Metagenome / Metatranscriptome Family F028017

Basic Information
Family ID	F028017
Family Type	Metagenome / Metatranscriptome
Number of Sequences	193
Average Sequence Length	41 residues
Representative Sequence	YLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI
Number of Associated Samples	143
Number of Associated Scaffolds	193

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	0.00 %
% of genes near scaffold ends (potentially truncated)	100.00 %
% of genes from short scaffolds (< 2000 bps)	92.75 %
Associated GOLD sequencing projects	134
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.38

Most Common Taxonomy
Group	Bacteria (96.373 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (11.399 % of family members)
Environment Ontology (ENVO)	Unclassified (26.943 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (45.596 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 5.88% β-sheet: 22.06% Coil/Unstructured: 72.06%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 193 Family Scaffolds
PF13302	Acetyltransf_3	7.77
PF01636	APH	2.07
PF07883	Cupin_2	2.07
PF01098	FTSW_RODA_SPOVE	2.07
PF07366	SnoaL	2.07
PF00211	Guanylate_cyc	1.55
PF04828	GFA	1.55
PF00368	HMG-CoA_red	1.04
PF00561	Abhydrolase_1	1.04
PF10604	Polyketide_cyc2	1.04
PF02687	FtsX	1.04
PF02518	HATPase_c	1.04
PF14333	DUF4389	1.04
PF00892	EamA	1.04
PF01965	DJ-1_PfpI	1.04
PF00571	CBS	1.04
PF12802	MarR_2	1.04
PF06736	TMEM175	1.04
PF02746	MR_MLE_N	0.52
PF01872	RibD_C	0.52
PF01709	Transcrip_reg	0.52
PF13649	Methyltransf_25	0.52
PF13673	Acetyltransf_10	0.52
PF13460	NAD_binding_10	0.52
PF01061	ABC2_membrane	0.52
PF00248	Aldo_ket_red	0.52
PF01521	Fe-S_biosyn	0.52
PF10947	DUF2628	0.52
PF03807	F420_oxidored	0.52
PF00589	Phage_integrase	0.52
PF12697	Abhydrolase_6	0.52
PF08240	ADH_N	0.52
PF07690	MFS_1	0.52
PF00441	Acyl-CoA_dh_1	0.52
PF01544	CorA	0.52
PF13669	Glyoxalase_4	0.52
PF00884	Sulfatase	0.52
PF01047	MarR	0.52
PF08530	PepX_C	0.52
PF07040	DUF1326	0.52
PF03466	LysR_substrate	0.52
PF03681	Obsolete Pfam Family	0.52
PF00072	Response_reg	0.52
PF00106	adh_short	0.52
PF00756	Esterase	0.52
PF13091	PLDc_2	0.52
PF13561	adh_short_C2	0.52
PF00293	NUDIX	0.52
PF03551	PadR	0.52
PF08281	Sigma70_r4_2	0.52
PF00583	Acetyltransf_1	0.52
PF08220	HTH_DeoR	0.52
PF14022	DUF4238	0.52
PF01230	HIT	0.52
PF12680	SnoaL_2	0.52
PF01019	G_glu_transpept	0.52
PF00903	Glyoxalase	0.52
PF13602	ADH_zinc_N_2	0.52
PF03050	DDE_Tnp_IS66	0.52
PF01209	Ubie_methyltran	0.52
PF13189	Cytidylate_kin2	0.52
PF03176	MMPL	0.52
PF12146	Hydrolase_4	0.52
PF03992	ABM	0.52

COG ID	Name	Functional Category	% Frequency in 193 Family Scaffolds
COG0772	Peptodoglycan polymerase FtsW/RodA/SpoVE	Cell cycle control, cell division, chromosome partitioning [D]	2.07
COG3791	Uncharacterized conserved protein	Function unknown [S]	1.55
COG2114	Adenylate cyclase, class 3	Signal transduction mechanisms [T]	1.55
COG4948	L-alanine-DL-glutamate epimerase or related enzyme of enolase superfamily	Cell wall/membrane/envelope biogenesis [M]	1.04
COG3548	Uncharacterized membrane protein	Function unknown [S]	1.04
COG1257	Hydroxymethylglutaryl-CoA reductase	Lipid transport and metabolism [I]	1.04
COG1985	Pyrimidine reductase, riboflavin biosynthesis	Coenzyme transport and metabolism [H]	0.52
COG5588	Uncharacterized conserved protein, DUF1326 domain	Function unknown [S]	0.52
COG4841	Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF family	Function unknown [S]	0.52
COG3436	Transposase	Mobilome: prophages, transposons [X]	0.52
COG2936	Predicted acyl esterase	General function prediction only [R]	0.52
COG2409	Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily	General function prediction only [R]	0.52
COG2227	2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase	Coenzyme transport and metabolism [H]	0.52
COG2226	Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG	Coenzyme transport and metabolism [H]	0.52
COG0217	Transcriptional and/or translational regulatory protein YebC/TACO1	Translation, ribosomal structure and biogenesis [J]	0.52
COG1960	Acyl-CoA dehydrogenase related to the alkylation response protein AidB	Lipid transport and metabolism [I]	0.52
COG1846	DNA-binding transcriptional regulator, MarR family	Transcription [K]	0.52
COG1733	DNA-binding transcriptional regulator, HxlR family	Transcription [K]	0.52
COG1695	DNA-binding transcriptional regulator, PadR family	Transcription [K]	0.52
COG1033	Predicted exporter protein, RND superfamily	General function prediction only [R]	0.52
COG0598	Mg2+ and Co2+ transporter CorA	Inorganic ion transport and metabolism [P]	0.52
COG0405	Gamma-glutamyltranspeptidase	Amino acid transport and metabolism [E]	0.52
COG0316	Fe-S cluster assembly iron-binding protein IscA	Posttranslational modification, protein turnover, chaperones [O]	0.52
COG0262	Dihydrofolate reductase	Coenzyme transport and metabolism [H]	0.52

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	96.89 %
Unclassified	root	N/A	3.11 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	96.37 %
Unclassified	root	N/A	3.11 %
Viruses	superkingdom	All Organisms → Viruses	0.52 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	96.37 %
Unclassified	root	N/A	3.11 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.52 %

Name	Rank	Taxonomy	Distribution
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	73.06 %
Unclassified	root	N/A	3.11 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.04 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.52 %

Name	Rank	Taxonomy	Distribution
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	67.88 %
Unclassified	root	N/A	3.11 %
Cyanobacteria/Melainabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group	0.52 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.52 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.52 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	0.52 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.52 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.52 %

Name	Rank	Taxonomy	Distribution
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	49.22 %
Unclassified	root	N/A	3.11 %
Thermoleophilia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	2.07 %
Rubrobacteria	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria	1.04 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.52 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.52 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.52 %
unclassified Chloroflexi	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi	0.52 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.52 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.52 %

Name	Rank	Taxonomy	Distribution
unclassified Actinomycetia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia	42.49 %
Unclassified	root	N/A	3.11 %
Solirubrobacterales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	1.55 %
Micromonosporales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales	1.04 %
Gaiellales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales	1.04 %
Pseudonocardiales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales	0.52 %
unclassified Thermoleophilia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia	0.52 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.52 %
Myxococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	0.52 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	0.52 %
Propionibacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales	0.52 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.52 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.52 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.52 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.52 %

