| Basic Information | |
|---|---|
| Family ID | F028017 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 193 |
| Average Sequence Length | 41 residues |
| Representative Sequence | YLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI |
| Number of Associated Samples | 143 |
| Number of Associated Scaffolds | 193 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 92.75 % |
| Associated GOLD sequencing projects | 134 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.373 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (11.399 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.943 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (45.596 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 5.88% β-sheet: 22.06% Coil/Unstructured: 72.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 193 Family Scaffolds |
|---|---|---|
| PF13302 | Acetyltransf_3 | 7.77 |
| PF01636 | APH | 2.07 |
| PF07883 | Cupin_2 | 2.07 |
| PF01098 | FTSW_RODA_SPOVE | 2.07 |
| PF07366 | SnoaL | 2.07 |
| PF00211 | Guanylate_cyc | 1.55 |
| PF04828 | GFA | 1.55 |
| PF00368 | HMG-CoA_red | 1.04 |
| PF00561 | Abhydrolase_1 | 1.04 |
| PF10604 | Polyketide_cyc2 | 1.04 |
| PF02687 | FtsX | 1.04 |
| PF02518 | HATPase_c | 1.04 |
| PF14333 | DUF4389 | 1.04 |
| PF00892 | EamA | 1.04 |
| PF01965 | DJ-1_PfpI | 1.04 |
| PF00571 | CBS | 1.04 |
| PF12802 | MarR_2 | 1.04 |
| PF06736 | TMEM175 | 1.04 |
| PF02746 | MR_MLE_N | 0.52 |
| PF01872 | RibD_C | 0.52 |
| PF01709 | Transcrip_reg | 0.52 |
| PF13649 | Methyltransf_25 | 0.52 |
| PF13673 | Acetyltransf_10 | 0.52 |
| PF13460 | NAD_binding_10 | 0.52 |
| PF01061 | ABC2_membrane | 0.52 |
| PF00248 | Aldo_ket_red | 0.52 |
| PF01521 | Fe-S_biosyn | 0.52 |
| PF10947 | DUF2628 | 0.52 |
| PF03807 | F420_oxidored | 0.52 |
| PF00589 | Phage_integrase | 0.52 |
| PF12697 | Abhydrolase_6 | 0.52 |
| PF08240 | ADH_N | 0.52 |
| PF07690 | MFS_1 | 0.52 |
| PF00441 | Acyl-CoA_dh_1 | 0.52 |
| PF01544 | CorA | 0.52 |
| PF13669 | Glyoxalase_4 | 0.52 |
| PF00884 | Sulfatase | 0.52 |
| PF01047 | MarR | 0.52 |
| PF08530 | PepX_C | 0.52 |
| PF07040 | DUF1326 | 0.52 |
| PF03466 | LysR_substrate | 0.52 |
| PF03681 | Obsolete Pfam Family | 0.52 |
| PF00072 | Response_reg | 0.52 |
| PF00106 | adh_short | 0.52 |
| PF00756 | Esterase | 0.52 |
| PF13091 | PLDc_2 | 0.52 |
| PF13561 | adh_short_C2 | 0.52 |
| PF00293 | NUDIX | 0.52 |
| PF03551 | PadR | 0.52 |
| PF08281 | Sigma70_r4_2 | 0.52 |
| PF00583 | Acetyltransf_1 | 0.52 |
| PF08220 | HTH_DeoR | 0.52 |
| PF14022 | DUF4238 | 0.52 |
| PF01230 | HIT | 0.52 |
| PF12680 | SnoaL_2 | 0.52 |
| PF01019 | G_glu_transpept | 0.52 |
| PF00903 | Glyoxalase | 0.52 |
| PF13602 | ADH_zinc_N_2 | 0.52 |
| PF03050 | DDE_Tnp_IS66 | 0.52 |
| PF01209 | Ubie_methyltran | 0.52 |
| PF13189 | Cytidylate_kin2 | 0.52 |
| PF03176 | MMPL | 0.52 |
| PF12146 | Hydrolase_4 | 0.52 |
| PF03992 | ABM | 0.52 |
| COG ID | Name | Functional Category | % Frequency in 193 Family Scaffolds |
|---|---|---|---|
| COG0772 | Peptodoglycan polymerase FtsW/RodA/SpoVE | Cell cycle control, cell division, chromosome partitioning [D] | 2.07 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 1.55 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 1.55 |
| COG4948 | L-alanine-DL-glutamate epimerase or related enzyme of enolase superfamily | Cell wall/membrane/envelope biogenesis [M] | 1.04 |
| COG3548 | Uncharacterized membrane protein | Function unknown [S] | 1.04 |
| COG1257 | Hydroxymethylglutaryl-CoA reductase | Lipid transport and metabolism [I] | 1.04 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.52 |
| COG5588 | Uncharacterized conserved protein, DUF1326 domain | Function unknown [S] | 0.52 |
| COG4841 | Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF family | Function unknown [S] | 0.52 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.52 |
| COG2936 | Predicted acyl esterase | General function prediction only [R] | 0.52 |
| COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 0.52 |
| COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 0.52 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.52 |
| COG0217 | Transcriptional and/or translational regulatory protein YebC/TACO1 | Translation, ribosomal structure and biogenesis [J] | 0.52 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.52 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.52 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.52 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.52 |
| COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 0.52 |
| COG0598 | Mg2+ and Co2+ transporter CorA | Inorganic ion transport and metabolism [P] | 0.52 |
| COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 0.52 |
| COG0316 | Fe-S cluster assembly iron-binding protein IscA | Posttranslational modification, protein turnover, chaperones [O] | 0.52 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.52 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.89 % |
| Unclassified | root | N/A | 3.11 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459003|FZ032L002G4KX2 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 516 | Open in IMG/M |
| 3300004479|Ga0062595_100089732 | All Organisms → cellular organisms → Bacteria | 1591 | Open in IMG/M |
| 3300004479|Ga0062595_101633256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 603 | Open in IMG/M |
| 3300005184|Ga0066671_10028218 | All Organisms → cellular organisms → Bacteria | 2596 | Open in IMG/M |
| 3300005329|Ga0070683_100910949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 843 | Open in IMG/M |
| 3300005331|Ga0070670_100232192 | All Organisms → cellular organisms → Bacteria | 1605 | Open in IMG/M |
| 3300005332|Ga0066388_102258771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 983 | Open in IMG/M |
| 3300005337|Ga0070682_100128036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1714 | Open in IMG/M |
