| Basic Information | |
|---|---|
| Family ID | F029006 |
| Family Type | Metagenome |
| Number of Sequences | 189 |
| Average Sequence Length | 50 residues |
| Representative Sequence | MNKIIIALMAIYFLGDPDLQYLAWLGDLKLYIVAAAIALVSMPWIAEQLDG |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 189 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 75.69 % |
| % of genes near scaffold ends (potentially truncated) | 25.40 % |
| % of genes from short scaffolds (< 2000 bps) | 84.13 % |
| Associated GOLD sequencing projects | 79 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (71.429 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands (62.434 % of family members) |
| Environment Ontology (ENVO) | Unclassified (76.720 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (68.783 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 60.76% β-sheet: 0.00% Coil/Unstructured: 39.24% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 189 Family Scaffolds |
|---|---|---|
| PF07885 | Ion_trans_2 | 7.94 |
| PF01758 | SBF | 2.12 |
| PF00589 | Phage_integrase | 1.59 |
| PF00072 | Response_reg | 1.06 |
| PF01050 | MannoseP_isomer | 1.06 |
| PF07592 | DDE_Tnp_ISAZ013 | 0.53 |
| PF00565 | SNase | 0.53 |
| PF06146 | PsiE | 0.53 |
| PF04304 | DUF454 | 0.53 |
| PF12762 | DDE_Tnp_IS1595 | 0.53 |
| PF03330 | DPBB_1 | 0.53 |
| PF07608 | DUF1571 | 0.53 |
| PF00483 | NTP_transferase | 0.53 |
| PF03109 | ABC1 | 0.53 |
| PF10604 | Polyketide_cyc2 | 0.53 |
| PF12281 | NTP_transf_8 | 0.53 |
| PF04185 | Phosphoesterase | 0.53 |
| PF02412 | TSP_3 | 0.53 |
| PF02586 | SRAP | 0.53 |
| PF04069 | OpuAC | 0.53 |
| PF01609 | DDE_Tnp_1 | 0.53 |
| PF03729 | DUF308 | 0.53 |
| PF05170 | AsmA | 0.53 |
| PF02560 | Cyanate_lyase | 0.53 |
| PF14659 | Phage_int_SAM_3 | 0.53 |
| PF04654 | DUF599 | 0.53 |
| PF13426 | PAS_9 | 0.53 |
| PF00196 | GerE | 0.53 |
| PF14321 | DUF4382 | 0.53 |
| PF08811 | DUF1800 | 0.53 |
| COG ID | Name | Functional Category | % Frequency in 189 Family Scaffolds |
|---|---|---|---|
| COG0661 | Predicted protein kinase regulating ubiquinone biosynthesis, AarF/ABC1/UbiB family | Signal transduction mechanisms [T] | 0.53 |
| COG1513 | Cyanate lyase | Inorganic ion transport and metabolism [P] | 0.53 |
| COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 0.53 |
| COG2832 | Uncharacterized membrane protein YbaN, DUF454 family | Function unknown [S] | 0.53 |
| COG2982 | Uncharacterized conserved protein AsmA involved in outer membrane biogenesis | Cell wall/membrane/envelope biogenesis [M] | 0.53 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.53 |
| COG3223 | Phosphate starvation-inducible membrane PsiE (function unknown) | General function prediction only [R] | 0.53 |
| COG3247 | Acid resistance membrane protein HdeD, DUF308 family | General function prediction only [R] | 0.53 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.53 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.53 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.53 |
| COG3821 | Uncharacterized membrane protein | Function unknown [S] | 0.53 |
| COG5267 | Uncharacterized conserved protein, DUF1800 family | Function unknown [S] | 0.53 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.53 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.53 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.53 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 71.43 % |
| All Organisms | root | All Organisms | 28.57 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002495|BRMGV_1006248 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3306 | Open in IMG/M |
| 3300002822|BMAI_1155740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4759 | Open in IMG/M |
| 3300002822|BMAI_1158500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Bathymodiolus platifrons methanotrophic gill symbiont | 1267 | Open in IMG/M |
| 3300003988|Ga0055475_10046169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1260 | Open in IMG/M |
| 3300003991|Ga0055461_10170487 | Not Available | 581 | Open in IMG/M |
| 3300003994|Ga0055435_10081107 | Not Available | 833 | Open in IMG/M |
| 3300003995|Ga0055438_10165295 | Not Available | 661 | Open in IMG/M |
| 3300004000|Ga0055458_10008971 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1939 | Open in IMG/M |
| 3300004000|Ga0055458_10022023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1399 | Open in IMG/M |
| 3300004000|Ga0055458_10043297 | Not Available | 1093 | Open in IMG/M |
| 3300004000|Ga0055458_10061767 | Not Available | 960 | Open in IMG/M |
| 3300004000|Ga0055458_10107719 | Not Available | 776 | Open in IMG/M |
| 3300004000|Ga0055458_10205005 | Not Available | 598 | Open in IMG/M |
| 3300004001|Ga0055450_10089272 | Not Available | 1095 | Open in IMG/M |
| 3300004001|Ga0055450_10374962 | Not Available | 529 | Open in IMG/M |
| 3300004002|Ga0055477_10240641 | Not Available | 720 | Open in IMG/M |
| 3300004004|Ga0055451_10050579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium HGW-Betaproteobacteria-3 | 1585 | Open in IMG/M |
| 3300004009|Ga0055437_10072422 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 969 | Open in IMG/M |
| 3300004009|Ga0055437_10084015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium HGW-Betaproteobacteria-3 | 914 | Open in IMG/M |
| 3300004009|Ga0055437_10103746 | Not Available | 841 | Open in IMG/M |
| 3300004009|Ga0055437_10336887 | Not Available | 506 | Open in IMG/M |
| 3300004010|Ga0055474_10279576 | Not Available | 596 | Open in IMG/M |
| 3300004011|Ga0055460_10195927 | Not Available | 626 | Open in IMG/M |
| 3300004012|Ga0055464_10028164 | Not Available | 1406 | Open in IMG/M |
| 3300004012|Ga0055464_10054220 | Not Available | 1050 | Open in IMG/M |
| 3300004012|Ga0055464_10112481 | Not Available | 764 | Open in IMG/M |
| 3300004012|Ga0055464_10119937 | Not Available | 743 | Open in IMG/M |
| 3300004014|Ga0055456_10141936 | Not Available | 797 | Open in IMG/M |
| 3300004014|Ga0055456_10170086 | Not Available | 736 | Open in IMG/M |
| 3300004014|Ga0055456_10172044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 732 | Open in IMG/M |
| 3300004014|Ga0055456_10283846 | Not Available | 585 | Open in IMG/M |
| 3300004019|Ga0055439_10198759 | Not Available | 641 | Open in IMG/M |