Name	Rank	Taxonomy	Distribution
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	42.49 %
Unclassified	root	N/A	3.11 %
Gaiellaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae	1.04 %
Micromonosporaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae	1.04 %
Thermoleophilia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium	0.52 %
Pseudonocardiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae	0.52 %
Solirubrobacteraceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae	0.52 %
Cystobacterineae	suborder	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae	0.52 %
Nocardioidaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae	0.52 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.52 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	0.52 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.52 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.52 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.52 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.52 %

Name	Rank	Taxonomy	Distribution
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	42.49 %
Unclassified	root	N/A	3.11 %
Gaiella	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella	1.04 %
Actinoplanes	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes	1.04 %
Myxococcaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae	0.52 %
Nocardioides	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides	0.52 %
Thermoleophilia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium	0.52 %
Pseudonocardiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae	0.52 %
Solirubrobacteraceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae	0.52 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.52 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	0.52 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.52 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.52 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.52 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.52 %

Name	Rank	Taxonomy	Distribution
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	42.49 %
Unclassified	root	N/A	3.11 %
Actinoplanes subtropicus	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes subtropicus	1.04 %
unclassified Gaiella	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella	0.52 %
unclassified Myxococcaceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae	0.52 %
Gaiella occulta	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → Gaiella occulta	0.52 %
Nocardioides guangzhouensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides guangzhouensis	0.52 %
Thermoleophilia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium	0.52 %
Pseudonocardiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae	0.52 %
Solirubrobacteraceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae	0.52 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.52 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	0.52 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.52 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.52 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.52 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.52 %