| 3300005435|Ga0070714_100172817 | All Organisms → cellular organisms → Bacteria | 1962 | Open in IMG/M |
| 3300005435|Ga0070714_100899164 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300005454|Ga0066687_10186623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1123 | Open in IMG/M |
| 3300005526|Ga0073909_10459783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 609 | Open in IMG/M |
| 3300005529|Ga0070741_11224269 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300005530|Ga0070679_101770816 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 566 | Open in IMG/M |
| 3300005530|Ga0070679_101987131 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300005536|Ga0070697_101099662 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300005540|Ga0066697_10435224 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300005549|Ga0070704_101702545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 582 | Open in IMG/M |
| 3300005552|Ga0066701_10510235 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 743 | Open in IMG/M |
| 3300005561|Ga0066699_10644644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 759 | Open in IMG/M |
| 3300005561|Ga0066699_11231553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 513 | Open in IMG/M |
| 3300005569|Ga0066705_10568146 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300005577|Ga0068857_100641949 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
| 3300005764|Ga0066903_101149843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1436 | Open in IMG/M |
| 3300005764|Ga0066903_104680846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 728 | Open in IMG/M |
| 3300005764|Ga0066903_105521713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 666 | Open in IMG/M |
| 3300006031|Ga0066651_10506575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 639 | Open in IMG/M |
| 3300006032|Ga0066696_10558186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 747 | Open in IMG/M |
| 3300006058|Ga0075432_10253740 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 715 | Open in IMG/M |
| 3300006163|Ga0070715_10007085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3843 | Open in IMG/M |
| 3300006163|Ga0070715_10496878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 697 | Open in IMG/M |
| 3300006175|Ga0070712_100136177 | All Organisms → cellular organisms → Bacteria | 1868 | Open in IMG/M |
| 3300006175|Ga0070712_101919365 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300006579|Ga0074054_12180644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 600 | Open in IMG/M |
| 3300006606|Ga0074062_12997004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 546 | Open in IMG/M |
| 3300006791|Ga0066653_10638573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 544 | Open in IMG/M |
| 3300006797|Ga0066659_11197133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 634 | Open in IMG/M |
| 3300006806|Ga0079220_10061887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1810 | Open in IMG/M |
| 3300006806|Ga0079220_10761169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 724 | Open in IMG/M |
| 3300006806|Ga0079220_11691648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 553 | Open in IMG/M |
| 3300006854|Ga0075425_100178069 | All Organisms → cellular organisms → Bacteria | 2441 | Open in IMG/M |
| 3300006854|Ga0075425_100926759 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| 3300006854|Ga0075425_101514087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 757 | Open in IMG/M |
| 3300006854|Ga0075425_103058637 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300006904|Ga0075424_102862847 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300009012|Ga0066710_100538395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1765 | Open in IMG/M |
| 3300009038|Ga0099829_11106603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 657 | Open in IMG/M |
| 3300009092|Ga0105250_10226392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 794 | Open in IMG/M |
| 3300009093|Ga0105240_11423711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 728 | Open in IMG/M |
| 3300009094|Ga0111539_10884791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1039 | Open in IMG/M |
| 3300009098|Ga0105245_11475730 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300009101|Ga0105247_10396524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 982 | Open in IMG/M |
| 3300009137|Ga0066709_100265923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae | 2307 | Open in IMG/M |
| 3300009137|Ga0066709_103638727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 559 | Open in IMG/M |
| 3300009147|Ga0114129_12327552 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300009148|Ga0105243_11550160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 688 | Open in IMG/M |
| 3300009148|Ga0105243_12026190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 610 | Open in IMG/M |
| 3300009156|Ga0111538_12140895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 703 | Open in IMG/M |
| 3300009162|Ga0075423_10155562 | All Organisms → cellular organisms → Bacteria | 2400 | Open in IMG/M |
| 3300009162|Ga0075423_10999345 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
| 3300009176|Ga0105242_12262652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 589 | Open in IMG/M |
| 3300009545|Ga0105237_11282236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 739 | Open in IMG/M |
| 3300009553|Ga0105249_12719755 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 567 | Open in IMG/M |
| 3300010136|Ga0127447_1177988 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 805 | Open in IMG/M |
| 3300010322|Ga0134084_10452633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 511 | Open in IMG/M |
| 3300010326|Ga0134065_10335983 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300010358|Ga0126370_12556789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 510 | Open in IMG/M |