| 3300004020|Ga0055440_10010843 | Not Available | 1639 | Open in IMG/M |
| 3300004020|Ga0055440_10128774 | Not Available | 622 | Open in IMG/M |
| 3300004022|Ga0055432_10051068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Bathymodiolus platifrons methanotrophic gill symbiont | 986 | Open in IMG/M |
| 3300004022|Ga0055432_10060609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium HGW-Betaproteobacteria-3 | 924 | Open in IMG/M |
| 3300004024|Ga0055436_10070684 | Not Available | 982 | Open in IMG/M |
| 3300004030|Ga0055444_10116037 | Not Available | 943 | Open in IMG/M |
| 3300004061|Ga0055487_10045493 | Not Available | 697 | Open in IMG/M |
| 3300004062|Ga0055500_10022970 | Not Available | 1121 | Open in IMG/M |
| 3300004064|Ga0055479_10359845 | Not Available | 549 | Open in IMG/M |
| 3300004066|Ga0055484_10022549 | Not Available | 1218 | Open in IMG/M |
| 3300004066|Ga0055484_10177547 | Not Available | 572 | Open in IMG/M |
| 3300004070|Ga0055488_10128337 | Not Available | 642 | Open in IMG/M |
| 3300004070|Ga0055488_10232938 | Not Available | 508 | Open in IMG/M |
| 3300004071|Ga0055486_10019007 | Not Available | 1152 | Open in IMG/M |
| 3300004071|Ga0055486_10033663 | Not Available | 957 | Open in IMG/M |
| 3300004071|Ga0055486_10065526 | Not Available | 763 | Open in IMG/M |
| 3300004071|Ga0055486_10148163 | Not Available | 569 | Open in IMG/M |
| 3300004077|Ga0055523_10095794 | Not Available | 686 | Open in IMG/M |
| 3300004145|Ga0055489_10099460 | Not Available | 841 | Open in IMG/M |
| 3300004145|Ga0055489_10124665 | Not Available | 764 | Open in IMG/M |
| 3300004145|Ga0055489_10286769 | Not Available | 527 | Open in IMG/M |
| 3300004148|Ga0055521_10242324 | Not Available | 514 | Open in IMG/M |
| 3300005204|Ga0068997_10063315 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 737 | Open in IMG/M |
| 3300005205|Ga0068999_10019417 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1010 | Open in IMG/M |
| 3300005205|Ga0068999_10032649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Legionellaceae → Legionella → Legionella lansingensis | 853 | Open in IMG/M |
| 3300005216|Ga0068994_10167960 | Not Available | 608 | Open in IMG/M |
| 3300005218|Ga0068996_10060703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 767 | Open in IMG/M |
| 3300005218|Ga0068996_10194031 | Not Available | 522 | Open in IMG/M |
| 3300005836|Ga0074470_11075564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium HGW-Betaproteobacteria-3 | 1090 | Open in IMG/M |
| 3300009506|Ga0118657_10084105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 4728 | Open in IMG/M |
| 3300009506|Ga0118657_10433367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Emcibacterales → Emcibacteraceae | 1719 | Open in IMG/M |
| 3300009506|Ga0118657_11705036 | Not Available | 736 | Open in IMG/M |
| 3300009506|Ga0118657_11761957 | Not Available | 722 | Open in IMG/M |
| 3300009506|Ga0118657_11807577 | Not Available | 711 | Open in IMG/M |
| 3300009506|Ga0118657_12125830 | Not Available | 645 | Open in IMG/M |
| 3300009506|Ga0118657_12916279 | Not Available | 528 | Open in IMG/M |
| 3300009797|Ga0105080_1045548 | Not Available | 542 | Open in IMG/M |
| 3300011414|Ga0137442_1069300 | Not Available | 739 | Open in IMG/M |
| 3300014295|Ga0075305_1042222 | Not Available | 825 | Open in IMG/M |
| 3300014295|Ga0075305_1048603 | Not Available | 778 | Open in IMG/M |
| 3300014297|Ga0075306_1066104 | Not Available | 642 | Open in IMG/M |
| 3300014304|Ga0075340_1101281 | Not Available | 580 | Open in IMG/M |
| 3300014316|Ga0075339_1231416 | Not Available | 529 | Open in IMG/M |
| 3300014317|Ga0075343_1019220 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria → unclassified Halobacteria → Halobacteria archaeon | 1170 | Open in IMG/M |
| 3300014317|Ga0075343_1061001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Bathymodiolus platifrons methanotrophic gill symbiont | 784 | Open in IMG/M |
| 3300014318|Ga0075351_1141590 | Not Available | 562 | Open in IMG/M |
| 3300014319|Ga0075348_1144859 | Not Available | 626 | Open in IMG/M |
| 3300014321|Ga0075353_1230652 | Not Available | 508 | Open in IMG/M |
| 3300014324|Ga0075352_1195115 | Not Available | 596 | Open in IMG/M |
| 3300014867|Ga0180076_1037095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Thiotrichaceae → Beggiatoa → unclassified Beggiatoa → Beggiatoa sp. PS | 847 | Open in IMG/M |
| 3300014874|Ga0180084_1065047 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 739 | Open in IMG/M |
| 3300014882|Ga0180069_1002677 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3648 | Open in IMG/M |
| 3300014884|Ga0180104_1173682 | Not Available | 642 | Open in IMG/M |
| 3300014885|Ga0180063_1300662 | Not Available | 509 | Open in IMG/M |
| 3300018084|Ga0184629_10023543 | Not Available | 2584 | Open in IMG/M |
| 3300018084|Ga0184629_10031151 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2308 | Open in IMG/M |
| 3300019729|Ga0193968_1071037 | Not Available | 507 | Open in IMG/M |
| 3300021081|Ga0210379_10126645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 1076 | Open in IMG/M |
| 3300025521|Ga0210083_1012209 | Not Available | 1136 | Open in IMG/M |
| 3300025521|Ga0210083_1047442 | Not Available | 649 | Open in IMG/M |
| 3300025535|Ga0207423_1033641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium HGW-Betaproteobacteria-3 | 878 | Open in IMG/M |
| 3300025538|Ga0210132_1044782 | Not Available | 646 | Open in IMG/M |
| 3300025551|Ga0210131_1000416 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6523 | Open in IMG/M |
| 3300025551|Ga0210131_1003407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium HGW-Betaproteobacteria-3 | 1893 | Open in IMG/M |
| 3300025551|Ga0210131_1010323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Emcibacterales → Emcibacteraceae | 1258 | Open in IMG/M |
| 3300025551|Ga0210131_1027914 | Not Available | 854 | Open in IMG/M |
| 3300025554|Ga0210060_1030202 | Not Available | 882 | Open in IMG/M |
| 3300025554|Ga0210060_1072088 | Not Available | 605 | Open in IMG/M |
| 3300025554|Ga0210060_1106775 | Not Available | 509 | Open in IMG/M |
| 3300025556|Ga0210120_1019229 | Not Available | 1332 | Open in IMG/M |
| 3300025560|Ga0210108_1004782 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2303 | Open in IMG/M |
