLFDSVVKNTFVSDSYCFEWKEVADEIAV |
| Ga0334991_0077014_1201_1353 | 3300034013 | Freshwater | MKRYTFGVWLDIDAEDEEMALSLFDSVVKNAFVSDSYCFEWKEVADEIAV |
| ⦗Top⦘ |