| 3300010359|Ga0126376_11674278 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 670 | Open in IMG/M |
| 3300010360|Ga0126372_12400824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 578 | Open in IMG/M |
| 3300010366|Ga0126379_10733146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1084 | Open in IMG/M |
| 3300010366|Ga0126379_11526847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 773 | Open in IMG/M |
| 3300010366|Ga0126379_13546696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 523 | Open in IMG/M |
| 3300010371|Ga0134125_12698547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 540 | Open in IMG/M |
| 3300010373|Ga0134128_10132581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2822 | Open in IMG/M |
| 3300010373|Ga0134128_10158989 | All Organisms → cellular organisms → Bacteria | 2553 | Open in IMG/M |
| 3300010373|Ga0134128_11091820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 881 | Open in IMG/M |
| 3300010375|Ga0105239_10719114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1142 | Open in IMG/M |
| 3300010375|Ga0105239_11187445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 879 | Open in IMG/M |
| 3300010396|Ga0134126_10481773 | All Organisms → cellular organisms → Bacteria | 1432 | Open in IMG/M |
| 3300010396|Ga0134126_10671028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1180 | Open in IMG/M |
| 3300010396|Ga0134126_11511979 | Not Available | 740 | Open in IMG/M |
| 3300010398|Ga0126383_12934416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 557 | Open in IMG/M |
| 3300010398|Ga0126383_13580619 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 507 | Open in IMG/M |
| 3300010399|Ga0134127_11209238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 823 | Open in IMG/M |
| 3300010403|Ga0134123_10223853 | All Organisms → cellular organisms → Bacteria | 1618 | Open in IMG/M |
| 3300011119|Ga0105246_10662051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 910 | Open in IMG/M |
| 3300011119|Ga0105246_12588890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 501 | Open in IMG/M |
| 3300012198|Ga0137364_10603545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 827 | Open in IMG/M |
| 3300012200|Ga0137382_10213265 | All Organisms → Viruses → Predicted Viral | 1330 | Open in IMG/M |
| 3300012208|Ga0137376_10190848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1771 | Open in IMG/M |
| 3300012211|Ga0137377_11158951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 703 | Open in IMG/M |
| 3300012211|Ga0137377_11553056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 587 | Open in IMG/M |
| 3300012285|Ga0137370_10537314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 718 | Open in IMG/M |
| 3300012285|Ga0137370_10683212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 638 | Open in IMG/M |
| 3300012349|Ga0137387_10217091 | All Organisms → cellular organisms → Bacteria | 1375 | Open in IMG/M |
| 3300012349|Ga0137387_10734124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 714 | Open in IMG/M |
| 3300012896|Ga0157303_10158639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 615 | Open in IMG/M |
| 3300012911|Ga0157301_10293488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 590 | Open in IMG/M |
| 3300012943|Ga0164241_10705822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 732 | Open in IMG/M |
| 3300012958|Ga0164299_11056294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 603 | Open in IMG/M |
| 3300012958|Ga0164299_11358741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 547 | Open in IMG/M |
| 3300012961|Ga0164302_10339336 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
| 3300012971|Ga0126369_10526135 | All Organisms → cellular organisms → Bacteria | 1244 | Open in IMG/M |
| 3300012975|Ga0134110_10389688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 616 | Open in IMG/M |
| 3300012984|Ga0164309_10203996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1362 | Open in IMG/M |
| 3300012984|Ga0164309_10307010 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
| 3300012984|Ga0164309_10679995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 814 | Open in IMG/M |
| 3300012984|Ga0164309_10714177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 797 | Open in IMG/M |
| 3300012985|Ga0164308_12012794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 538 | Open in IMG/M |
| 3300012987|Ga0164307_10411202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1000 | Open in IMG/M |
| 3300012987|Ga0164307_10469962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides guangzhouensis | 943 | Open in IMG/M |
| 3300013104|Ga0157370_11377631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes subtropicus | 635 | Open in IMG/M |
| 3300013105|Ga0157369_10450098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1333 | Open in IMG/M |
| 3300013296|Ga0157374_11369586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 730 | Open in IMG/M |
| 3300013297|Ga0157378_13262209 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300013307|Ga0157372_10489529 | All Organisms → cellular organisms → Bacteria | 1434 | Open in IMG/M |
| 3300013307|Ga0157372_11826451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 699 | Open in IMG/M |
| 3300014150|Ga0134081_10097300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 924 | Open in IMG/M |
| 3300014150|Ga0134081_10283984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 589 | Open in IMG/M |
| 3300014325|Ga0163163_10351842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1529 | Open in IMG/M |
| 3300014325|Ga0163163_10376665 | All Organisms → cellular organisms → Bacteria | 1477 | Open in IMG/M |
| 3300014325|Ga0163163_12794210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 545 | Open in IMG/M |
| 3300014968|Ga0157379_12380093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 528 | Open in IMG/M |