| 3300025560|Ga0210108_1070415 | Not Available | 682 | Open in IMG/M |
| 3300025562|Ga0210099_1013985 | Not Available | 1480 | Open in IMG/M |
| 3300025563|Ga0210112_1003041 | Not Available | 3957 | Open in IMG/M |
| 3300025563|Ga0210112_1012282 | Not Available | 1895 | Open in IMG/M |
| 3300025563|Ga0210112_1015381 | Not Available | 1685 | Open in IMG/M |
| 3300025563|Ga0210112_1021243 | Not Available | 1417 | Open in IMG/M |
| 3300025563|Ga0210112_1022759 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1365 | Open in IMG/M |
| 3300025563|Ga0210112_1055439 | Not Available | 828 | Open in IMG/M |
| 3300025563|Ga0210112_1093821 | Not Available | 617 | Open in IMG/M |
| 3300025563|Ga0210112_1121990 | Not Available | 532 | Open in IMG/M |
| 3300025565|Ga0210110_1015862 | All Organisms → cellular organisms → Bacteria | 1971 | Open in IMG/M |
| 3300025565|Ga0210110_1064768 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300025568|Ga0210095_1171688 | Not Available | 521 | Open in IMG/M |
| 3300025569|Ga0210073_1059806 | Not Available | 801 | Open in IMG/M |
| 3300025573|Ga0210133_1087506 | Not Available | 683 | Open in IMG/M |
| 3300025583|Ga0210085_1010612 | Not Available | 3085 | Open in IMG/M |
| 3300025583|Ga0210085_1015188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium HGW-Betaproteobacteria-3 | 2486 | Open in IMG/M |
| 3300025583|Ga0210085_1017121 | Not Available | 2312 | Open in IMG/M |
| 3300025583|Ga0210085_1086337 | Not Available | 865 | Open in IMG/M |
| 3300025593|Ga0210096_1023415 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1781 | Open in IMG/M |
| 3300025599|Ga0210074_1026665 | All Organisms → cellular organisms → Bacteria | 1675 | Open in IMG/M |
| 3300025599|Ga0210074_1029697 | Not Available | 1570 | Open in IMG/M |
| 3300025599|Ga0210074_1161412 | Not Available | 593 | Open in IMG/M |
| 3300025615|Ga0210086_1020830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium HGW-Betaproteobacteria-3 | 2219 | Open in IMG/M |
| 3300025793|Ga0210065_1003723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3036 | Open in IMG/M |
| 3300025793|Ga0210065_1011334 | Not Available | 1675 | Open in IMG/M |
| 3300025797|Ga0210062_1044460 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
| 3300025797|Ga0210062_1079795 | Not Available | 764 | Open in IMG/M |
| 3300025799|Ga0210122_1116534 | Not Available | 581 | Open in IMG/M |
| 3300025801|Ga0210097_1003369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium SG8_38_1 | 3661 | Open in IMG/M |
| 3300025801|Ga0210097_1021091 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1440 | Open in IMG/M |
| 3300025801|Ga0210097_1123645 | Not Available | 605 | Open in IMG/M |
| 3300025813|Ga0210064_1008943 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3012 | Open in IMG/M |
| 3300025813|Ga0210064_1021720 | Not Available | 1765 | Open in IMG/M |
| 3300025813|Ga0210064_1047956 | Not Available | 1090 | Open in IMG/M |
| 3300025814|Ga0210101_1000365 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 15632 | Open in IMG/M |
| 3300025943|Ga0210125_1089005 | Not Available | 513 | Open in IMG/M |
| 3300025947|Ga0210067_1000528 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4361 | Open in IMG/M |
| 3300025947|Ga0210067_1011479 | Not Available | 1104 | Open in IMG/M |
| 3300025947|Ga0210067_1024244 | Not Available | 808 | Open in IMG/M |
| 3300025948|Ga0210088_1044344 | Not Available | 694 | Open in IMG/M |
| 3300025953|Ga0210068_1054358 | Not Available | 619 | Open in IMG/M |
| 3300026007|Ga0210124_1024641 | Not Available | 2126 | Open in IMG/M |
| 3300026888|Ga0209900_1020906 | Not Available | 527 | Open in IMG/M |
| 3300028803|Ga0307281_10025261 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1750 | Open in IMG/M |
| 3300029827|Ga0134606_10248421 | Not Available | 547 | Open in IMG/M |
| 3300029827|Ga0134606_10285435 | Not Available | 505 | Open in IMG/M |
| 3300031256|Ga0315556_1055191 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1619 | Open in IMG/M |
| 3300031256|Ga0315556_1182113 | Not Available | 753 | Open in IMG/M |
| 3300031256|Ga0315556_1195067 | Not Available | 720 | Open in IMG/M |
| 3300031585|Ga0315534_1256931 | Not Available | 601 | Open in IMG/M |
| 3300031665|Ga0316575_10013976 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3008 | Open in IMG/M |
| 3300031665|Ga0316575_10022341 | Not Available | 2440 | Open in IMG/M |
| 3300031665|Ga0316575_10102260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium HGW-Betaproteobacteria-3 | 1166 | Open in IMG/M |
| 3300031665|Ga0316575_10230392 | Not Available | 774 | Open in IMG/M |
| 3300031665|Ga0316575_10429372 | Not Available | 569 | Open in IMG/M |
| 3300031691|Ga0316579_10043789 | All Organisms → cellular organisms → Bacteria | 2083 | Open in IMG/M |
| 3300031691|Ga0316579_10130096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1212 | Open in IMG/M |
| 3300031691|Ga0316579_10174139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Emcibacterales → Emcibacteraceae | 1040 | Open in IMG/M |
| 3300031691|Ga0316579_10235532 | Not Available | 886 | Open in IMG/M |
| 3300031727|Ga0316576_10153603 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1735 | Open in IMG/M |
| 3300031727|Ga0316576_10637675 | Not Available | 776 | Open in IMG/M |
| 3300031727|Ga0316576_11342387 | Not Available | 502 | Open in IMG/M |
| 3300031728|Ga0316578_10238599 | Not Available | 1092 | Open in IMG/M |
| 3300031728|Ga0316578_10394419 | Not Available | 821 | Open in IMG/M |
| 3300031728|Ga0316578_10432360 | Not Available | 779 | Open in IMG/M |
| 3300031728|Ga0316578_10713709 | Not Available | 583 | Open in IMG/M |
| 3300031728|Ga0316578_10807790 | Not Available | 543 | Open in IMG/M |
| 3300031733|Ga0316577_10372877 | Not Available | 811 | Open in IMG/M |
| 3300032061|Ga0315540_10102163 | Not Available | 1315 | Open in IMG/M |
| 3300032061|Ga0315540_10409257 | Not Available | 543 | Open in IMG/M |
| 3300032061|Ga0315540_10461385 | Not Available | 501 | Open in IMG/M |
| 3300032133|Ga0316583_10028709 | Not Available | 1984 | Open in IMG/M |
| 3300032133|Ga0316583_10029769 | Not Available | 1946 | Open in IMG/M |
| 3300032133|Ga0316583_10055501 | Not Available | 1393 | Open in IMG/M |