Name	Rank	Taxonomy	Distribution
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	42.49 %
Unclassified	root	N/A	3.11 %
Actinoplanes subtropicus	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes subtropicus	1.04 %
Myxococcaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium	0.52 %
Gaiella sp. SCGC AG-212-M14	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14	0.52 %
Gaiella occulta	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → Gaiella occulta	0.52 %
Nocardioides guangzhouensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides guangzhouensis	0.52 %
Thermoleophilia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium	0.52 %
Pseudonocardiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae	0.52 %
Solirubrobacteraceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae	0.52 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.52 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	0.52 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.52 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.52 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.52 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.52 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2170459003\|FZ032L002G4KX2	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	516	Open in IMG/M
3300004479\|Ga0062595_100089732	All Organisms → cellular organisms → Bacteria	1591	Open in IMG/M
3300004479\|Ga0062595_101633256	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	603	Open in IMG/M
3300005184\|Ga0066671_10028218	All Organisms → cellular organisms → Bacteria	2596	Open in IMG/M
3300005329\|Ga0070683_100910949	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	843	Open in IMG/M
3300005331\|Ga0070670_100232192	All Organisms → cellular organisms → Bacteria	1605	Open in IMG/M
3300005332\|Ga0066388_102258771	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	983	Open in IMG/M
3300005337\|Ga0070682_100128036	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	1714	Open in IMG/M
3300005435\|Ga0070714_100172817	All Organisms → cellular organisms → Bacteria	1962	Open in IMG/M
3300005435\|Ga0070714_100899164	All Organisms → cellular organisms → Bacteria	860	Open in IMG/M
3300005454\|Ga0066687_10186623	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1123	Open in IMG/M
3300005526\|Ga0073909_10459783	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	609	Open in IMG/M
3300005529\|Ga0070741_11224269	All Organisms → cellular organisms → Bacteria	632	Open in IMG/M
3300005530\|Ga0070679_101770816	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	566	Open in IMG/M
3300005530\|Ga0070679_101987131	All Organisms → cellular organisms → Bacteria	530	Open in IMG/M
3300005536\|Ga0070697_101099662	All Organisms → cellular organisms → Bacteria	707	Open in IMG/M
3300005540\|Ga0066697_10435224	All Organisms → cellular organisms → Bacteria	757	Open in IMG/M
3300005549\|Ga0070704_101702545	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	582	Open in IMG/M
3300005552\|Ga0066701_10510235	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	743	Open in IMG/M
3300005561\|Ga0066699_10644644	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	759	Open in IMG/M
3300005561\|Ga0066699_11231553	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	513	Open in IMG/M
3300005569\|Ga0066705_10568146	All Organisms → cellular organisms → Bacteria	700	Open in IMG/M
3300005577\|Ga0068857_100641949	All Organisms → cellular organisms → Bacteria	1006	Open in IMG/M
3300005764\|Ga0066903_101149843	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1436	Open in IMG/M
3300005764\|Ga0066903_104680846	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	728	Open in IMG/M
3300005764\|Ga0066903_105521713	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	666	Open in IMG/M
3300006031\|Ga0066651_10506575	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	639	Open in IMG/M
3300006032\|Ga0066696_10558186	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	747	Open in IMG/M
3300006058\|Ga0075432_10253740	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	715	Open in IMG/M
3300006163\|Ga0070715_10007085	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	3843	Open in IMG/M
3300006163\|Ga0070715_10496878	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	697	Open in IMG/M
3300006175\|Ga0070712_100136177	All Organisms → cellular organisms → Bacteria	1868	Open in IMG/M
3300006175\|Ga0070712_101919365	All Organisms → cellular organisms → Bacteria	518	Open in IMG/M
3300006579\|Ga0074054_12180644	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	600	Open in IMG/M
3300006606\|Ga0074062_12997004	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	546	Open in IMG/M
3300006791\|Ga0066653_10638573	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	544	Open in IMG/M
3300006797\|Ga0066659_11197133	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	634	Open in IMG/M
3300006806\|Ga0079220_10061887	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1810	Open in IMG/M
3300006806\|Ga0079220_10761169	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	724	Open in IMG/M
3300006806\|Ga0079220_11691648	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	553	Open in IMG/M
3300006854\|Ga0075425_100178069	All Organisms → cellular organisms → Bacteria	2441	Open in IMG/M
3300006854\|Ga0075425_100926759	All Organisms → cellular organisms → Bacteria	995	Open in IMG/M
3300006854\|Ga0075425_101514087	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	757	Open in IMG/M
3300006854\|Ga0075425_103058637	All Organisms → cellular organisms → Bacteria	510	Open in IMG/M
3300006904\|Ga0075424_102862847	All Organisms → cellular organisms → Bacteria	502	Open in IMG/M
3300009012\|Ga0066710_100538395	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1765	Open in IMG/M
3300009038\|Ga0099829_11106603	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	657	Open in IMG/M
3300009092\|Ga0105250_10226392	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae	794	Open in IMG/M
3300009093\|Ga0105240_11423711	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	728	Open in IMG/M
3300009094\|Ga0111539_10884791	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1039	Open in IMG/M
3300009098\|Ga0105245_11475730	All Organisms → cellular organisms → Bacteria	731	Open in IMG/M
3300009101\|Ga0105247_10396524	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	982	Open in IMG/M
3300009137\|Ga0066709_100265923	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae	2307	Open in IMG/M
3300009137\|Ga0066709_103638727	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	559	Open in IMG/M
3300009147\|Ga0114129_12327552	All Organisms → cellular organisms → Bacteria	643	Open in IMG/M
3300009148\|Ga0105243_11550160	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	688	Open in IMG/M
3300009148\|Ga0105243_12026190	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	610	Open in IMG/M
3300009156\|Ga0111538_12140895	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	703	Open in IMG/M
3300009162\|Ga0075423_10155562	All Organisms → cellular organisms → Bacteria	2400	Open in IMG/M
3300009162\|Ga0075423_10999345	All Organisms → cellular organisms → Bacteria	889	Open in IMG/M
3300009176\|Ga0105242_12262652	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	589	Open in IMG/M
3300009545\|Ga0105237_11282236	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	739	Open in IMG/M
3300009553\|Ga0105249_12719755	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	567	Open in IMG/M
3300010136\|Ga0127447_1177988	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	805	Open in IMG/M
3300010322\|Ga0134084_10452633	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	511	Open in IMG/M
3300010326\|Ga0134065_10335983	All Organisms → cellular organisms → Bacteria	589	Open in IMG/M
3300010358\|Ga0126370_12556789	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	510	Open in IMG/M
3300010359\|Ga0126376_11674278	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	670	Open in IMG/M
3300010360\|Ga0126372_12400824	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	578	Open in IMG/M
3300010366\|Ga0126379_10733146	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1084	Open in IMG/M
3300010366\|Ga0126379_11526847	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	773	Open in IMG/M
3300010366\|Ga0126379_13546696	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	523	Open in IMG/M
3300010371\|Ga0134125_12698547	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	540	Open in IMG/M
3300010373\|Ga0134128_10132581	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2822	Open in IMG/M
3300010373\|Ga0134128_10158989	All Organisms → cellular organisms → Bacteria	2553	Open in IMG/M
3300010373\|Ga0134128_11091820	All Organisms → cellular organisms → Bacteria → Terrabacteria group	881	Open in IMG/M
3300010375\|Ga0105239_10719114	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1142	Open in IMG/M
3300010375\|Ga0105239_11187445	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	879	Open in IMG/M
3300010396\|Ga0134126_10481773	All Organisms → cellular organisms → Bacteria	1432	Open in IMG/M
3300010396\|Ga0134126_10671028	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1180	Open in IMG/M
3300010396\|Ga0134126_11511979	Not Available	740	Open in IMG/M
3300010398\|Ga0126383_12934416	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	557	Open in IMG/M
3300010398\|Ga0126383_13580619	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	507	Open in IMG/M
3300010399\|Ga0134127_11209238	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	823	Open in IMG/M
3300010403\|Ga0134123_10223853	All Organisms → cellular organisms → Bacteria	1618	Open in IMG/M
3300011119\|Ga0105246_10662051	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	910	Open in IMG/M
3300011119\|Ga0105246_12588890	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	501	Open in IMG/M
3300012198\|Ga0137364_10603545	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium	827	Open in IMG/M
3300012200\|Ga0137382_10213265	All Organisms → Viruses → Predicted Viral	1330	Open in IMG/M
3300012208\|Ga0137376_10190848	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1771	Open in IMG/M
3300012211\|Ga0137377_11158951	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	703	Open in IMG/M
3300012211\|Ga0137377_11553056	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	587	Open in IMG/M
3300012285\|Ga0137370_10537314	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	718	Open in IMG/M
3300012285\|Ga0137370_10683212	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	638	Open in IMG/M
3300012349\|Ga0137387_10217091	All Organisms → cellular organisms → Bacteria	1375	Open in IMG/M
3300012349\|Ga0137387_10734124	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	714	Open in IMG/M