| 3300015077|Ga0173483_10307730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 779 | Open in IMG/M |
| 3300015077|Ga0173483_10310661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 776 | Open in IMG/M |
| 3300015356|Ga0134073_10195424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 668 | Open in IMG/M |
| 3300015371|Ga0132258_10806899 | All Organisms → cellular organisms → Bacteria | 2366 | Open in IMG/M |
| 3300015372|Ga0132256_102699764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 596 | Open in IMG/M |
| 3300015373|Ga0132257_100140148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2825 | Open in IMG/M |
| 3300015373|Ga0132257_100258654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2081 | Open in IMG/M |
| 3300015373|Ga0132257_101903393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 765 | Open in IMG/M |
| 3300015374|Ga0132255_100291191 | All Organisms → cellular organisms → Bacteria | 2347 | Open in IMG/M |
| 3300015374|Ga0132255_101705242 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300015374|Ga0132255_102616400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 771 | Open in IMG/M |
| 3300017966|Ga0187776_10335502 | Not Available | 993 | Open in IMG/M |
| 3300018032|Ga0187788_10504433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 523 | Open in IMG/M |
| 3300018064|Ga0187773_11017175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 544 | Open in IMG/M |
| 3300018433|Ga0066667_10205069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1453 | Open in IMG/M |
| 3300018433|Ga0066667_10808464 | Not Available | 798 | Open in IMG/M |
| 3300018433|Ga0066667_10956391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 738 | Open in IMG/M |
| 3300018468|Ga0066662_12139234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 587 | Open in IMG/M |
| 3300018482|Ga0066669_11243701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 672 | Open in IMG/M |
| 3300019767|Ga0190267_10059590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1351 | Open in IMG/M |
| 3300025898|Ga0207692_10585636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 716 | Open in IMG/M |
| 3300025899|Ga0207642_10134406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1295 | Open in IMG/M |
| 3300025904|Ga0207647_10676439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 564 | Open in IMG/M |
| 3300025905|Ga0207685_10011874 | All Organisms → cellular organisms → Bacteria | 2638 | Open in IMG/M |
| 3300025910|Ga0207684_10592702 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300025915|Ga0207693_10387647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1092 | Open in IMG/M |
| 3300025915|Ga0207693_10799285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 727 | Open in IMG/M |
| 3300025916|Ga0207663_11497145 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 543 | Open in IMG/M |
| 3300025919|Ga0207657_10710016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 781 | Open in IMG/M |
| 3300025922|Ga0207646_10205069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1781 | Open in IMG/M |
| 3300025923|Ga0207681_11084012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 673 | Open in IMG/M |
| 3300025927|Ga0207687_10287238 | All Organisms → cellular organisms → Bacteria | 1321 | Open in IMG/M |
| 3300025927|Ga0207687_11070446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 692 | Open in IMG/M |
| 3300025927|Ga0207687_11872130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 513 | Open in IMG/M |
| 3300025929|Ga0207664_10625997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 967 | Open in IMG/M |
| 3300025939|Ga0207665_11464234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 543 | Open in IMG/M |
| 3300025944|Ga0207661_10316784 | Not Available | 1401 | Open in IMG/M |
| 3300025960|Ga0207651_10938210 | Not Available | 772 | Open in IMG/M |
| 3300025972|Ga0207668_10450577 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
| 3300026078|Ga0207702_12124029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 551 | Open in IMG/M |
| 3300026121|Ga0207683_11833842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 555 | Open in IMG/M |
| 3300026295|Ga0209234_1043381 | All Organisms → cellular organisms → Bacteria | 1710 | Open in IMG/M |
| 3300026532|Ga0209160_1340892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 513 | Open in IMG/M |
| 3300026542|Ga0209805_1290464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 622 | Open in IMG/M |
| 3300026548|Ga0209161_10486281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 545 | Open in IMG/M |
| 3300027465|Ga0207626_102677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 624 | Open in IMG/M |
| 3300027821|Ga0209811_10010630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2957 | Open in IMG/M |
| 3300027842|Ga0209580_10203345 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300028790|Ga0307283_10045066 | Not Available | 1034 | Open in IMG/M |
| 3300031184|Ga0307499_10161394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → Gaiella occulta | 665 | Open in IMG/M |
| 3300031544|Ga0318534_10408885 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300031682|Ga0318560_10695294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 550 | Open in IMG/M |
| 3300031716|Ga0310813_11492652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes subtropicus | 629 | Open in IMG/M |
| 3300031716|Ga0310813_11803585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 575 | Open in IMG/M |
| 3300031716|Ga0310813_12320050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 509 | Open in IMG/M |
| 3300031765|Ga0318554_10262703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 983 | Open in IMG/M |
| 3300031778|Ga0318498_10486849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 544 | Open in IMG/M |
| 3300031832|Ga0318499_10419661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 511 | Open in IMG/M |