| 3300032137|Ga0316585_10180472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium HGW-Betaproteobacteria-3 | 697 | Open in IMG/M |
| 3300032139|Ga0316580_10165494 | Not Available | 679 | Open in IMG/M |
| 3300033291|Ga0307417_10358290 | Not Available | 549 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 62.43% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 13.23% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 5.82% |
| Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 3.70% |
| Mangrove Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment | 3.70% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 3.17% |
| Mangrove Soil | Environmental → Aquatic → Marine → Oceanic → Sediment → Mangrove Soil | 1.06% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 1.06% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.06% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.06% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.53% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.53% |
| Mangrove Soil | Environmental → Aquatic → Marine → Oceanic → Oil-Contaminated Sediment → Mangrove Soil | 0.53% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.53% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.53% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.53% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002495 | 454 Fosmid Sequence | Environmental | Open in IMG/M |
| 3300002822 | Illumina_Fosmid_Bertioga | Environmental | Open in IMG/M |
| 3300003988 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordB_D2 | Environmental | Open in IMG/M |
| 3300003991 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300003994 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300003995 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 | Environmental | Open in IMG/M |
| 3300004000 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLB_D2 | Environmental | Open in IMG/M |
| 3300004001 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWC_D1 | Environmental | Open in IMG/M |
| 3300004002 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWA_D2 | Environmental | Open in IMG/M |
| 3300004004 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWB_D2 | Environmental | Open in IMG/M |
| 3300004009 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300004010 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWA_D1 | Environmental | Open in IMG/M |
| 3300004011 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004012 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300004014 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLA_D2 | Environmental | Open in IMG/M |
| 3300004019 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 | Environmental | Open in IMG/M |
| 3300004020 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2 | Environmental | Open in IMG/M |
| 3300004021 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWB_D1 | Environmental | Open in IMG/M |
| 3300004022 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300004024 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2 | Environmental | Open in IMG/M |
| 3300004030 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_CordA_D2 | Environmental | Open in IMG/M |
| 3300004061 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300004062 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004064 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWC_D1 | Environmental | Open in IMG/M |
| 3300004066 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLC_D2 | Environmental | Open in IMG/M |
| 3300004070 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004071 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqB_D2 | Environmental | Open in IMG/M |
| 3300004077 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300004145 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2 | Environmental | Open in IMG/M |
| 3300004148 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300005204 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D2 | Environmental | Open in IMG/M |
| 3300005205 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D2 | Environmental | Open in IMG/M |
| 3300005216 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLA_D2 | Environmental | Open in IMG/M |
| 3300005218 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300009506 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8 | Environmental | Open in IMG/M |
| 3300009797 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_10_20 | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300011414 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT266_2 | Environmental | Open in IMG/M |
| 3300014295 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLB_D1 | Environmental | Open in IMG/M |
| 3300014297 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLC_D1 | Environmental | Open in IMG/M |
| 3300014304 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300014316 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLC_D1 | Environmental | Open in IMG/M |
| 3300014317 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300014318 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D1_rd | Environmental | Open in IMG/M |
| 3300014319 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014321 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D1 | Environmental | Open in IMG/M |
| 3300014324 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014867 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT433_16_10D | Environmental | Open in IMG/M |
| 3300014874 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_2_16_10D | Environmental | Open in IMG/M |
| 3300014882 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231B'_16_10D | Environmental | Open in IMG/M |
| 3300014884 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1Da | Environmental | Open in IMG/M |