3300012896\|Ga0157303_10158639	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	615	Open in IMG/M
3300012911\|Ga0157301_10293488	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	590	Open in IMG/M
3300012943\|Ga0164241_10705822	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	732	Open in IMG/M
3300012958\|Ga0164299_11056294	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	603	Open in IMG/M
3300012958\|Ga0164299_11358741	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	547	Open in IMG/M
3300012961\|Ga0164302_10339336	All Organisms → cellular organisms → Bacteria	999	Open in IMG/M
3300012971\|Ga0126369_10526135	All Organisms → cellular organisms → Bacteria	1244	Open in IMG/M
3300012975\|Ga0134110_10389688	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	616	Open in IMG/M
3300012984\|Ga0164309_10203996	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	1362	Open in IMG/M
3300012984\|Ga0164309_10307010	All Organisms → cellular organisms → Bacteria	1147	Open in IMG/M
3300012984\|Ga0164309_10679995	All Organisms → cellular organisms → Bacteria → Terrabacteria group	814	Open in IMG/M
3300012984\|Ga0164309_10714177	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	797	Open in IMG/M
3300012985\|Ga0164308_12012794	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	538	Open in IMG/M
3300012987\|Ga0164307_10411202	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1000	Open in IMG/M
3300012987\|Ga0164307_10469962	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides guangzhouensis	943	Open in IMG/M
3300013104\|Ga0157370_11377631	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes subtropicus	635	Open in IMG/M
3300013105\|Ga0157369_10450098	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1333	Open in IMG/M
3300013296\|Ga0157374_11369586	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	730	Open in IMG/M
3300013297\|Ga0157378_13262209	All Organisms → cellular organisms → Bacteria	504	Open in IMG/M
3300013307\|Ga0157372_10489529	All Organisms → cellular organisms → Bacteria	1434	Open in IMG/M
3300013307\|Ga0157372_11826451	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	699	Open in IMG/M
3300014150\|Ga0134081_10097300	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	924	Open in IMG/M
3300014150\|Ga0134081_10283984	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	589	Open in IMG/M
3300014325\|Ga0163163_10351842	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1529	Open in IMG/M
3300014325\|Ga0163163_10376665	All Organisms → cellular organisms → Bacteria	1477	Open in IMG/M
3300014325\|Ga0163163_12794210	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	545	Open in IMG/M
3300014968\|Ga0157379_12380093	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	528	Open in IMG/M
3300015077\|Ga0173483_10307730	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	779	Open in IMG/M
3300015077\|Ga0173483_10310661	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	776	Open in IMG/M
3300015356\|Ga0134073_10195424	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	668	Open in IMG/M
3300015371\|Ga0132258_10806899	All Organisms → cellular organisms → Bacteria	2366	Open in IMG/M
3300015372\|Ga0132256_102699764	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	596	Open in IMG/M
3300015373\|Ga0132257_100140148	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	2825	Open in IMG/M
3300015373\|Ga0132257_100258654	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2081	Open in IMG/M
3300015373\|Ga0132257_101903393	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	765	Open in IMG/M
3300015374\|Ga0132255_100291191	All Organisms → cellular organisms → Bacteria	2347	Open in IMG/M
3300015374\|Ga0132255_101705242	All Organisms → cellular organisms → Bacteria	956	Open in IMG/M
3300015374\|Ga0132255_102616400	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14	771	Open in IMG/M
3300017966\|Ga0187776_10335502	Not Available	993	Open in IMG/M
3300018032\|Ga0187788_10504433	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	523	Open in IMG/M
3300018064\|Ga0187773_11017175	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	544	Open in IMG/M
3300018433\|Ga0066667_10205069	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1453	Open in IMG/M
3300018433\|Ga0066667_10808464	Not Available	798	Open in IMG/M
3300018433\|Ga0066667_10956391	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	738	Open in IMG/M
3300018468\|Ga0066662_12139234	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	587	Open in IMG/M
3300018482\|Ga0066669_11243701	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	672	Open in IMG/M
3300019767\|Ga0190267_10059590	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1351	Open in IMG/M
3300025898\|Ga0207692_10585636	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	716	Open in IMG/M
3300025899\|Ga0207642_10134406	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1295	Open in IMG/M
3300025904\|Ga0207647_10676439	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	564	Open in IMG/M
3300025905\|Ga0207685_10011874	All Organisms → cellular organisms → Bacteria	2638	Open in IMG/M
3300025910\|Ga0207684_10592702	All Organisms → cellular organisms → Bacteria	947	Open in IMG/M
3300025915\|Ga0207693_10387647	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1092	Open in IMG/M
3300025915\|Ga0207693_10799285	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	727	Open in IMG/M
3300025916\|Ga0207663_11497145	All Organisms → cellular organisms → Bacteria → Terrabacteria group	543	Open in IMG/M
3300025919\|Ga0207657_10710016	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	781	Open in IMG/M
3300025922\|Ga0207646_10205069	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1781	Open in IMG/M
3300025923\|Ga0207681_11084012	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	673	Open in IMG/M
3300025927\|Ga0207687_10287238	All Organisms → cellular organisms → Bacteria	1321	Open in IMG/M
3300025927\|Ga0207687_11070446	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	692	Open in IMG/M
3300025927\|Ga0207687_11872130	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	513	Open in IMG/M
3300025929\|Ga0207664_10625997	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	967	Open in IMG/M
3300025939\|Ga0207665_11464234	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	543	Open in IMG/M
3300025944\|Ga0207661_10316784	Not Available	1401	Open in IMG/M
3300025960\|Ga0207651_10938210	Not Available	772	Open in IMG/M
3300025972\|Ga0207668_10450577	All Organisms → cellular organisms → Bacteria	1098	Open in IMG/M
3300026078\|Ga0207702_12124029	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	551	Open in IMG/M
3300026121\|Ga0207683_11833842	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	555	Open in IMG/M
3300026295\|Ga0209234_1043381	All Organisms → cellular organisms → Bacteria	1710	Open in IMG/M
3300026532\|Ga0209160_1340892	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	513	Open in IMG/M
3300026542\|Ga0209805_1290464	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	622	Open in IMG/M
3300026548\|Ga0209161_10486281	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium	545	Open in IMG/M
3300027465\|Ga0207626_102677	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	624	Open in IMG/M
3300027821\|Ga0209811_10010630	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	2957	Open in IMG/M
3300027842\|Ga0209580_10203345	All Organisms → cellular organisms → Bacteria	982	Open in IMG/M
3300028790\|Ga0307283_10045066	Not Available	1034	Open in IMG/M
3300031184\|Ga0307499_10161394	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → Gaiella occulta	665	Open in IMG/M
3300031544\|Ga0318534_10408885	All Organisms → cellular organisms → Bacteria	779	Open in IMG/M
3300031682\|Ga0318560_10695294	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	550	Open in IMG/M
3300031716\|Ga0310813_11492652	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes subtropicus	629	Open in IMG/M
3300031716\|Ga0310813_11803585	All Organisms → cellular organisms → Bacteria → Terrabacteria group	575	Open in IMG/M
3300031716\|Ga0310813_12320050	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	509	Open in IMG/M
3300031765\|Ga0318554_10262703	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	983	Open in IMG/M
3300031778\|Ga0318498_10486849	All Organisms → cellular organisms → Bacteria → Terrabacteria group	544	Open in IMG/M
3300031832\|Ga0318499_10419661	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	511	Open in IMG/M
3300031847\|Ga0310907_10313420	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	794	Open in IMG/M
3300031858\|Ga0310892_10355308	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	941	Open in IMG/M
3300031879\|Ga0306919_11533661	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	501	Open in IMG/M
3300031890\|Ga0306925_10508599	All Organisms → cellular organisms → Bacteria	1282	Open in IMG/M
3300031938\|Ga0308175_100160428	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	2168	Open in IMG/M
3300031939\|Ga0308174_11557620	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	567	Open in IMG/M
3300031939\|Ga0308174_11692002	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	543	Open in IMG/M
3300031944\|Ga0310884_10470366	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	734	Open in IMG/M
3300032075\|Ga0310890_10345239	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1086	Open in IMG/M
3300032180\|Ga0307471_103326309	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	570	Open in IMG/M
3300033412\|Ga0310810_11448557	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	517	Open in IMG/M
3300034268\|Ga0372943_0159256	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1378	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	71.50%
Host-Associated	Host-Associated	28.50%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	71.50%
Plants	Host-Associated → Plants	28.50%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	71.50%
Rhizosphere	Host-Associated → Plants → Rhizosphere	20.73%
Rhizoplane	Host-Associated → Plants → Rhizoplane	6.22%
Roots	Host-Associated → Plants → Roots	1.55%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	56.48%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	17.62%
Loam	Environmental → Terrestrial → Soil → Loam	13.47%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	3.63%
Soil	Host-Associated → Plants → Rhizosphere → Soil	3.11%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	2.07%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	1.55%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	1.55%