| 3300031847|Ga0310907_10313420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 794 | Open in IMG/M |
| 3300031858|Ga0310892_10355308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 941 | Open in IMG/M |
| 3300031879|Ga0306919_11533661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 501 | Open in IMG/M |
| 3300031890|Ga0306925_10508599 | All Organisms → cellular organisms → Bacteria | 1282 | Open in IMG/M |
| 3300031938|Ga0308175_100160428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2168 | Open in IMG/M |
| 3300031939|Ga0308174_11557620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 567 | Open in IMG/M |
| 3300031939|Ga0308174_11692002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 543 | Open in IMG/M |
| 3300031944|Ga0310884_10470366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 734 | Open in IMG/M |
| 3300032075|Ga0310890_10345239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1086 | Open in IMG/M |
| 3300032180|Ga0307471_103326309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 570 | Open in IMG/M |
| 3300033412|Ga0310810_11448557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 517 | Open in IMG/M |
| 3300034268|Ga0372943_0159256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1378 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.25% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.25% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.70% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.18% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.66% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.66% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.66% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.66% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.63% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.11% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.59% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.07% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.07% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.07% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.07% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.07% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.55% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.55% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.55% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.55% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.55% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 1.55% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.04% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.04% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.04% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.52% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.52% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.52% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.52% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010136 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012943 | Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY) | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027465 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-BECK03-A (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028790 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122 | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E4A_10072850 | 2170459003 | Grass Soil | FGCYLRSQPWGMVVLTLSGSKVDEITFFADPALPGRFGLPEHI |
| Ga0062595_1000897321 | 3300004479 | Soil | LRSQPWGMIVLTLSGSKVDEITFFADPALPGRFGLPAHI* |
| Ga0062595_1016332561 | 3300004479 | Soil | YLRSQPRGMIVLTLNGSKVDEITFFADPALVGRFGLPEHI* |
| Ga0066671_100282186 | 3300005184 | Soil | PAFGYYLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI* |
| Ga0070683_1009109492 | 3300005329 | Corn Rhizosphere | FGCYLRSQPWGMMVLTLSGSKVDEITFFADPALPSRFGLPEHI* |
| Ga0070670_1002321921 | 3300005331 | Switchgrass Rhizosphere | LRSQPWGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI* |
| Ga0066388_1022587714 | 3300005332 | Tropical Forest Soil | AFGCYLRSQPWGMMVLTLSGSKVDEITLFADPALPGRFGLPAHI* |
| Ga0070682_1001280361 | 3300005337 | Corn Rhizosphere | GYYLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI* |
| Ga0070714_1001728172 | 3300005435 | Agricultural Soil | FGCYLRSQPWGMMVLALSGSKVDEITLFVDPALPSRFGLPEHI* |
| Ga0070714_1008991641 | 3300005435 | Agricultural Soil | YYLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI* |
| Ga0066687_101866231 | 3300005454 | Soil | YYLRSQPRGMMVLTLSGSKVDEITYFADPALPGRFGLPEYI* |
| Ga0073909_104597831 | 3300005526 | Surface Soil | LRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPGHI* |
| Ga0070741_112242692 | 3300005529 | Surface Soil | AQPWGMIVLTLSGRKVDEMTFFADPALPVRFGLPEHI* |
| Ga0070679_1017708163 | 3300005530 | Corn Rhizosphere | AFGYYLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFDLPEHI* |
| Ga0070679_1019871312 | 3300005530 | Corn Rhizosphere | FGYYLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI* |
| Ga0070697_1010996622 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | RSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHIQPTRMGST* |
| Ga0066697_104352241 | 3300005540 | Soil | YLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI* |
| Ga0070704_1017025451 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | AFGYYLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI* |
| Ga0066701_105102351 | 3300005552 | Soil | SRPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI* |
| Ga0066699_106446442 | 3300005561 | Soil | QPAFGYYLRSQPRGMMVLTLSGSKVDEITFFADPTLPGRFGLPEHI* |
| Ga0066699_112315531 | 3300005561 | Soil | RGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI* |
| Ga0066705_105681461 | 3300005569 | Soil | RSQPWGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI* |
| Ga0068857_1006419493 | 3300005577 | Corn Rhizosphere | QPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI* |