| 3300014885 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10D | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300019729 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_4-5_MG | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300025521 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025535 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025538 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025551 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025554 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025556 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025560 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025562 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025563 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025565 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025568 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025569 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025573 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025583 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025593 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025599 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_CordA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025615 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025793 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025797 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025799 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025801 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025813 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025814 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025943 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025947 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025948 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025953 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025985 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026007 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026888 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300029827 | Marine sediment microbial communities from Barataria Bay, New Orleans, USA to study impact of Deep Water Horizon explosion - M1047 | Environmental | Open in IMG/M |
| 3300031256 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1603-10 | Environmental | Open in IMG/M |
| 3300031585 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1602-40 | Environmental | Open in IMG/M |
| 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Host-Associated | Open in IMG/M |
| 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Host-Associated | Open in IMG/M |
| 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Host-Associated | Open in IMG/M |
| 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Host-Associated | Open in IMG/M |
| 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Host-Associated | Open in IMG/M |
| 3300032061 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-10 | Environmental | Open in IMG/M |
| 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Host-Associated | Open in IMG/M |
| 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Host-Associated | Open in IMG/M |
| 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Host-Associated | Open in IMG/M |
| 3300033291 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1602-10 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| BRMGV_10062483 | 3300002495 | Mangrove Soil | MNKINIALMAIYFLGDPDLQYLSWLGDLKLYVVAAALSLVSMPWIAKQLDG* |
| BMAI_11557402 | 3300002822 | Mangrove Soil | MNKIMIAMMAIYFMVDPDLLYLLWLDDLKLYLVATAIALVSMPWIASQLDG* |
| BMAI_11585003 | 3300002822 | Mangrove Soil | MNKVIIALMAIYFIGDPGLQYLAWLGELKVYIVAAAIALVSMPWIASQLDG* |
| Ga0055475_100461691 | 3300003988 | Natural And Restored Wetlands | AIYFVGDPHLQYLAWLGDLKLYIVAAAIALVSMPWIAEQLDG* |
| Ga0055461_101704871 | 3300003991 | Natural And Restored Wetlands | MNKIIITLMAIYFVGDPHLQYLAWLGDLKLYIVAAAIALVSMPWIAEQLDG* |
| Ga0055435_100811072 | 3300003994 | Natural And Restored Wetlands | MNKIIITLMAIYFVGDPDLQYLSWLGDMKLYIVAAAIALVSMPWIAEQLDG* |
| Ga0055438_101652951 | 3300003995 | Natural And Restored Wetlands | AIYFIGDPGLQYLSWLGELKLYIVAAAIALVSMPWVASQLDG* |
| Ga0055458_100089713 | 3300004000 | Natural And Restored Wetlands | MNKIIIVLMAIYFLGDPHLQYLSWLGDMKLYVVAAAIALVSMPWIAEQLDG* |
| Ga0055458_100220232 | 3300004000 | Natural And Restored Wetlands | MNKLIIVLMAIYFIGDPGLQYLAWLGELKVYIVAAAIALVSMPWIASQLDG* |
| Ga0055458_100432971 | 3300004000 | Natural And Restored Wetlands | MKHKFEKEATMNKIIIALMAIYFLGDPDLQYLAWLGDIKLYLIAAAMALVSMPWIASQFDG* |
| Ga0055458_100617671 | 3300004000 | Natural And Restored Wetlands | MAIYFVGDPHLQYLAWLGDLKLYIVAAAIALVSMPWIAEQLDG* |
| Ga0055458_101077191 | 3300004000 | Natural And Restored Wetlands | MNKIMIGLMAIYFLGDPQLHYLAWFGDMKLYLVAAAIALVSMPWITSQLDG* |
| Ga0055458_102050051 | 3300004000 | Natural And Restored Wetlands | MNKIIIALMAIYFLGDPDLQYLAWLGDMRLYIVAAAIAVVSMPWIAEQLDG* |
| Ga0055450_100892722 | 3300004001 | Natural And Restored Wetlands | MNKLIIALMAIYFIGDPGLQYLAWLGELKVYIVAAAIALVSMPWIASQLDG* |
| Ga0055450_103749621 | 3300004001 | Natural And Restored Wetlands | MNKSIIALMAIYFLGDPDLEYLSWLGDMKLYIVASAIALVSMPWIAEQLDG* |
| Ga0055477_102406412 | 3300004002 | Natural And Restored Wetlands | MNKIIIALMAIYFLGDPDLQYLAWLGDLKLYIVAAAIALVSMPWIAEQLDG* |
| Ga0055451_100505793 | 3300004004 | Natural And Restored Wetlands | MNKIIITLMAIYFLGDPHLQYLAWLGDLKLYVVAAALALVSMPWIAEQLDG* |
| Ga0055437_100724222 | 3300004009 | Natural And Restored Wetlands | MNKIIIGLMAIYFLGDPDLHYLAWLGDLKLYVVAAALALVSMPWIASQIDG* |
| Ga0055437_100840151 | 3300004009 | Natural And Restored Wetlands | MDKIIITLMAIYFVGDPHLQYLSWLGDMKLYVVAAAIALVSMPWI |
| Ga0055437_101037462 | 3300004009 | Natural And Restored Wetlands | MNKIIITLTAIYFVGDPHLHYLAWLGDLKLYIVAAAIALVSMPWIVEQLDG |
| Ga0055437_103368871 | 3300004009 | Natural And Restored Wetlands | MNKVIIALMAIYFVGDPDLQYLAWLGDLKVYLVAAAIALVSMPWIASQLDG* |
| Ga0055474_102795761 | 3300004010 | Natural And Restored Wetlands | MNKIIITLMAIYFLGDPHLQYLAWLGDLKIYVVAAALALVTMPWIAEQLDG* |
| Ga0055460_101959272 | 3300004011 | Natural And Restored Wetlands | MNKIIIALMAIYFLGDPDLQYLSWLGDLKLYIVAAAIALVSMPWITDQLDG* |
| Ga0055464_100281642 | 3300004012 | Natural And Restored Wetlands | MNKVIIALMAIYFIGDPGLQYLAWLGELKIYIVAAAIALVSMPWVAAQLDG* |
| Ga0055464_100542201 | 3300004012 | Natural And Restored Wetlands | MNKMIIALMAIYFIGDPGLQYLAWLGELKVYIVAAAIALVSMPWIASQLDG* |
| Ga0055464_101124811 | 3300004012 | Natural And Restored Wetlands | MNKIIIALMAIYFMGDPDLQYLSWLGDMKLYIVAAAIALVSMPWIAEQLDG* |