Soil	Host-Associated → Plants → Rhizoplane → Soil	0.52%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	32.64%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	17.62%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	12.44%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	11.40%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	4.66%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	3.63%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	3.63%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	3.11%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	3.11%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	2.07%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	2.07%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	1.55%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	1.55%
Unclassified	Host-Associated → Plants → Rhizoplane → Soil → Unclassified	0.52%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	11.40%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	7.25%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	7.25%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	5.70%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	5.18%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	4.66%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	4.66%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	4.66%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	4.66%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	3.63%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	3.63%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	3.63%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	3.11%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	2.59%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	2.07%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	2.07%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	2.07%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	2.07%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	2.07%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	1.55%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.55%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	1.55%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil	1.55%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	1.55%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	1.55%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.55%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.04%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.04%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.04%
Grass Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil	0.52%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.52%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.52%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere	0.52%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.52%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.52%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.52%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2170459003	Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm	Environmental	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300005184	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120	Environmental	Open in IMG/M
3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Environmental	Open in IMG/M
3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Host-Associated	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Environmental	Open in IMG/M
3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Environmental	Open in IMG/M
3300005454	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136	Environmental	Open in IMG/M
3300005526	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1	Environmental	Open in IMG/M
3300005529	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1	Environmental	Open in IMG/M
3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Environmental	Open in IMG/M
3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Environmental	Open in IMG/M
3300005540	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146	Environmental	Open in IMG/M
3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Environmental	Open in IMG/M
3300005552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150	Environmental	Open in IMG/M
3300005561	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148	Environmental	Open in IMG/M
3300005569	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154	Environmental	Open in IMG/M
3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300006031	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100	Environmental	Open in IMG/M
3300006032	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145	Environmental	Open in IMG/M
3300006058	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Host-Associated	Open in IMG/M
3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Environmental	Open in IMG/M
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental	Open in IMG/M
3300006579	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006606	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006791	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102	Environmental	Open in IMG/M
3300006797	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108	Environmental	Open in IMG/M
3300006806	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100	Environmental	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental	Open in IMG/M
3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Host-Associated	Open in IMG/M
3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Host-Associated	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated	Open in IMG/M
3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300010136	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_24_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010322	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG	Environmental	Open in IMG/M
3300010326	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG	Environmental	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental	Open in IMG/M
3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Host-Associated	Open in IMG/M
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated	Open in IMG/M
3300012198	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG	Environmental	Open in IMG/M
3300012200	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG	Environmental	Open in IMG/M
3300012208	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG	Environmental	Open in IMG/M
3300012211	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG	Environmental	Open in IMG/M
3300012285	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG	Environmental	Open in IMG/M
3300012349	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG	Environmental	Open in IMG/M
3300012896	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2	Environmental	Open in IMG/M
3300012911	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2	Environmental	Open in IMG/M
3300012943	Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY)	Environmental	Open in IMG/M
3300012958	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG	Environmental	Open in IMG/M
3300012961	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300012975	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015	Environmental	Open in IMG/M
3300012984	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG	Environmental	Open in IMG/M
3300012985	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG	Environmental	Open in IMG/M
3300012987	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG	Environmental	Open in IMG/M
3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Host-Associated	Open in IMG/M
3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Host-Associated	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Host-Associated	Open in IMG/M
3300014150	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG	Environmental	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated	Open in IMG/M
3300015077	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)	Environmental	Open in IMG/M
3300015356	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300017966	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG	Environmental	Open in IMG/M
3300018032	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG	Environmental	Open in IMG/M
3300018064	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG	Environmental	Open in IMG/M
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental	Open in IMG/M
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300019767	Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T	Environmental	Open in IMG/M
3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)	Host-Associated	Open in IMG/M
3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026295	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes)	Environmental	Open in IMG/M
3300026532	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes)	Environmental	Open in IMG/M
3300026542	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)	Environmental	Open in IMG/M
3300026548	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)	Environmental	Open in IMG/M
3300027465	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-BECK03-A (SPAdes)	Environmental	Open in IMG/M
3300027821	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027842	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300028790	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122	Environmental	Open in IMG/M
3300031184	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S	Environmental	Open in IMG/M
3300031544	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26	Environmental	Open in IMG/M
3300031682	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22	Environmental	Open in IMG/M
3300031716	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3	Environmental	Open in IMG/M
3300031765	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22	Environmental	Open in IMG/M
3300031778	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24	Environmental	Open in IMG/M
3300031832	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25	Environmental	Open in IMG/M
3300031847	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4	Environmental	Open in IMG/M
3300031858	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2	Environmental	Open in IMG/M
3300031879	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)	Environmental	Open in IMG/M
3300031890	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)	Environmental	Open in IMG/M
3300031938	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1	Environmental	Open in IMG/M
3300031939	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2	Environmental	Open in IMG/M
3300031944	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1	Environmental	Open in IMG/M
3300032075	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300033412	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC	Environmental	Open in IMG/M
3300034268	Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.38
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.38
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F028017