| Ga0066903_1011498433 | 3300005764 | Tropical Forest Soil | CYLRSQPWGMMVLTLSGSKVDEITLFADPALPGRFGLPERI* |
| Ga0066903_1046808461 | 3300005764 | Tropical Forest Soil | GCYLRSQPWGMMVLTLSGSKVDEITLFADPALPGRFGLPAHI* |
| Ga0066903_1055217131 | 3300005764 | Tropical Forest Soil | CYLRSQPWGMMVLTLSGSKVDEITLFADPALPGRFGLPEHI* |
| Ga0066651_105065751 | 3300006031 | Soil | SQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI* |
| Ga0066696_105581861 | 3300006032 | Soil | PAFGYYLRSRPRGMMVLTLSGSKVDEITFFADPALPGRLGLPEQI* |
| Ga0075432_102537402 | 3300006058 | Populus Rhizosphere | YYLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHIEPTRMGST* |
| Ga0070715_100070858 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | QPAFGCYLRSQPWGMMVLTLSGSKVDEITYFADPSLPGRFGLPEHI* |
| Ga0070715_104968781 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | LRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI* |
| Ga0070712_1001361771 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | PWGMIVLTLSGSKVDEITFFADPALLGRFGLPEHI* |
| Ga0070712_1019193652 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | FGYYLRSQPRGMMVLTLSGSKVDEITFFADPSLPGRFGLPEHI* |
| Ga0074054_121806441 | 3300006579 | Soil | RSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEQI* |
| Ga0074062_129970042 | 3300006606 | Soil | AFGCYLRSQPWGMMVLTLSGSKVDEITFFIDPALPGRFGLPEHI* |
| Ga0066653_106385731 | 3300006791 | Soil | NGQPAFGYYLRSQPRGMMVLALSGSKVDEITFFADPALPGRFGLPEHI* |
| Ga0066659_111971331 | 3300006797 | Soil | SRPRGMMVLTLSGSKVDQITFFADPALPGRFGLPQHI* |
| Ga0079220_100618871 | 3300006806 | Agricultural Soil | PEGMMVLTLSGSRVDEITFFADPALPGRFGLPEHL* |
| Ga0079220_107611691 | 3300006806 | Agricultural Soil | FGYYLRSQPRGMMVLTLSGGKVDEITFFADPALPGRFGLPEHI* |
| Ga0079220_116916481 | 3300006806 | Agricultural Soil | QPAFGYYVRSQPRGVIVLTLSGNKVAHMTFFDDPALPGRFGLPEHI* |
| Ga0075425_1001780691 | 3300006854 | Populus Rhizosphere | RSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPAHI* |
| Ga0075425_1009267591 | 3300006854 | Populus Rhizosphere | SQPRGMMVLTLSGSNVDEITFFADPALPGRFGLPEHI* |
| Ga0075425_1015140871 | 3300006854 | Populus Rhizosphere | SQPWGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI* |
| Ga0075425_1030586372 | 3300006854 | Populus Rhizosphere | RGIMVLTLSGSKVDEITFFADPALPGRFGLPEHI* |
| Ga0075424_1028628471 | 3300006904 | Populus Rhizosphere | AFGYYFRSQPRGMIVLTLSGSKVAHITFFDDPALPGRFGLPEHI* |
| Ga0066710_1005383951 | 3300009012 | Grasslands Soil | GYYLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEQI |
| Ga0099829_111066032 | 3300009038 | Vadose Zone Soil | RGMMVLTLSGNKVDEITFFADPALPGRFGLPEHI* |
| Ga0105250_102263922 | 3300009092 | Switchgrass Rhizosphere | GQPAFGYYLHSQPGGMMVLTLSGSKVDKITFFADPALPGRFGLPEHI* |
| Ga0105240_114237112 | 3300009093 | Corn Rhizosphere | LRSQPRGMMVLTLSGNKVDEITFFADPALPGRFGLPEHI* |
| Ga0111539_108847911 | 3300009094 | Populus Rhizosphere | PRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI* |
| Ga0105245_114757302 | 3300009098 | Miscanthus Rhizosphere | LRSQPWGMMVLTLSGSKVDEITLFIDPGLPGRFGLPEHI* |
| Ga0105247_103965241 | 3300009101 | Switchgrass Rhizosphere | SQAWGMMVLTLSGSKVDQITFFADPALPGRFGLPEHI* |
| Ga0066709_1002659231 | 3300009137 | Grasslands Soil | FGYYVRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPGHI* |
| Ga0066709_1036387271 | 3300009137 | Grasslands Soil | QPRGMMVLTLSGSKVDEITFFADPALPRRFGLPEAF* |
| Ga0114129_123275521 | 3300009147 | Populus Rhizosphere | PRGMMVLTLSGSNVDEITFFADPALPGRFGLPEHI* |
| Ga0105243_115501602 | 3300009148 | Miscanthus Rhizosphere | SQPRGMMVLTLSGGKVDEITFFADPALPGRFGLPEHI* |
| Ga0105243_120261901 | 3300009148 | Miscanthus Rhizosphere | YLRSQPRGLMVLTLSGSKVDEITFFADPALPGRFGLPEHI* |
| Ga0111538_121408952 | 3300009156 | Populus Rhizosphere | WGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI* |
| Ga0075423_101555621 | 3300009162 | Populus Rhizosphere | SQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPAHI* |
| Ga0075423_109993452 | 3300009162 | Populus Rhizosphere | RSQPRGMMVLTLSGSNVDEITFFADPALPGRFGLPEHI* |
| Ga0105242_122626522 | 3300009176 | Miscanthus Rhizosphere | RSEPRGLMVLTLSGSKVDEITFFADPALPGRFGLPEHI* |
| Ga0105237_112822361 | 3300009545 | Corn Rhizosphere | GQPAFGCYLRSQPWGMMVLALSGSKIDEITLFADPALPGHFGLPEHI* |
| Ga0105249_127197551 | 3300009553 | Switchgrass Rhizosphere | RGLMVLTLSGSKVDEITFFADPALPGRFGLPEHI* |
| Ga0127447_11779882 | 3300010136 | Grasslands Soil | YYLRAQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI* |
| Ga0134084_104526332 | 3300010322 | Grasslands Soil | SQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPKHI* |
| Ga0134065_103359831 | 3300010326 | Grasslands Soil | PAFAYYLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI* |
| Ga0126370_125567891 | 3300010358 | Tropical Forest Soil | AFGCYLRSQPWGMMVLTLSGSQVDEITFFADPGLPGRFGLPEHI* |
| Ga0126376_116742783 | 3300010359 | Tropical Forest Soil | GCYLRSQPWAMMVLTLSGSKVDEITFFADPVLPGRFGLPDHI* |
| Ga0126372_124008242 | 3300010360 | Tropical Forest Soil | WGMMVLTLSGSKVDQITFFADPALPGRFGLPEHL* |
| Ga0126379_107331463 | 3300010366 | Tropical Forest Soil | AFGCYLRSQPWGMLVLALSGSKVDEITFFADPALPGRFGLPEHI* |
| Ga0126379_115268471 | 3300010366 | Tropical Forest Soil | YLRSQPRGMMVLTLSGNKVDEITFFADPALPGRFGLPEHI* |
| Ga0126379_135466961 | 3300010366 | Tropical Forest Soil | QPAFACYLRSQPWGMIVLTLSGSKVDEITFFIDPALPARFGLPEPI* |
| Ga0134125_126985471 | 3300010371 | Terrestrial Soil | PAFGYYLRSQPRGMMVLTLSGGKVDEITFFADPALPGRFGLPEHI* |
| Ga0134128_101325811 | 3300010373 | Terrestrial Soil | PAFGYYLRSQPRGMMVLTLSGNKVDEITFFADPALPGRFGLPEHI* |
| Ga0134128_101589894 | 3300010373 | Terrestrial Soil | YLRSQPWGMIVLRLSGNKVDEITFFADPALPGRFALPGHI* |
| Ga0134128_110918201 | 3300010373 | Terrestrial Soil | SEPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI* |
| Ga0105239_107191141 | 3300010375 | Corn Rhizosphere | PAFGCYLRSQPWGMVVLTLSGSKVDEITFFIDPALPGRFGLPKHI* |
| Ga0105239_111874453 | 3300010375 | Corn Rhizosphere | RGMIVLTLSGSKVDEITFFADPALPGRFGLPEHI* |