| Ga0055464_101199372 | 3300004012 | Natural And Restored Wetlands | MNKIIIALMAIYFLGDPDLQYLAWLGDIKLYLIAAAMALVSMPWIASQFDG* |
| Ga0055456_101419361 | 3300004014 | Natural And Restored Wetlands | MNKIMIGLMAIYFLGDPQLHYLAWLGDMKLYIVAAAIALVSMPWIAEQLDG* |
| Ga0055456_101700861 | 3300004014 | Natural And Restored Wetlands | MNKVMIALMAIYFIGDPGLQYLAWLGELKVYIVAAAIALVSMPWVAAQLDG* |
| Ga0055456_101720443 | 3300004014 | Natural And Restored Wetlands | AIYFLGDPDLQYLSWLGDLKIYVVAAALSLVSMPWIAEQLDG* |
| Ga0055456_102838461 | 3300004014 | Natural And Restored Wetlands | MNKIIIVLMAIYFLGDPHLQYLSWLGDMKLYVAAAAIALVSMPWIAEQLDG* |
| Ga0055439_101987591 | 3300004019 | Natural And Restored Wetlands | YFIGDPGLQYLSWLGELKLYIVAAAIALVSMPWVASQLDG* |
| Ga0055440_100108432 | 3300004020 | Natural And Restored Wetlands | MNKVIIALMAIYFIGDPGLQYLSWLGELKLYIVAAAIALVSMPWVASQLDG* |
| Ga0055440_101287741 | 3300004020 | Natural And Restored Wetlands | VTERTTMNKVMIALMAIYFLGDPDLQYLAWLGDLKVYLVAAAIALVSMPWIASQLDG* |
| Ga0055449_102070601 | 3300004021 | Natural And Restored Wetlands | MKEATMNKIIITLMAIYFVGDPHLQYLAWLGDLKLYIVAA |
| Ga0055432_100510681 | 3300004022 | Natural And Restored Wetlands | MNKVMIALMAIYFLGDPDLQYLAWLGDLKVYLVAAAIALVSMPWIASQLDG* |
| Ga0055432_100606092 | 3300004022 | Natural And Restored Wetlands | MDKIIITLMAIYFVGDPHLQYLSWLGDMKLYVVAAAIALVSMPWIAEQFDG* |
| Ga0055436_100706842 | 3300004024 | Natural And Restored Wetlands | MNKIIITLTAIYFVGDPHLHYLAWLGDLKLYIVAAAIALVSMPWIVEQLDG* |
| Ga0055444_101160371 | 3300004030 | Natural And Restored Wetlands | MSMNKVIIALMAIYFLGDPGLQYLSWLGDMKLYIVAAAIALVSMPWVASQLDG* |
| Ga0055487_100454931 | 3300004061 | Natural And Restored Wetlands | MNKIIITLMAIYFVGDPHLQYLAWLGDLKLYIVAAAIALMSMPWIAEQLDG* |
| Ga0055500_100229702 | 3300004062 | Natural And Restored Wetlands | MNKVIVALMAIYFIGDPGLQYLAWLGELKVYIVAGAIALISMPWIASQLDG* |
| Ga0055479_103598452 | 3300004064 | Natural And Restored Wetlands | MNKMIIALMAIYFMGDPGLQYLAWLGELKVYIVAAAIALVSMPWIA |
| Ga0055484_100225492 | 3300004066 | Natural And Restored Wetlands | MNKIIITLMAIYFVGDPHLQYLAWLGDLKIYIVAAAIALVSMPWIVEQLDG* |
| Ga0055484_101775471 | 3300004066 | Natural And Restored Wetlands | MNKVMIALMAIYFLGDPDLHYLAWLGDLKVYLVAAAIALVSMPWIASQLDG* |
| Ga0055488_101283371 | 3300004070 | Natural And Restored Wetlands | MERTTMNKVIIALMAIYFLGDPDLQYLAWLGDLKVYLVAAAIA |
| Ga0055488_102329381 | 3300004070 | Natural And Restored Wetlands | RIMNKVIIALMAIYFIGDPGLQYLAWLGELKVYIVAAAIALVSMPWIASQLDG* |
| Ga0055486_100190073 | 3300004071 | Natural And Restored Wetlands | MNKIIIGLMAIYFVGDPHLQYLSWLGDMKLYIVAAAIALVSMPWIAEQFDG* |
| Ga0055486_100336632 | 3300004071 | Natural And Restored Wetlands | MKLQLVKERNMNKVMIALMAIYFLGDPDLQYLAWLGDLKVYLVAAAIALVSMPWIASQLDG* |
| Ga0055486_100655261 | 3300004071 | Natural And Restored Wetlands | KIIITLMAIYFVGDPHLQYLAWLGDLKLYIVAAAIALVSMPWIVEQLDG* |
| Ga0055486_101481631 | 3300004071 | Natural And Restored Wetlands | MNRIIIVLMAIYFLGDPDLQYLSWLGDLKIYVVVAALSLVSMPWIASQLDG* |
| Ga0055523_100957941 | 3300004077 | Natural And Restored Wetlands | MNKIIITLMAIYFVGDPHLQYLAWLGDLKLYVVAAALALVSMPW |
| Ga0055489_100994602 | 3300004145 | Natural And Restored Wetlands | MNKVIIALMAIYFLGDPDLQYLAWLGDLKVYLVAAAIALVSMPWIASQLDG* |
| Ga0055489_101246652 | 3300004145 | Natural And Restored Wetlands | MKKIIIALMAIYFLGDPDLQYLSWLGDLKIYVIAAALSLVSIPWIASQLDG* |
| Ga0055489_102867692 | 3300004145 | Natural And Restored Wetlands | MNKVIIALMAIYFIGDPGLHYLAWLGDLKVYIVAAAIALVSMPWIASQLDG* |
| Ga0055521_102423241 | 3300004148 | Natural And Restored Wetlands | LMAIYFVGDPHLQYLAWLGDLKLYIVAAAIALVSMPWIAEQLDG* |
| Ga0068997_100633152 | 3300005204 | Natural And Restored Wetlands | MNKIIITLMAIYFVGDPHLQYLAWLGDLKLYVVAAAIALVSMPWIAEQLDG* |
| Ga0068999_100194171 | 3300005205 | Natural And Restored Wetlands | MNKIIIALMAIYFLGDPDLQYLAWLGELKVYIIAAAIALVSMPWIASQLDG* |
| Ga0068999_100326491 | 3300005205 | Natural And Restored Wetlands | MECIMNKVIVALMAIYFIGDPGLQYLAWLGELKVYIVAGAIALISMPWIASQLDG* |
| Ga0068994_101679601 | 3300005216 | Natural And Restored Wetlands | ITLMAIYFVGDPHLQYLAWLGDLKIYIVAAAIALVSMPWIVEQLDG* |
| Ga0068996_100607032 | 3300005218 | Natural And Restored Wetlands | MDKIIITLMAIYFVGDPHLQYLSWLGDMKLYVVAAAIALVSMPWIVEQLDG* |
| Ga0068996_101940312 | 3300005218 | Natural And Restored Wetlands | MNKVIIALMAIYFIGDPGLQYLSWLGELKIYTVAAAIALVSMPWIASQLDG* |
| Ga0074470_110755642 | 3300005836 | Sediment (Intertidal) | MDKIIITLMAIYFVGDPHLQYLSWLGDMKLYVVAAAIALVSMPWIAEQLDG* |
| Ga0118657_100841053 | 3300009506 | Mangrove Sediment | MKEATMNKIIIALMAIYFLGDPDLQYLSWLGDLKIYVVAAALSLVSIPWIVEQLDG* |
| Ga0118657_104333674 | 3300009506 | Mangrove Sediment | KIIITLMAIYFVGDPHLQYLAWLGDLKLYIVAAAIALVSMPWIAEQLDG* |
| Ga0118657_117050362 | 3300009506 | Mangrove Sediment | VNKIIIGLMAIYFLGDPDLQYLSWLGDLKLYLVAAAIALVSMPWISEQIDG* |
| Ga0118657_117619572 | 3300009506 | Mangrove Sediment | MEATMNKIIIGLLAIYFLGDPHLQYLAWLGDLKIHAVAAALSLVSMPWFASQLDG* |
| Ga0118657_118075771 | 3300009506 | Mangrove Sediment | MNKVLIALMAIYLIGDPGLQYLSWLGDMKVYVVAAAVALVNMPWIASQLDG* |
| Ga0118657_121258301 | 3300009506 | Mangrove Sediment | MNKSIITLMAIYFVGDPHLQYLAWLGDLKLYIVAAAIALVSMPWIAEQLDG* |
| Ga0118657_129162791 | 3300009506 | Mangrove Sediment | MNKVMIALMAIYFIGDPGLQYLSWLGELKLYIVAAAIALVSMPWIASQLDS* |
| Ga0105080_10455482 | 3300009797 | Groundwater Sand | MIMNKVIIALMAIYFLGDPGLQYLAWLGELKIYIVAAAIALVSMPWIASQLDG* |
| Ga0118731_1084068921 | 3300010392 | Marine | FLGDPSLQTLAWLGEMKTYLVAAAIALVSIPFVASQLDG* |
| Ga0137442_10693002 | 3300011414 | Soil | VIYFLGDPGLQYLAWLGALKIYVVAAAITLVSMPWVASQLDG* |
| Ga0075305_10422221 | 3300014295 | Natural And Restored Wetlands | MNKIIIALMAIYFLGDPDLQYLAWLGDMKLYIVAAAIALVSMPWIAEQLDG* |
| Ga0075305_10486033 | 3300014295 | Natural And Restored Wetlands | MNKVIIALMAIYFIGDPGLQYLAWLGELKVYIVAAAIALVSMPWIAS |
| Ga0075306_10661042 | 3300014297 | Natural And Restored Wetlands | MKEATMNKIIITLMAIYFVGDPHLQYLAWLGDLKLYIVAAAIALVSMPWIAEQLDG* |
| Ga0075340_11012811 | 3300014304 | Natural And Restored Wetlands | MNKIIITLMAIYFVGDPHLQYLAWLGDLKLYVVAAALALVSMPWIAEQLDG* |
| Ga0075339_12314161 | 3300014316 | Natural And Restored Wetlands | MNKIIIALMAIYFLGDPDLQYLSWLGDLKIYVVAAALSLVSIPWIVEQLDG* |
| Ga0075343_10192202 | 3300014317 | Natural And Restored Wetlands | KEATMNRIIIVLMAIYFLGDPDLQYLSWLGDLKIYVVVAALSLVSMPWIASQLDG* |
| Ga0075343_10610012 | 3300014317 | Natural And Restored Wetlands | MNKVIIALMAIYFIGDPGLQYLSWLGDLKLYIVAAVIALVSMPWIASQLDG* |