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
E4A_10072850	2170459003	Grass Soil	FGCYLRSQPWGMVVLTLSGSKVDEITFFADPALPGRFGLPEHI
Ga0062595_1000897321	3300004479	Soil	LRSQPWGMIVLTLSGSKVDEITFFADPALPGRFGLPAHI*
Ga0062595_1016332561	3300004479	Soil	YLRSQPRGMIVLTLNGSKVDEITFFADPALVGRFGLPEHI*
Ga0066671_100282186	3300005184	Soil	PAFGYYLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0070683_1009109492	3300005329	Corn Rhizosphere	FGCYLRSQPWGMMVLTLSGSKVDEITFFADPALPSRFGLPEHI*
Ga0070670_1002321921	3300005331	Switchgrass Rhizosphere	LRSQPWGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0066388_1022587714	3300005332	Tropical Forest Soil	AFGCYLRSQPWGMMVLTLSGSKVDEITLFADPALPGRFGLPAHI*
Ga0070682_1001280361	3300005337	Corn Rhizosphere	GYYLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0070714_1001728172	3300005435	Agricultural Soil	FGCYLRSQPWGMMVLALSGSKVDEITLFVDPALPSRFGLPEHI*
Ga0070714_1008991641	3300005435	Agricultural Soil	YYLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0066687_101866231	3300005454	Soil	YYLRSQPRGMMVLTLSGSKVDEITYFADPALPGRFGLPEYI*
Ga0073909_104597831	3300005526	Surface Soil	LRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPGHI*
Ga0070741_112242692	3300005529	Surface Soil	AQPWGMIVLTLSGRKVDEMTFFADPALPVRFGLPEHI*
Ga0070679_1017708163	3300005530	Corn Rhizosphere	AFGYYLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFDLPEHI*
Ga0070679_1019871312	3300005530	Corn Rhizosphere	FGYYLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0070697_1010996622	3300005536	Corn, Switchgrass And Miscanthus Rhizosphere	RSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHIQPTRMGST*
Ga0066697_104352241	3300005540	Soil	YLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0070704_1017025451	3300005549	Corn, Switchgrass And Miscanthus Rhizosphere	AFGYYLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0066701_105102351	3300005552	Soil	SRPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0066699_106446442	3300005561	Soil	QPAFGYYLRSQPRGMMVLTLSGSKVDEITFFADPTLPGRFGLPEHI*
Ga0066699_112315531	3300005561	Soil	RGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0066705_105681461	3300005569	Soil	RSQPWGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0068857_1006419493	3300005577	Corn Rhizosphere	QPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0066903_1011498433	3300005764	Tropical Forest Soil	CYLRSQPWGMMVLTLSGSKVDEITLFADPALPGRFGLPERI*
Ga0066903_1046808461	3300005764	Tropical Forest Soil	GCYLRSQPWGMMVLTLSGSKVDEITLFADPALPGRFGLPAHI*
Ga0066903_1055217131	3300005764	Tropical Forest Soil	CYLRSQPWGMMVLTLSGSKVDEITLFADPALPGRFGLPEHI*
Ga0066651_105065751	3300006031	Soil	SQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0066696_105581861	3300006032	Soil	PAFGYYLRSRPRGMMVLTLSGSKVDEITFFADPALPGRLGLPEQI*
Ga0075432_102537402	3300006058	Populus Rhizosphere	YYLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHIEPTRMGST*
Ga0070715_100070858	3300006163	Corn, Switchgrass And Miscanthus Rhizosphere	QPAFGCYLRSQPWGMMVLTLSGSKVDEITYFADPSLPGRFGLPEHI*
Ga0070715_104968781	3300006163	Corn, Switchgrass And Miscanthus Rhizosphere	LRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0070712_1001361771	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	PWGMIVLTLSGSKVDEITFFADPALLGRFGLPEHI*
Ga0070712_1019193652	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	FGYYLRSQPRGMMVLTLSGSKVDEITFFADPSLPGRFGLPEHI*
Ga0074054_121806441	3300006579	Soil	RSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEQI*
Ga0074062_129970042	3300006606	Soil	AFGCYLRSQPWGMMVLTLSGSKVDEITFFIDPALPGRFGLPEHI*
Ga0066653_106385731	3300006791	Soil	NGQPAFGYYLRSQPRGMMVLALSGSKVDEITFFADPALPGRFGLPEHI*
Ga0066659_111971331	3300006797	Soil	SRPRGMMVLTLSGSKVDQITFFADPALPGRFGLPQHI*
Ga0079220_100618871	3300006806	Agricultural Soil	PEGMMVLTLSGSRVDEITFFADPALPGRFGLPEHL*
Ga0079220_107611691	3300006806	Agricultural Soil	FGYYLRSQPRGMMVLTLSGGKVDEITFFADPALPGRFGLPEHI*
Ga0079220_116916481	3300006806	Agricultural Soil	QPAFGYYVRSQPRGVIVLTLSGNKVAHMTFFDDPALPGRFGLPEHI*
Ga0075425_1001780691	3300006854	Populus Rhizosphere	RSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPAHI*
Ga0075425_1009267591	3300006854	Populus Rhizosphere	SQPRGMMVLTLSGSNVDEITFFADPALPGRFGLPEHI*
Ga0075425_1015140871	3300006854	Populus Rhizosphere	SQPWGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0075425_1030586372	3300006854	Populus Rhizosphere	RGIMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0075424_1028628471	3300006904	Populus Rhizosphere	AFGYYFRSQPRGMIVLTLSGSKVAHITFFDDPALPGRFGLPEHI*
Ga0066710_1005383951	3300009012	Grasslands Soil	GYYLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEQI
Ga0099829_111066032	3300009038	Vadose Zone Soil	RGMMVLTLSGNKVDEITFFADPALPGRFGLPEHI*
Ga0105250_102263922	3300009092	Switchgrass Rhizosphere	GQPAFGYYLHSQPGGMMVLTLSGSKVDKITFFADPALPGRFGLPEHI*
Ga0105240_114237112	3300009093	Corn Rhizosphere	LRSQPRGMMVLTLSGNKVDEITFFADPALPGRFGLPEHI*
Ga0111539_108847911	3300009094	Populus Rhizosphere	PRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0105245_114757302	3300009098	Miscanthus Rhizosphere	LRSQPWGMMVLTLSGSKVDEITLFIDPGLPGRFGLPEHI*
Ga0105247_103965241	3300009101	Switchgrass Rhizosphere	SQAWGMMVLTLSGSKVDQITFFADPALPGRFGLPEHI*
Ga0066709_1002659231	3300009137	Grasslands Soil	FGYYVRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPGHI*
Ga0066709_1036387271	3300009137	Grasslands Soil	QPRGMMVLTLSGSKVDEITFFADPALPRRFGLPEAF*
Ga0114129_123275521	3300009147	Populus Rhizosphere	PRGMMVLTLSGSNVDEITFFADPALPGRFGLPEHI*
Ga0105243_115501602	3300009148	Miscanthus Rhizosphere	SQPRGMMVLTLSGGKVDEITFFADPALPGRFGLPEHI*
Ga0105243_120261901	3300009148	Miscanthus Rhizosphere	YLRSQPRGLMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0111538_121408952	3300009156	Populus Rhizosphere	WGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0075423_101555621	3300009162	Populus Rhizosphere	SQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPAHI*
Ga0075423_109993452	3300009162	Populus Rhizosphere	RSQPRGMMVLTLSGSNVDEITFFADPALPGRFGLPEHI*
Ga0105242_122626522	3300009176	Miscanthus Rhizosphere	RSEPRGLMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0105237_112822361	3300009545	Corn Rhizosphere	GQPAFGCYLRSQPWGMMVLALSGSKIDEITLFADPALPGHFGLPEHI*