| Ga0134126_104817731 | 3300010396 | Terrestrial Soil | YLRSQPRGMMVLTLSGSKVDKITFFADPALPGRFGLPEHI* |
| Ga0134126_106710281 | 3300010396 | Terrestrial Soil | QPAFGYYLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI* |
| Ga0134126_115119792 | 3300010396 | Terrestrial Soil | SDPGNGQPAFGYHLRSQPRGMVVLTLGGSKGDEITFFADPALPGRFGLPEQV* |
| Ga0126383_129344161 | 3300010398 | Tropical Forest Soil | QPAFGCYLRSQPWGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI* |
| Ga0126383_135806192 | 3300010398 | Tropical Forest Soil | FGCYLRSQPWGMMVLTLSGSKVDEITLFADPALLGRFGLPEHI* |
| Ga0134127_112092382 | 3300010399 | Terrestrial Soil | GQPAFGYYLRSEPRGLMVLTLSGSKVDEITFFADPALPGRFGLPEHI* |
| Ga0134123_102238531 | 3300010403 | Terrestrial Soil | YLHSQPGGMMVLTLSGSKVDKITFFADPALPGRFGLPEHI* |
| Ga0105246_106620511 | 3300011119 | Miscanthus Rhizosphere | GQPAFGCYLRSQPWGMMVLTLSGSQVDEITFFADPALPGRFGLPEHI* |
| Ga0105246_125888901 | 3300011119 | Miscanthus Rhizosphere | FGCYLRSQPWGMMVLTLSGSKVDEITLFIDPALPGRFGLPEHI* |
| Ga0137364_106035451 | 3300012198 | Vadose Zone Soil | PWGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI* |
| Ga0137382_102132651 | 3300012200 | Vadose Zone Soil | SQPRGMMVLTLSGSKVDEITFFADPALPGRLGLPEHI* |
| Ga0137376_101908484 | 3300012208 | Vadose Zone Soil | RSQPRGMMVLALSGSKVEEITFFADPALPGRFGLPEHI* |
| Ga0137377_111589511 | 3300012211 | Vadose Zone Soil | PAFGCYLRSQPWGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI* |
| Ga0137377_115530561 | 3300012211 | Vadose Zone Soil | RSRPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI* |
| Ga0137370_105373141 | 3300012285 | Vadose Zone Soil | RSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI* |
| Ga0137370_106832122 | 3300012285 | Vadose Zone Soil | FGYYLRSQPRGMMVLTLSGSKVDEITFFADPALPSRFGLPEHI* |
| Ga0137387_102170911 | 3300012349 | Vadose Zone Soil | YNIRSRTRGMLLLTPSGSKDDEITFFADPAQPGRFGLPEHI* |
| Ga0137387_107341243 | 3300012349 | Vadose Zone Soil | RPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI* |
| Ga0157303_101586391 | 3300012896 | Soil | YVRSQPLGMMVLTLSGSKVDEITLFADPALPGRFGLPEHI* |
| Ga0157301_102934881 | 3300012911 | Soil | YLRSQPRGMMVLTLSGSKVDDITFFADPALPGRFGLPEHI* |
| Ga0164241_107058222 | 3300012943 | Soil | YLRSQPWGMMVLTLSGSKVDEITFFADAALPGRFGLPEHI* |
| Ga0164299_110562941 | 3300012958 | Soil | PAFGYYLRSKPRGMMVLTLSGSKVDEITFFADPALPSRFGLPEHI* |
| Ga0164299_113587411 | 3300012958 | Soil | QPRGMMVLTLSGSKVDEITFFADPALPGRFGLPGHI* |
| Ga0164302_103393362 | 3300012961 | Soil | PWGMMVLTLSGSKVDEITFFADTALPSRFGLPEHI* |
| Ga0126369_105261351 | 3300012971 | Tropical Forest Soil | RSQPWGMIVLTLSGSKVDEITFFIDPALPRRFGLPEHI* |
| Ga0134110_103896881 | 3300012975 | Grasslands Soil | GYYLRSRPRGMMLLTLSGSKVDEITFFADPALPGRFGLPEHI* |
| Ga0164309_102039964 | 3300012984 | Soil | FGYYLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPGHI* |
| Ga0164309_103070102 | 3300012984 | Soil | CYLRSQPWGMMVLTLSGSKVDEITFFADPALPSRFGLPEHI* |
| Ga0164309_106799951 | 3300012984 | Soil | PWGMMVLTLSGSTVDEITFFIDPALPCRFGLPEHI* |
| Ga0164309_107141771 | 3300012984 | Soil | GQPAFGYYLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI* |
| Ga0164308_120127941 | 3300012985 | Soil | NGQPAFGYYVRSQPRGMMVLTLSGSEVDEITFFADPALPGRFGLPEHI* |
| Ga0164307_104112021 | 3300012987 | Soil | PAFGYYLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEQI* |
| Ga0164307_104699621 | 3300012987 | Soil | PRGLMVLTLSGSKVDEITFFADPALPGRFDLPEHI* |
| Ga0157370_113776312 | 3300013104 | Corn Rhizosphere | SQPRGMIVLTLSGSKVDEITFFADPALPGRFGLPEHI* |
| Ga0157369_104500982 | 3300013105 | Corn Rhizosphere | LRSQPWGMIVLTLSGNKVDEITFFADPALPGRFGLPGHI* |
| Ga0157374_113695861 | 3300013296 | Miscanthus Rhizosphere | QPWGMVVLTLSSSEVDGITFFADPALPGRFGLPEHI* |
| Ga0157378_132622092 | 3300013297 | Miscanthus Rhizosphere | WGMMVLTLSGRKVDEITLFIDPALPGRFGLPEHI* |
| Ga0157372_104895294 | 3300013307 | Corn Rhizosphere | PRGLMVLTLSGSKVDEITFFADPALPGRFGLPEHI* |
| Ga0157372_118264513 | 3300013307 | Corn Rhizosphere | WGMMVLTLSGSKVDEITLFIDPGLPGRFGLPEHI* |
| Ga0134081_100973001 | 3300014150 | Grasslands Soil | YLRSQPWGMVVLTLSGSKVDEITFFADPALPGRFGLPEHI* |
| Ga0134081_102839842 | 3300014150 | Grasslands Soil | QPAFGCYLRSQPWGMMVLTLSGSKVDEITFFADPALPGRFGLPKHI* |
| Ga0163163_103518424 | 3300014325 | Switchgrass Rhizosphere | YYLRSQPRGMMVLTLRGSKVDEITFFADPALLGRFGLPEHL* |
| Ga0163163_103766651 | 3300014325 | Switchgrass Rhizosphere | AFGYYLRSQPRGMMVLTLSGSRVDEITFFADPALPGRFGLPEHI* |
| Ga0163163_127942102 | 3300014325 | Switchgrass Rhizosphere | RSQPWGMMVLTLSGSKVDEITLFIDPALPGRFGLPEHI* |
| Ga0157379_123800932 | 3300014968 | Switchgrass Rhizosphere | PAFGYYLRSQPRGMMVLTLSGQEVDEITFFADPALPGRFGLPEHI* |
| Ga0173483_103077301 | 3300015077 | Soil | WGMMALTLSGSKVDEITFFIDPALPGRFDLPEHI* |
| Ga0173483_103106612 | 3300015077 | Soil | GCYLRSQPWGMMVLTLSGSKVDEITFFANPALPGRFGLPEHI* |
| Ga0134073_101954241 | 3300015356 | Grasslands Soil | SFGYYLRSQPQGLMVLTLSGSEIDEITFFADPALPGRFGLPEHI* |
| Ga0132258_108068991 | 3300015371 | Arabidopsis Rhizosphere | AFGYYLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLREHI* |
| Ga0132256_1026997641 | 3300015372 | Arabidopsis Rhizosphere | AYYLRSQSRGVMVLTLSGSKVADITFFADPTLPGRFGLPEHI* |
| Ga0132257_1001401486 | 3300015373 | Arabidopsis Rhizosphere | YLRSQPWGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI* |
| Ga0132257_1002586541 | 3300015373 | Arabidopsis Rhizosphere | CYLRSRPWGMIVLTLSGSKVDEITLFADPALPGRFGLPEHI* |
| Ga0132257_1019033932 | 3300015373 | Arabidopsis Rhizosphere | GQPAFGCYLRSEPWGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI* |
| Ga0132255_1002911915 | 3300015374 | Arabidopsis Rhizosphere | RSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLREHI* |
| Ga0132255_1017052422 | 3300015374 | Arabidopsis Rhizosphere | PAFGYYLRSRPRGMMVLTVSGSKGDEITFFADPALPSRFGLPEHI* |
| Ga0132255_1026164003 | 3300015374 | Arabidopsis Rhizosphere | AFCCYLRSQPWGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI* |
| Ga0187776_103355021 | 3300017966 | Tropical Peatland | PWGMMVLTLSGSKVDEITFFADPALPGRFGLPEHV |