| Ga0075351_11415901 | 3300014318 | Natural And Restored Wetlands | MVMNKLIIALMAIYFLGDPGLQYLAWLGELKIYVVAAAITLVSMPWVASQLDG* |
| Ga0075348_11448591 | 3300014319 | Natural And Restored Wetlands | IITLMAIYFVGDPHLQYLAWLGDLKLYIVAAAIALASMPWIAEQLDG* |
| Ga0075353_12306522 | 3300014321 | Natural And Restored Wetlands | EMVMNKVIIALMAIYFLGDPDMRYLAWLGDLKIYVVAAAITLVSMPWVASQLDG* |
| Ga0075352_11951151 | 3300014324 | Natural And Restored Wetlands | IALMAIYFLGDPDLQYLAWLGDLKVYLVAAAIALVSMPWIASQLDG* |
| Ga0180076_10370952 | 3300014867 | Soil | MVMNKVIIALMVIYFLGDPGLQYLAWLGALKIYVVAAAITLVSMPWVASQLDG* |
| Ga0180084_10650472 | 3300014874 | Soil | MNKMIIALMAIYFLGDPGLQYLAWLGDLKIYVVATAITLVSMPWITSQLDG* |
| Ga0180069_10026773 | 3300014882 | Soil | MNKVIIALMVIYFLGDPGLQYLAWLGDLKIYVVAAAITLVSMPWVASQLDG* |
| Ga0180104_11736821 | 3300014884 | Soil | MVMNNVIIALMAIYFLGDPGLQYLAWLGDLKIYVVATAITLVSMPWITSQLDG* |
| Ga0180063_13006621 | 3300014885 | Soil | MNKIIIALMAIYFLGDPNLQYLAWLGDLKIYVVAAALSLVSMPWIASQLDG* |
| Ga0184629_100235431 | 3300018084 | Groundwater Sediment | MNKVIIALMVIYFLGDPSLQYLAWLGALKIYVVAAAITLVSMPWVASQLDG |
| Ga0184629_100311511 | 3300018084 | Groundwater Sediment | MNKVIIALMVIYFLGDPGLQYLAWLGALKIYVVAAAITLVSMPWVASQLDG |
| Ga0193968_10710372 | 3300019729 | Sediment | MNKVIIALMAIYFMGDPGLQYLAWLGELKVYIVAAAIALVSMPWIASQLDG |
| Ga0210379_101266452 | 3300021081 | Groundwater Sediment | MSATITFLGDPHLLYLAWMCDMKLYLVAAAVALVSMPWITSQLDG |
| Ga0210083_10122091 | 3300025521 | Natural And Restored Wetlands | MNKIIIGLMAIYFVGDPHLQYLSWLGDMKLYIVAAAIALVSMP |
| Ga0210083_10474422 | 3300025521 | Natural And Restored Wetlands | MNKVIIALMAIYFIGDPGLQYLSWLGELKLYIVAAAIALVSMPWVASQLDG |
| Ga0207423_10336412 | 3300025535 | Natural And Restored Wetlands | MDKIIITLMAIYFVGDPHLQYLSWLGDLKLYIVAAAIALVSMPWIVEQLDG |
| Ga0210132_10447821 | 3300025538 | Natural And Restored Wetlands | PSKQQVVTERIMNKVIIALMAIYFIGDPGLQYLSWLGELKLYIVAAAIALVSMPWVASQLDG |
| Ga0210131_10004165 | 3300025551 | Natural And Restored Wetlands | MNKIIIGLMAIYFVGDPHLQYLSWLGDMKLYIVAAAIALVSMPWIAEQFDG |
| Ga0210131_10034072 | 3300025551 | Natural And Restored Wetlands | MNKIIITLMAIYFVGDPHLQYLSWLGDLKLYIVAAAIALVSMPWIAEQFDG |
| Ga0210131_10103231 | 3300025551 | Natural And Restored Wetlands | MAIYFVGDPHLQYLSWLGDLKLYIVAVAIALVSMPWIVEQLDG |
| Ga0210131_10279142 | 3300025551 | Natural And Restored Wetlands | MNKVIIALMAIYFIGDPDLQYLAWLGELKVYIVAAAIALVSMPWIASQLDG |
| Ga0210060_10302022 | 3300025554 | Natural And Restored Wetlands | MNKVIIALMAIYFIGDPGLQYLSWLGELKVYIVAAAIALVSMPWIASQLDG |
| Ga0210060_10720882 | 3300025554 | Natural And Restored Wetlands | MNKIIIALMAIYFLGDPDLQYLAWLGDMRLYIVAAAIAVVSMPWIAEQLDG |
| Ga0210060_11067751 | 3300025554 | Natural And Restored Wetlands | MAIYFVGDPHLQYLAWLGDLKLYIVAAAIALVSMPW |
| Ga0210120_10192292 | 3300025556 | Natural And Restored Wetlands | MNKVIITLMAIYFLGDPDLQYLSWLGDLKLYIVAAAIALVSMPWIAEQLDG |
| Ga0210108_10047821 | 3300025560 | Natural And Restored Wetlands | MDKIIITLMAIYFVGDPHLQYLSWLGDMKLYVVAAAIALVSMPWIVEQLDG |
| Ga0210108_10704152 | 3300025560 | Natural And Restored Wetlands | MNKIIITLMAIYFVGDPHLQYLAWLGDLKLYVVAAAIALVSMPWIAEQLDG |
| Ga0210099_10139853 | 3300025562 | Natural And Restored Wetlands | MAIYFVGDPHLQYLAWLGDLKLYIVAAAIALVSMPWIAEQLDG |
| Ga0210112_10030411 | 3300025563 | Natural And Restored Wetlands | MNKMIIALMAIYFIGDPGLQYLAWLGELKVYIVAAAIALVSMPWIASQLDG |
| Ga0210112_10122821 | 3300025563 | Natural And Restored Wetlands | TIYFLGDPQLHYLAWLGDMKLYIVAAAIALVSMPWIAEQLDG |
| Ga0210112_10153814 | 3300025563 | Natural And Restored Wetlands | VKEATMNKIIIGLMAIYFLGDPDLHYLSWLGDLKLYVVAAAIALVSMPWIAEQLDG |
| Ga0210112_10212432 | 3300025563 | Natural And Restored Wetlands | MNKVIIALMAIYFIGDPGLQYLAWLGELKIYIVAAAIALVSMPWVAAQLDG |
| Ga0210112_10227592 | 3300025563 | Natural And Restored Wetlands | MNKVIIALMAIYFLGDPGLQYLAWLGELKLYIVAAAIALVSMPWIASQLDG |
| Ga0210112_10554392 | 3300025563 | Natural And Restored Wetlands | MSMNKVIIALMAIYFLGDPGLQYLSWLGDMKLYIVAAAIALVSMPWVASQLDG |
| Ga0210112_10938211 | 3300025563 | Natural And Restored Wetlands | KLIIVLMAIYFIGDPGLQYLAWLGELKVYIVAAAIALVSMPWIASQLDG |
| Ga0210112_11219901 | 3300025563 | Natural And Restored Wetlands | MNKVIIALMAIYFIGDPGLQYLSWLGELKIYTVAAAIALVSMPWIASQLDG |
| Ga0210110_10158623 | 3300025565 | Natural And Restored Wetlands | MNKIIIALMAIYFLGDPDLQYLAWLGDLKLYIVAAAIALVSMPWIAEQLDG |
| Ga0210110_10647682 | 3300025565 | Natural And Restored Wetlands | MNKIIITLMAIYFLGDPDLQYLAWLGDLKLYIVAAAIALVSMPWIAEQLDG |
| Ga0210095_11716882 | 3300025568 | Natural And Restored Wetlands | MNKVIIALMAIYFIGDPGLQYLSWLGELKLYIVAAAIALVSMPWIASQLDG |
| Ga0210073_10598061 | 3300025569 | Natural And Restored Wetlands | MNKIIITLMAIYFVGDPHLQYLSWLGDLKLYIVAAAIALVSM |
| Ga0210133_10875062 | 3300025573 | Natural And Restored Wetlands | MNKIIIALMAIYFMGDPDLQYLSWLGDMKLYIVAAAIALVSMPWIAEQLDG |
| Ga0210085_10106122 | 3300025583 | Natural And Restored Wetlands | MNKVIIALMAIYFIGDPGLHYLAWLGELKVYIVAAAIALVSMPWIASQLDG |
| Ga0210085_10151882 | 3300025583 | Natural And Restored Wetlands | MNKIIITLMAIYFVGDPHLQYLAWLGDMKLYIVAAAIALVSMPWIAEQLDG |
| Ga0210085_10171212 | 3300025583 | Natural And Restored Wetlands | MNKSIIALMAIYFLGDPDLEYLSWLGDMKLYIVASAIALVSMPWIAEQLDG |
| Ga0210085_10863372 | 3300025583 | Natural And Restored Wetlands | MNKIIIALMGIYFLGDPDLQYLSWLGDMKLYIVAAAIALVSMPWIAEQLDG |
| Ga0210096_10234151 | 3300025593 | Natural And Restored Wetlands | MNKVMIALMAIYFIGDPGLQYLAWLGELKVYIVAAAIALVSMPWIASQLDG |
| Ga0210074_10049271 | 3300025599 | Natural And Restored Wetlands | YFVGDPHLQYLAWLGDLKLYIVAAAIALVSMPWIAEQLDG |
| Ga0210074_10266652 | 3300025599 | Natural And Restored Wetlands | MNKIIITLMTIYFVGDPHLQYLAWLGDLKLYIVAAAIALVSMPWIAEQLDG |
| Ga0210074_10296972 | 3300025599 | Natural And Restored Wetlands | MNKVIIGLMAIYFIGDPGLQYLAWLGELKVYIVAAAIALVSMPWIASQLDG |
| Ga0210074_10362692 | 3300025599 | Natural And Restored Wetlands | MNKIIITLMAIYFVGDPHLQYLAWLGDLKLYIVAA |
| Ga0210074_11614121 | 3300025599 | Natural And Restored Wetlands | MNKIIITLMAIYFAGDPHLQYLAWLGDLKLYIVAAAIALVSMPWIAEQLDG |
| Ga0210086_10208304 | 3300025615 | Natural And Restored Wetlands | MNKIIITLMAIYFLGDPHLQYLAWLGDLKLYVVAAALALVSMPWIAEQLDG |
| Ga0210065_10037236 | 3300025793 | Natural And Restored Wetlands | LGDPDLQYLAWLGDLKLYIVAAAIALVSMPWIAEQLDG |
| Ga0210065_10113343 | 3300025793 | Natural And Restored Wetlands | ERIMNKVIIALMAIYFIGDPGLQYLAWLGELKVYIVAAAIALVSMPWIASQLDG |
| Ga0210062_10444601 | 3300025797 | Natural And Restored Wetlands | MNKIIITLMAIYFLGDPDLQYLAWLGDLKLYIVAAAIALVSMPW |
| Ga0210062_10797951 | 3300025797 | Natural And Restored Wetlands | MNKIIIALMAIYFLGDPDLQYLAWLGDLKLYIVAAAIALVSMPW |
| Ga0210122_11165341 | 3300025799 | Natural And Restored Wetlands | ATMNKIIITLMAIYFVGDPHLQYLAWLGDLKLYIVAAAIALVSMPWIAEQLDG |
| Ga0210097_10033692 | 3300025801 | Natural And Restored Wetlands | MNKIIIVLMAIYFLGDPHLQYLSWLGDMKLYVVAAAIALVSMPWIAEQLDG |
| Ga0210097_10210913 | 3300025801 | Natural And Restored Wetlands | VNKIIIGLMAIYFLGDPDLQYLSWLGDLKIYVVAAALSLVSMPWIAEQLDG |
| Ga0210097_11236452 | 3300025801 | Natural And Restored Wetlands | MNKVIIALMAIYFIGDPGLQYLAWLGELKMYIVAAAIALVSMPWIAEQLDG |
| Ga0210064_10089434 | 3300025813 | Natural And Restored Wetlands | MNKIIITLMAIYFVGDPHLQYLAWLGDLKLYIVAAAIALVSMPWIAEQL |
| Ga0210064_10217202 | 3300025813 | Natural And Restored Wetlands | MAIYFAGDPHLQYLAWPGDLKLYIVAAAIALVSMPWIAEQLDG |
| Ga0210064_10479561 | 3300025813 | Natural And Restored Wetlands | MAIYFLGDPDLQYLAWLGDLKLYIVAAAIALVSMPWIAEQLDG |
| Ga0210101_10003651 | 3300025814 | Natural And Restored Wetlands | YFLGDPDLQYLAWLGDLKLYIVAAAIALVSMPWIAEQLDG |
| Ga0210125_10890051 | 3300025943 | Natural And Restored Wetlands | MNKLIMALMAIYFIGDPGLQYLAWLGELKVYAVAAAVALVSMPWIASQLDG |
| Ga0210067_10005282 | 3300025947 | Natural And Restored Wetlands | MNKIIITLMAIYFVGDPHLQYLAWLGDLKLYIVAAAIALVSMPWIAEQLDG |
| Ga0210067_10114792 | 3300025947 | Natural And Restored Wetlands | MNKIIITLMAIYFVGDPHLQYLSWLGDLKLYIVAAAIALVSMPWIVEQLDG |
| Ga0210067_10242441 | 3300025947 | Natural And Restored Wetlands | MNKVIIALMAIYFLGDPDLQYLAWLGDLKVYLVAAAIALVSMPWIASQLDG |
| Ga0210067_10325662 | 3300025947 | Natural And Restored Wetlands | PGLQYLAWLGELKVYIVAAAIALVSMPWIASQLDG |
| Ga0210088_10443442 | 3300025948 | Natural And Restored Wetlands | MNKIIITLMAIYFVGDPHLQYLAWLGDLKIYIVAAAIALVSMPWIVEQLDG |
| Ga0210068_10543582 | 3300025953 | Natural And Restored Wetlands | MNKIIITLMAIYFVGDPHLQYLAWLGDLKLYVVAAALALVSMPWIAEQLDG |
| Ga0210117_10085991 | 3300025985 | Natural And Restored Wetlands | FVGDPHLQYLSWLGDMKLYVVAAAIALVSMPWIVEQLDG |
| Ga0210124_10246414 | 3300026007 | Natural And Restored Wetlands | LMAIYFVGDPHLQYLAWLGDLKLYIVAAAIALVSMPWIAEQLDG |
| Ga0209900_10209061 | 3300026888 | Groundwater Sand | MVMNKVIIALMAIYFLGDPDMQYLAWLGDLKIYVVAAAITLVSMPWVASQLDG |
| Ga0307281_100252612 | 3300028803 | Soil | MSATITFLGDPHLLYLAWMGDMKLYLVAAAVALVSMPWITSQLDG |
| Ga0134606_102484211 | 3300029827 | Marine Sediment | MNKVIIALMAIYFLGDPGLQYLAWLGEMKLYIVAAAIALVSMPWIVDQIDG |
| Ga0134606_102854352 | 3300029827 | Marine Sediment | VNKIIIGLMAIYFLGDPDLQYLSWLGDLKLYVVAAALSLVSMPWIASQLDG |
| Ga0315556_10551912 | 3300031256 | Salt Marsh Sediment | MNKIIIAMMAIYFLGDPDLQYLSCLVDLKLYIVAAVVALVTMPWIAEQLDG |
| Ga0315556_11821131 | 3300031256 | Salt Marsh Sediment | MSMNKVIIALMAIYFLGDPGLQYLSWLGDMKLYIVAAAIALVSMPWIASQLDG |
| Ga0315556_11950672 | 3300031256 | Salt Marsh Sediment | MNKIIIALLAIYFLGDPDLQYLSWLGDLKLYIVAAAIALVSMPWIAEQLDG |
| Ga0315534_12569311 | 3300031585 | Salt Marsh Sediment | MNKLIIALMAIYVIGDPGLQYLAWLGELKVYIVAAAIAAVSMPWIASQLDG |
| Ga0316575_100139761 | 3300031665 | Rhizosphere | VNKIIITLMAIYFAGDPHLQYLAWLGDLKLYIVAAAIALVSMPWIAEQLDG |
| Ga0316575_100223412 | 3300031665 | Rhizosphere | MNKMIIALMAIYFIGDPGLQYLAWLGELKVYIVAATIALVSMPWIASQLDG |
| Ga0316575_101022601 | 3300031665 | Rhizosphere | VNKIIIGLMAIYFLGDPDLQYLSWLGDLKLYLVAAAIALVSMPWISEQIDG |
| Ga0316575_102303922 | 3300031665 | Rhizosphere | MNKVIIALMAIYFLGDPGLQYLAWLGELKPYIVAAAIALVSMPWIASQLDG |
| Ga0316575_103723961 | 3300031665 | Rhizosphere | MNKIIITLMAIYFVGDPHLQYLAWLGDLKLYIVAAAI |
| Ga0316575_104293721 | 3300031665 | Rhizosphere | METSMNKVIIALMAIYLIGDPGLQYLAWLGELKLYIVATAIALVSMPWIASKLDG |
| Ga0316579_100437894 | 3300031691 | Rhizosphere | EHLEATMNKIIIALMAIYFLGDPDLQYLAWLGDLKLYIVAAAIALVSMPWIAEQLDG |
| Ga0316579_101300963 | 3300031691 | Rhizosphere | MNKIIITLMAIYFVGDPHLQYLAWLGDLKLYVVAAALALVPMPWIAE |
| Ga0316579_101741392 | 3300031691 | Rhizosphere | ITLMAIYFAGDPHLQYLAWLGDLKLYIVAAAIALVSMPWIAEQLDG |
| Ga0316579_102355321 | 3300031691 | Rhizosphere | MNKLIIALMTIYFLGDPQLHYLAWLGDMKLYLVAAAIALVSMPWIAEQIDG |
| Ga0316576_101536032 | 3300031727 | Rhizosphere | MMNKVIIALMAIYFIGDPGLQYLSWLGDLKLYFVAAAIALVSMPWVASQLDG |
| Ga0316576_106376752 | 3300031727 | Rhizosphere | MNKIVITLMAIYFLGDPDMHYLSWLGDLKLYVVAASIALVTMPWITAQLDG |
| Ga0316576_113423872 | 3300031727 | Rhizosphere | RIMNKLIIALMAIYFIGDPGLQYLAWLGELKVYIVAAAIALVSMPWIASQLDG |
| Ga0316578_102385993 | 3300031728 | Rhizosphere | IYFVGDPDLQYLAWLGDLKLYVVAAALALVSMPWIAEQLDG |
| Ga0316578_103944192 | 3300031728 | Rhizosphere | MNKIIIALMAIYFLGDPGLQYLSWLGDLKIYVVAAALALVSMPWIAEQLDG |
| Ga0316578_104323601 | 3300031728 | Rhizosphere | MNKIMIGLMAIYFLGDPQLHYLAWFGDMKLYLVAAAIALVSMPWI |
| Ga0316578_107137091 | 3300031728 | Rhizosphere | IMNKVIIALMAIYFIGDPGLQYLAWLGELKVYIVAAAIALVSMPWIASQLDG |
| Ga0316578_108077901 | 3300031728 | Rhizosphere | MNKVIIALMAIYFIGDPGLQYLSWLGDLKLYFVAAAIALVSMPWVASQLDG |
| Ga0316577_103728772 | 3300031733 | Rhizosphere | TMNKLIIALMAVYFLGDPGLHYLAWLGGMKVYIISAAIALVSMPWITSQLDG |
| Ga0315540_101021632 | 3300032061 | Salt Marsh Sediment | MNKLIIALMTIYFLGDPQLHYLAWLGDMKLYLVAAAIALVSMPWIADQIDG |
| Ga0315540_104092571 | 3300032061 | Salt Marsh Sediment | GVSYFVGDPDLQYLAWLGDLKLYLVAAAIALVSMPWIAEQIDG |
| Ga0315540_104613851 | 3300032061 | Salt Marsh Sediment | MNKVIIALMAIYFIGDPDLQYLAWLGDLKVYIVAAAIALVSMPWITAQLDG |
| Ga0316583_100287092 | 3300032133 | Rhizosphere | MNKIMIGLMAIYFLGDPQLHYLAWFGDMKLYLVAAAIALVSMPWITSQLDG |
| Ga0316583_100297694 | 3300032133 | Rhizosphere | VKEATMNKIIITLMAIYFVGDPHLQYLAWLGDLKLYIVAAAIALVSMPWIAEQLDG |
| Ga0316583_100555012 | 3300032133 | Rhizosphere | MKEATMNKLIIALMTIYFLGDPQLHYLAWLGDMKLYLVAAAIALVSMPWIADQIDG |
| Ga0316585_101804722 | 3300032137 | Rhizosphere | MNKIIITLMAIYFVGDPHLQYLAWLGDLKLYIVAAAIALVSMPWI |
| Ga0316580_100582801 | 3300032139 | Rhizosphere | MNKIIITLMAIYFVGDPHLQYLAWLGDLKLYVVAAALALV |
| Ga0316580_101654942 | 3300032139 | Rhizosphere | QQVVTERIMNKVIIALMAIYFIGDPGLQYLAWLGELKVYIVAAAIALVSMPWIASQLDG |
| Ga0307417_103582901 | 3300033291 | Salt Marsh | MNKIIITLMTIYFVGDPHLQYLAWLGDLKLYIVAAALALVSMPWIAEQLDG |
| ⦗Top⦘ |