Ga0105249_127197551	3300009553	Switchgrass Rhizosphere	RGLMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0127447_11779882	3300010136	Grasslands Soil	YYLRAQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0134084_104526332	3300010322	Grasslands Soil	SQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPKHI*
Ga0134065_103359831	3300010326	Grasslands Soil	PAFAYYLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0126370_125567891	3300010358	Tropical Forest Soil	AFGCYLRSQPWGMMVLTLSGSQVDEITFFADPGLPGRFGLPEHI*
Ga0126376_116742783	3300010359	Tropical Forest Soil	GCYLRSQPWAMMVLTLSGSKVDEITFFADPVLPGRFGLPDHI*
Ga0126372_124008242	3300010360	Tropical Forest Soil	WGMMVLTLSGSKVDQITFFADPALPGRFGLPEHL*
Ga0126379_107331463	3300010366	Tropical Forest Soil	AFGCYLRSQPWGMLVLALSGSKVDEITFFADPALPGRFGLPEHI*
Ga0126379_115268471	3300010366	Tropical Forest Soil	YLRSQPRGMMVLTLSGNKVDEITFFADPALPGRFGLPEHI*
Ga0126379_135466961	3300010366	Tropical Forest Soil	QPAFACYLRSQPWGMIVLTLSGSKVDEITFFIDPALPARFGLPEPI*
Ga0134125_126985471	3300010371	Terrestrial Soil	PAFGYYLRSQPRGMMVLTLSGGKVDEITFFADPALPGRFGLPEHI*
Ga0134128_101325811	3300010373	Terrestrial Soil	PAFGYYLRSQPRGMMVLTLSGNKVDEITFFADPALPGRFGLPEHI*
Ga0134128_101589894	3300010373	Terrestrial Soil	YLRSQPWGMIVLRLSGNKVDEITFFADPALPGRFALPGHI*
Ga0134128_110918201	3300010373	Terrestrial Soil	SEPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0105239_107191141	3300010375	Corn Rhizosphere	PAFGCYLRSQPWGMVVLTLSGSKVDEITFFIDPALPGRFGLPKHI*
Ga0105239_111874453	3300010375	Corn Rhizosphere	RGMIVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0134126_104817731	3300010396	Terrestrial Soil	YLRSQPRGMMVLTLSGSKVDKITFFADPALPGRFGLPEHI*
Ga0134126_106710281	3300010396	Terrestrial Soil	QPAFGYYLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0134126_115119792	3300010396	Terrestrial Soil	SDPGNGQPAFGYHLRSQPRGMVVLTLGGSKGDEITFFADPALPGRFGLPEQV*
Ga0126383_129344161	3300010398	Tropical Forest Soil	QPAFGCYLRSQPWGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0126383_135806192	3300010398	Tropical Forest Soil	FGCYLRSQPWGMMVLTLSGSKVDEITLFADPALLGRFGLPEHI*
Ga0134127_112092382	3300010399	Terrestrial Soil	GQPAFGYYLRSEPRGLMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0134123_102238531	3300010403	Terrestrial Soil	YLHSQPGGMMVLTLSGSKVDKITFFADPALPGRFGLPEHI*
Ga0105246_106620511	3300011119	Miscanthus Rhizosphere	GQPAFGCYLRSQPWGMMVLTLSGSQVDEITFFADPALPGRFGLPEHI*
Ga0105246_125888901	3300011119	Miscanthus Rhizosphere	FGCYLRSQPWGMMVLTLSGSKVDEITLFIDPALPGRFGLPEHI*
Ga0137364_106035451	3300012198	Vadose Zone Soil	PWGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0137382_102132651	3300012200	Vadose Zone Soil	SQPRGMMVLTLSGSKVDEITFFADPALPGRLGLPEHI*
Ga0137376_101908484	3300012208	Vadose Zone Soil	RSQPRGMMVLALSGSKVEEITFFADPALPGRFGLPEHI*
Ga0137377_111589511	3300012211	Vadose Zone Soil	PAFGCYLRSQPWGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0137377_115530561	3300012211	Vadose Zone Soil	RSRPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0137370_105373141	3300012285	Vadose Zone Soil	RSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0137370_106832122	3300012285	Vadose Zone Soil	FGYYLRSQPRGMMVLTLSGSKVDEITFFADPALPSRFGLPEHI*
Ga0137387_102170911	3300012349	Vadose Zone Soil	YNIRSRTRGMLLLTPSGSKDDEITFFADPAQPGRFGLPEHI*
Ga0137387_107341243	3300012349	Vadose Zone Soil	RPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0157303_101586391	3300012896	Soil	YVRSQPLGMMVLTLSGSKVDEITLFADPALPGRFGLPEHI*
Ga0157301_102934881	3300012911	Soil	YLRSQPRGMMVLTLSGSKVDDITFFADPALPGRFGLPEHI*
Ga0164241_107058222	3300012943	Soil	YLRSQPWGMMVLTLSGSKVDEITFFADAALPGRFGLPEHI*
Ga0164299_110562941	3300012958	Soil	PAFGYYLRSKPRGMMVLTLSGSKVDEITFFADPALPSRFGLPEHI*
Ga0164299_113587411	3300012958	Soil	QPRGMMVLTLSGSKVDEITFFADPALPGRFGLPGHI*
Ga0164302_103393362	3300012961	Soil	PWGMMVLTLSGSKVDEITFFADTALPSRFGLPEHI*
Ga0126369_105261351	3300012971	Tropical Forest Soil	RSQPWGMIVLTLSGSKVDEITFFIDPALPRRFGLPEHI*
Ga0134110_103896881	3300012975	Grasslands Soil	GYYLRSRPRGMMLLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0164309_102039964	3300012984	Soil	FGYYLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPGHI*
Ga0164309_103070102	3300012984	Soil	CYLRSQPWGMMVLTLSGSKVDEITFFADPALPSRFGLPEHI*
Ga0164309_106799951	3300012984	Soil	PWGMMVLTLSGSTVDEITFFIDPALPCRFGLPEHI*
Ga0164309_107141771	3300012984	Soil	GQPAFGYYLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0164308_120127941	3300012985	Soil	NGQPAFGYYVRSQPRGMMVLTLSGSEVDEITFFADPALPGRFGLPEHI*
Ga0164307_104112021	3300012987	Soil	PAFGYYLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEQI*
Ga0164307_104699621	3300012987	Soil	PRGLMVLTLSGSKVDEITFFADPALPGRFDLPEHI*
Ga0157370_113776312	3300013104	Corn Rhizosphere	SQPRGMIVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0157369_104500982	3300013105	Corn Rhizosphere	LRSQPWGMIVLTLSGNKVDEITFFADPALPGRFGLPGHI*
Ga0157374_113695861	3300013296	Miscanthus Rhizosphere	QPWGMVVLTLSSSEVDGITFFADPALPGRFGLPEHI*
Ga0157378_132622092	3300013297	Miscanthus Rhizosphere	WGMMVLTLSGRKVDEITLFIDPALPGRFGLPEHI*
Ga0157372_104895294	3300013307	Corn Rhizosphere	PRGLMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0157372_118264513	3300013307	Corn Rhizosphere	WGMMVLTLSGSKVDEITLFIDPGLPGRFGLPEHI*
Ga0134081_100973001	3300014150	Grasslands Soil	YLRSQPWGMVVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0134081_102839842	3300014150	Grasslands Soil	QPAFGCYLRSQPWGMMVLTLSGSKVDEITFFADPALPGRFGLPKHI*
Ga0163163_103518424	3300014325	Switchgrass Rhizosphere	YYLRSQPRGMMVLTLRGSKVDEITFFADPALLGRFGLPEHL*
Ga0163163_103766651	3300014325	Switchgrass Rhizosphere	AFGYYLRSQPRGMMVLTLSGSRVDEITFFADPALPGRFGLPEHI*
Ga0163163_127942102	3300014325	Switchgrass Rhizosphere	RSQPWGMMVLTLSGSKVDEITLFIDPALPGRFGLPEHI*
Ga0157379_123800932	3300014968	Switchgrass Rhizosphere	PAFGYYLRSQPRGMMVLTLSGQEVDEITFFADPALPGRFGLPEHI*
Ga0173483_103077301	3300015077	Soil	WGMMALTLSGSKVDEITFFIDPALPGRFDLPEHI*
Ga0173483_103106612	3300015077	Soil	GCYLRSQPWGMMVLTLSGSKVDEITFFANPALPGRFGLPEHI*
Ga0134073_101954241	3300015356	Grasslands Soil	SFGYYLRSQPQGLMVLTLSGSEIDEITFFADPALPGRFGLPEHI*
Ga0132258_108068991	3300015371	Arabidopsis Rhizosphere	AFGYYLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLREHI*
Ga0132256_1026997641	3300015372	Arabidopsis Rhizosphere	AYYLRSQSRGVMVLTLSGSKVADITFFADPTLPGRFGLPEHI*