| Ga0187788_105044331 | 3300018032 | Tropical Peatland | FGYYLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI |
| Ga0187773_110171751 | 3300018064 | Tropical Peatland | AFGCYLRSQPWGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI |
| Ga0066667_102050693 | 3300018433 | Grasslands Soil | GYYLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI |
| Ga0066667_108084642 | 3300018433 | Grasslands Soil | RSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI |
| Ga0066667_109563912 | 3300018433 | Grasslands Soil | RSRPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI |
| Ga0066662_121392341 | 3300018468 | Grasslands Soil | GQPAFAYYVRAQARGMIVLALSGGEIDEMTYFADPALPARFGLPERI |
| Ga0066669_112437012 | 3300018482 | Grasslands Soil | GQPAFACYLRSQPWGMIVLTLSGSKIDEITFFADPALPGRFGLPEHI |
| Ga0190267_100595902 | 3300019767 | Soil | QPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI |
| Ga0207692_105856362 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | PAFGYYVRSQPRGIMVLTLSGNKVDGITFFADAALPGRFGLPEHI |
| Ga0207642_101344061 | 3300025899 | Miscanthus Rhizosphere | LRSEPRGLMVLTLSGSKVDEITFFADPALPGRFGLPEHI |
| Ga0207647_106764391 | 3300025904 | Corn Rhizosphere | AFGCYLRSQPWGMVVLTLSGSKVDEITFFIDPALPGRFGLPKHI |
| Ga0207685_100118745 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | LRSQPWGMMVLTLSGSKVDEITFFADPSLPGRFGLPEHI |
| Ga0207684_105927023 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | GCYLRSQPWGMMVLTLSGSKVDEITFFIDPALPGRFGLPEHI |
| Ga0207693_103876473 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | YLRSQPWGMIVLTLSGSKVDEITFFADPALLGRFGLPEHI |
| Ga0207693_107992851 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | YLRSQAWGMMVLTLSGSKVDEITLFADPTLAGRFGLPARI |
| Ga0207663_114971451 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | RSQPWGMMVLTLSGSTVDEITFFIDPALPGRFGLPEHI |
| Ga0207657_107100163 | 3300025919 | Corn Rhizosphere | YLRSQPRGMIVLTLSGSKVDEITFFADPALPGRFGLPEHI |
| Ga0207646_102050691 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | GQPALGYYLRSRPRGMIVLTLSGSKVDEITFFADPALPGRFGLPEQI |
| Ga0207681_110840122 | 3300025923 | Switchgrass Rhizosphere | LRSQPRGMMVLTLSGKKVDKITFFADPALPGRFGLPEHI |
| Ga0207687_102872381 | 3300025927 | Miscanthus Rhizosphere | AFGYYLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI |
| Ga0207687_110704461 | 3300025927 | Miscanthus Rhizosphere | PAFGYYLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI |
| Ga0207687_118721302 | 3300025927 | Miscanthus Rhizosphere | CYLRSQPWGMIVLTLSGSKVDEITLFADPALPGRFGLPKHI |
| Ga0207664_106259971 | 3300025929 | Agricultural Soil | PAFGYYVRSQPRGMMVLTLSGNKVDGITFFADPALPGRFGLPEHI |
| Ga0207665_114642342 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | PAFGYYLRSQPRGMMVLTLSGSKVDEITFFADPALPSRFGLPEHL |
| Ga0207661_103167842 | 3300025944 | Corn Rhizosphere | RSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHL |
| Ga0207651_109382101 | 3300025960 | Switchgrass Rhizosphere | YLRSQPSGMMVLTLSSSKVDEITFFADPALPVRFGLPEHI |
| Ga0207668_104505771 | 3300025972 | Switchgrass Rhizosphere | HSQPGGMMVLTLSGSKVDKITFFADPALPGRFGLPEHI |
| Ga0207702_121240292 | 3300026078 | Corn Rhizosphere | QPRGMIVLTLSGSKVAHITFFDDPALPGRFGLPEHI |
| Ga0207683_118338422 | 3300026121 | Miscanthus Rhizosphere | PWGMVVLTLSSSKVDGITFFADPALPGRFGLPEHI |
| Ga0209234_10433811 | 3300026295 | Grasslands Soil | YYLRSQPRGMMVLTLSGSKVDEITFFADPALPSRFGLPEHI |
| Ga0209160_13408921 | 3300026532 | Soil | RSRPRGMMVLTLNGSKVDEITFFADPALPRRFGLPEHI |
| Ga0209805_12904641 | 3300026542 | Soil | QPRGMMVLTLSGNKVDEITFFADPALPGRFGLPEHI |
| Ga0209161_104862812 | 3300026548 | Soil | SQPRGMMVLTLSGSKVEEITFFADPALPGRFGLPEHI |
| Ga0207626_1026771 | 3300027465 | Soil | QPRGMMVLTLSGSKVDEITFFADPALPGRFGLPERI |
| Ga0209811_100106305 | 3300027821 | Surface Soil | PRGMMVLTLSGSKVDEITFFADPALPGRFGLPGHI |
| Ga0209580_102033452 | 3300027842 | Surface Soil | LRAQPWGMIVLTLSGSKVDEITFFADPALPGRFGLPEHI |
| Ga0307283_100450662 | 3300028790 | Soil | SEPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI |
| Ga0307499_101613941 | 3300031184 | Soil | RSQPWGMMVLTLSGSKVDEITFFIDPALPGRFGLPEHI |
| Ga0318534_104088851 | 3300031544 | Soil | YLRSQPWGMVVLTLSGSKVDEITFFADPALPGRFGLPEHI |
| Ga0318560_106952941 | 3300031682 | Soil | QPRGMMVLTLSGSKVCEITFFADPALPGRFGLPEHI |
| Ga0310813_114926521 | 3300031716 | Soil | LRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI |
| Ga0310813_118035851 | 3300031716 | Soil | PWGVIVLTLSGTTIDEITLFADPALLGRFGLPDHI |
| Ga0310813_123200502 | 3300031716 | Soil | QPAFGCYLRSQAWGMMVLTLSGSKVDEITLFADPTLAGRFGLPARI |
| Ga0318554_102627031 | 3300031765 | Soil | CYLRSQPWGMMVLTLSGSKVDEITLFADPALPGRFGLPERI |
| Ga0318498_104868491 | 3300031778 | Soil | PRGMLVLTLSGSKVCEITFFADPALPGRFGLPEHI |
| Ga0318499_104196612 | 3300031832 | Soil | YLHSQPRGIMVLTLSGSKVDEITFFADPALPGRFGLPEHI |
| Ga0310907_103134201 | 3300031847 | Soil | YLRSQPRGMMVLTLSGSKVDAITFFADPALPGRFGLPEHI |
| Ga0310892_103553082 | 3300031858 | Soil | GCYLRSQPWGMMVLTLSGSKVDEITFFADPALPGRFGLPERI |
| Ga0306919_115336611 | 3300031879 | Soil | FGCYLRSQPWGMMVLTLSGSKVDEITLFADPALLARFGLPEHI |
| Ga0306925_105085991 | 3300031890 | Soil | RSQPRGMMVLTLSGSKVCEITFFADPALPRRFGLPEHI |
| Ga0308175_1001604281 | 3300031938 | Soil | PRGMMVLTLSGSKVDEITFFADPALPGRFGLPEQI |
| Ga0308174_115576202 | 3300031939 | Soil | AFGCYLRSQPWGMMVLTLSGSKVDEITFFADPALPRRFGLPEHI |
| Ga0308174_116920021 | 3300031939 | Soil | RSQPWGMIVLTLSGSKVDEITFFADPALPGRFGLPEQI |
| Ga0310884_104703661 | 3300031944 | Soil | QPAFGYYLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI |
| Ga0310890_103452391 | 3300032075 | Soil | FGYYLRSQPRGIIVLTLSGSKVDEITFFADPALPGRFGLPEHI |
| Ga0307471_1033263091 | 3300032180 | Hardwood Forest Soil | GYYLRSRPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI |
| Ga0310810_114485571 | 3300033412 | Soil | PAFGYYLRSQPRGMMVLTLSGNKVDEITFFADPALPGRFSLPEHI |
| Ga0372943_0159256_3_167 | 3300034268 | Soil | QPAFGYYLRSEPQGMIVLTLSGSTVDKITFFADPALPGRFGLPDHIYSNPGANL |
| ⦗Top⦘ |