Ga0132257_1001401486	3300015373	Arabidopsis Rhizosphere	YLRSQPWGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0132257_1002586541	3300015373	Arabidopsis Rhizosphere	CYLRSRPWGMIVLTLSGSKVDEITLFADPALPGRFGLPEHI*
Ga0132257_1019033932	3300015373	Arabidopsis Rhizosphere	GQPAFGCYLRSEPWGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0132255_1002911915	3300015374	Arabidopsis Rhizosphere	RSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLREHI*
Ga0132255_1017052422	3300015374	Arabidopsis Rhizosphere	PAFGYYLRSRPRGMMVLTVSGSKGDEITFFADPALPSRFGLPEHI*
Ga0132255_1026164003	3300015374	Arabidopsis Rhizosphere	AFCCYLRSQPWGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0187776_103355021	3300017966	Tropical Peatland	PWGMMVLTLSGSKVDEITFFADPALPGRFGLPEHV
Ga0187788_105044331	3300018032	Tropical Peatland	FGYYLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI
Ga0187773_110171751	3300018064	Tropical Peatland	AFGCYLRSQPWGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI
Ga0066667_102050693	3300018433	Grasslands Soil	GYYLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI
Ga0066667_108084642	3300018433	Grasslands Soil	RSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI
Ga0066667_109563912	3300018433	Grasslands Soil	RSRPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI
Ga0066662_121392341	3300018468	Grasslands Soil	GQPAFAYYVRAQARGMIVLALSGGEIDEMTYFADPALPARFGLPERI
Ga0066669_112437012	3300018482	Grasslands Soil	GQPAFACYLRSQPWGMIVLTLSGSKIDEITFFADPALPGRFGLPEHI
Ga0190267_100595902	3300019767	Soil	QPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI
Ga0207692_105856362	3300025898	Corn, Switchgrass And Miscanthus Rhizosphere	PAFGYYVRSQPRGIMVLTLSGNKVDGITFFADAALPGRFGLPEHI
Ga0207642_101344061	3300025899	Miscanthus Rhizosphere	LRSEPRGLMVLTLSGSKVDEITFFADPALPGRFGLPEHI
Ga0207647_106764391	3300025904	Corn Rhizosphere	AFGCYLRSQPWGMVVLTLSGSKVDEITFFIDPALPGRFGLPKHI
Ga0207685_100118745	3300025905	Corn, Switchgrass And Miscanthus Rhizosphere	LRSQPWGMMVLTLSGSKVDEITFFADPSLPGRFGLPEHI
Ga0207684_105927023	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	GCYLRSQPWGMMVLTLSGSKVDEITFFIDPALPGRFGLPEHI
Ga0207693_103876473	3300025915	Corn, Switchgrass And Miscanthus Rhizosphere	YLRSQPWGMIVLTLSGSKVDEITFFADPALLGRFGLPEHI
Ga0207693_107992851	3300025915	Corn, Switchgrass And Miscanthus Rhizosphere	YLRSQAWGMMVLTLSGSKVDEITLFADPTLAGRFGLPARI
Ga0207663_114971451	3300025916	Corn, Switchgrass And Miscanthus Rhizosphere	RSQPWGMMVLTLSGSTVDEITFFIDPALPGRFGLPEHI
Ga0207657_107100163	3300025919	Corn Rhizosphere	YLRSQPRGMIVLTLSGSKVDEITFFADPALPGRFGLPEHI
Ga0207646_102050691	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	GQPALGYYLRSRPRGMIVLTLSGSKVDEITFFADPALPGRFGLPEQI
Ga0207681_110840122	3300025923	Switchgrass Rhizosphere	LRSQPRGMMVLTLSGKKVDKITFFADPALPGRFGLPEHI
Ga0207687_102872381	3300025927	Miscanthus Rhizosphere	AFGYYLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI
Ga0207687_110704461	3300025927	Miscanthus Rhizosphere	PAFGYYLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI
Ga0207687_118721302	3300025927	Miscanthus Rhizosphere	CYLRSQPWGMIVLTLSGSKVDEITLFADPALPGRFGLPKHI
Ga0207664_106259971	3300025929	Agricultural Soil	PAFGYYVRSQPRGMMVLTLSGNKVDGITFFADPALPGRFGLPEHI
Ga0207665_114642342	3300025939	Corn, Switchgrass And Miscanthus Rhizosphere	PAFGYYLRSQPRGMMVLTLSGSKVDEITFFADPALPSRFGLPEHL
Ga0207661_103167842	3300025944	Corn Rhizosphere	RSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHL
Ga0207651_109382101	3300025960	Switchgrass Rhizosphere	YLRSQPSGMMVLTLSSSKVDEITFFADPALPVRFGLPEHI
Ga0207668_104505771	3300025972	Switchgrass Rhizosphere	HSQPGGMMVLTLSGSKVDKITFFADPALPGRFGLPEHI
Ga0207702_121240292	3300026078	Corn Rhizosphere	QPRGMIVLTLSGSKVAHITFFDDPALPGRFGLPEHI
Ga0207683_118338422	3300026121	Miscanthus Rhizosphere	PWGMVVLTLSSSKVDGITFFADPALPGRFGLPEHI
Ga0209234_10433811	3300026295	Grasslands Soil	YYLRSQPRGMMVLTLSGSKVDEITFFADPALPSRFGLPEHI
Ga0209160_13408921	3300026532	Soil	RSRPRGMMVLTLNGSKVDEITFFADPALPRRFGLPEHI
Ga0209805_12904641	3300026542	Soil	QPRGMMVLTLSGNKVDEITFFADPALPGRFGLPEHI
Ga0209161_104862812	3300026548	Soil	SQPRGMMVLTLSGSKVEEITFFADPALPGRFGLPEHI
Ga0207626_1026771	3300027465	Soil	QPRGMMVLTLSGSKVDEITFFADPALPGRFGLPERI
Ga0209811_100106305	3300027821	Surface Soil	PRGMMVLTLSGSKVDEITFFADPALPGRFGLPGHI
Ga0209580_102033452	3300027842	Surface Soil	LRAQPWGMIVLTLSGSKVDEITFFADPALPGRFGLPEHI
Ga0307283_100450662	3300028790	Soil	SEPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI
Ga0307499_101613941	3300031184	Soil	RSQPWGMMVLTLSGSKVDEITFFIDPALPGRFGLPEHI
Ga0318534_104088851	3300031544	Soil	YLRSQPWGMVVLTLSGSKVDEITFFADPALPGRFGLPEHI
Ga0318560_106952941	3300031682	Soil	QPRGMMVLTLSGSKVCEITFFADPALPGRFGLPEHI
Ga0310813_114926521	3300031716	Soil	LRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI
Ga0310813_118035851	3300031716	Soil	PWGVIVLTLSGTTIDEITLFADPALLGRFGLPDHI
Ga0310813_123200502	3300031716	Soil	QPAFGCYLRSQAWGMMVLTLSGSKVDEITLFADPTLAGRFGLPARI
Ga0318554_102627031	3300031765	Soil	CYLRSQPWGMMVLTLSGSKVDEITLFADPALPGRFGLPERI
Ga0318498_104868491	3300031778	Soil	PRGMLVLTLSGSKVCEITFFADPALPGRFGLPEHI
Ga0318499_104196612	3300031832	Soil	YLHSQPRGIMVLTLSGSKVDEITFFADPALPGRFGLPEHI
Ga0310907_103134201	3300031847	Soil	YLRSQPRGMMVLTLSGSKVDAITFFADPALPGRFGLPEHI
Ga0310892_103553082	3300031858	Soil	GCYLRSQPWGMMVLTLSGSKVDEITFFADPALPGRFGLPERI
Ga0306919_115336611	3300031879	Soil	FGCYLRSQPWGMMVLTLSGSKVDEITLFADPALLARFGLPEHI
Ga0306925_105085991	3300031890	Soil	RSQPRGMMVLTLSGSKVCEITFFADPALPRRFGLPEHI
Ga0308175_1001604281	3300031938	Soil	PRGMMVLTLSGSKVDEITFFADPALPGRFGLPEQI
Ga0308174_115576202	3300031939	Soil	AFGCYLRSQPWGMMVLTLSGSKVDEITFFADPALPRRFGLPEHI
Ga0308174_116920021	3300031939	Soil	RSQPWGMIVLTLSGSKVDEITFFADPALPGRFGLPEQI
Ga0310884_104703661	3300031944	Soil	QPAFGYYLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI
Ga0310890_103452391	3300032075	Soil	FGYYLRSQPRGIIVLTLSGSKVDEITFFADPALPGRFGLPEHI
Ga0307471_1033263091	3300032180	Hardwood Forest Soil	GYYLRSRPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI
Ga0310810_114485571	3300033412	Soil	PAFGYYLRSQPRGMMVLTLSGNKVDEITFFADPALPGRFSLPEHI
Ga0372943_0159256_3_167	3300034268	Soil	QPAFGYYLRSEPQGMIVLTLSGSTVDKITFFADPALPGRFGLPDHIYSNPGANL

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign