| Basic Information | |
|---|---|
| Family ID | F027541 |
| Family Type | Metagenome |
| Number of Sequences | 194 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MMWTDFIDVMNFIFIANDMWMLWTAFILGGAFIWKIKK |
| Number of Associated Samples | 86 |
| Number of Associated Scaffolds | 194 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 28.50 % |
| % of genes near scaffold ends (potentially truncated) | 45.36 % |
| % of genes from short scaffolds (< 2000 bps) | 84.54 % |
| Associated GOLD sequencing projects | 70 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (72.680 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (30.412 % of family members) |
| Environment Ontology (ENVO) | Unclassified (91.753 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (78.866 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.55% β-sheet: 0.00% Coil/Unstructured: 45.45% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 194 Family Scaffolds |
|---|---|---|
| PF01106 | NifU | 7.73 |
| PF08291 | Peptidase_M15_3 | 4.12 |
| PF00476 | DNA_pol_A | 3.09 |
| PF01612 | DNA_pol_A_exo1 | 1.03 |
| PF00271 | Helicase_C | 1.03 |
| PF11753 | DUF3310 | 0.52 |
| PF00313 | CSD | 0.52 |
| PF04279 | IspA | 0.52 |
| PF00961 | LAGLIDADG_1 | 0.52 |
| PF00856 | SET | 0.52 |
| PF02195 | ParBc | 0.52 |
| PF13361 | UvrD_C | 0.52 |
| PF01510 | Amidase_2 | 0.52 |
| COG ID | Name | Functional Category | % Frequency in 194 Family Scaffolds |
|---|---|---|---|
| COG0694 | Fe-S cluster biogenesis protein NfuA, 4Fe-4S-binding domain | Posttranslational modification, protein turnover, chaperones [O] | 7.73 |
| COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 3.09 |
| COG2917 | Intracellular septation protein A | Cell cycle control, cell division, chromosome partitioning [D] | 0.52 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 72.68 % |
| All Organisms | root | All Organisms | 27.32 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 30.41% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 22.68% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 12.37% |
| Filtered Seawater | Environmental → Aquatic → Marine → Unclassified → Unclassified → Filtered Seawater | 10.82% |
| Marine Oceanic | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic | 5.15% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 3.61% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 2.58% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.06% |
| Hydrothermal Vent Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids | 2.06% |
| Diffuse Hydrothermal Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Fluids | 1.55% |
| Hydrothermal Vent Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Fluids | 1.55% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.03% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 1.03% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Abyssal Plane → Marine | 1.03% |
| Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Sediment | 0.52% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.52% |
| Hydrothermal Vent Plume | Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Hydrothermal Vent Plume | 0.52% |
| Marine, Hydrothermal Vent Plume | Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Marine, Hydrothermal Vent Plume | 0.52% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001516 | Hydrothermal vent plume microbial communities from Tahi Moana, Pacific Ocean, of black smokers | Environmental | Open in IMG/M |
| 3300001719 | Marine viral communities from the Deep Pacific Ocean - MSP-109 | Environmental | Open in IMG/M |
| 3300001726 | Marine viral communities from the Deep Pacific Ocean - MSP-103 | Environmental | Open in IMG/M |
| 3300001727 | Marine viral communities from the Pacific Ocean - LP-55 | Environmental | Open in IMG/M |
| 3300001732 | Marine viral communities from the Deep Pacific Ocean - MSP-97 | Environmental | Open in IMG/M |
| 3300001733 | Marine viral communities from the Deep Pacific Ocean - MSP112 | Environmental | Open in IMG/M |
| 3300001735 | Marine viral communities from the Pacific Ocean - LP-45 | Environmental | Open in IMG/M |
| 3300001738 | Marine viral communities from the Deep Pacific Ocean - MSP-118 | Environmental | Open in IMG/M |
| 3300001739 | Marine viral communities from the Deep Pacific Ocean - MSP-121 | Environmental | Open in IMG/M |
| 3300001743 | Marine viral communities from the Pacific Ocean - LP-38 | Environmental | Open in IMG/M |
| 3300002511 | Marine viral communities from the Pacific Ocean - ETNP_2_1000 | Environmental | Open in IMG/M |
| 3300002760 | Marine viral communities from the Pacific Ocean - ETNP_6_1000 | Environmental | Open in IMG/M |
| 3300003690 | Hydrothermal vent plume microbial communities from the Mid Cayman Rise - Piccard2013-Plume - Viral/microbial metagenome assembly | Environmental | Open in IMG/M |
| 3300005398 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV201 | Environmental | Open in IMG/M |
| 3300005431 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV75 | Environmental | Open in IMG/M |
| 3300005785 | Deep-sea sediment bacterial and archaeal communities from Fram Strait - Hausgarten VI | Environmental | Open in IMG/M |
| 3300005969 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_Bottom_ad_4513_LV_A | Environmental | Open in IMG/M |
| 3300006076 | Microbial communities in diffuse hydrothermal fluids of Manus Basin, Bismarck Sea ? fluid A | Environmental | Open in IMG/M |
| 3300006303 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT234_1_1000m | Environmental | Open in IMG/M |
| 3300006311 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_1_1000m | Environmental | Open in IMG/M |
| 3300006313 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0770m | Environmental | Open in IMG/M |
| 3300006316 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_1_1000m | Environmental | Open in IMG/M |
| 3300006325 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_0500m | Environmental | Open in IMG/M |
| 3300006326 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_1_0770m | Environmental | Open in IMG/M |
| 3300006331 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT233_1_1000m | Environmental | Open in IMG/M |
| 3300006338 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_1_0770m | Environmental | Open in IMG/M |
| 3300006340 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0770m | Environmental | Open in IMG/M |
| 3300006341 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT236_2_0770m | Environmental | Open in IMG/M |
| 3300006347 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_1000m | Environmental | Open in IMG/M |
| 3300006654 | Combined Assembly of Gp0125100, Gp0113270, Gp0125099 | Environmental | Open in IMG/M |
| 3300006900 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_Bottom_ad_5009_LV_A | Environmental | Open in IMG/M |
| 3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
| 3300008216 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_Geostar | Environmental | Open in IMG/M |
| 3300008218 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s6 | Environmental | Open in IMG/M |
| 3300009030 | Deep subsurface microbial communities from Kermadec Trench to uncover new lineages of life (NeLLi) - N075 metaG | Environmental | Open in IMG/M |
| 3300009412 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s2 | Environmental | Open in IMG/M |
| 3300009413 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12 | Environmental | Open in IMG/M |
| 3300009595 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3635_2500 | Environmental | Open in IMG/M |
| 3300009622 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3321_4155 | Environmental | Open in IMG/M |
| 3300017715 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_06 viral metaG | Environmental | Open in IMG/M |
| 3300020262 | Marine microbial communities from Tara Oceans - TARA_B100000097 (ERX556100-ERR599172) | Environmental | Open in IMG/M |
| 3300020444 | Marine microbial communities from Tara Oceans - TARA_B100001245 (ERX556114-ERR598980) | Environmental | Open in IMG/M |
| 3300020447 | Marine microbial communities from Tara Oceans - TARA_B100000745 (ERX556090-ERR599159) | Environmental | Open in IMG/M |
| 3300021973 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Alice_FS923 _150kmer | Environmental | Open in IMG/M |
| 3300021978 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Perseverance_CTD_V16A_01_btl17 _150kmer | Environmental | Open in IMG/M |
| 3300021979 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Hafa_FS926 _150kmer | Environmental | Open in IMG/M |
| 3300022225 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014_SV_400_PacBio MetaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300024431 | Deep subsurface microbial communities from Kermadec Trench to uncover new lineages of life (NeLLi) - N075 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025029 | Marine viral communities from the Pacific Ocean - LP-39 (SPAdes) | Environmental | Open in IMG/M |
| 3300025044 | Marine viral communities from the Pacific Ocean - LP-50 (SPAdes) | Environmental | Open in IMG/M |
| 3300025046 | Marine viral communities from the Pacific Ocean - LP-45 (SPAdes) | Environmental | Open in IMG/M |
| 3300025049 | Marine viral communities from the Pacific Ocean - LP-55 (SPAdes) | Environmental | Open in IMG/M |
| 3300025125 | Marine viral communities from the Pacific Ocean - ETNP_2_1000 (SPAdes) | Environmental | Open in IMG/M |
| 3300025216 | Marine viral communities from the Deep Pacific Ocean - MSP-109 (SPAdes) | Environmental | Open in IMG/M |
| 3300025218 | Marine viral communities from the Deep Pacific Ocean - MSP-103 (SPAdes) | Environmental | Open in IMG/M |
| 3300025236 | Marine viral communities from the Deep Pacific Ocean - MSP-144 (SPAdes) | Environmental | Open in IMG/M |
| 3300025241 | Marine viral communities from the Deep Pacific Ocean - MSP-121 (SPAdes) | Environmental | Open in IMG/M |
| 3300025244 | Marine viral communities from the Deep Pacific Ocean - MSP-81 (SPAdes) | Environmental | Open in IMG/M |
| 3300025247 | Marine viral communities from the Deep Pacific Ocean - MSP-91 (SPAdes) | Environmental | Open in IMG/M |
| 3300025248 | Marine viral communities from the Deep Pacific Ocean - MSP-118 (SPAdes) | Environmental | Open in IMG/M |
| 3300025251 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 (SPAdes) | Environmental | Open in IMG/M |
| 3300025264 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025267 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_Geostar (SPAdes) | Environmental | Open in IMG/M |
| 3300025274 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_51 (SPAdes) | Environmental | Open in IMG/M |
| 3300025277 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 (SPAdes) | Environmental | Open in IMG/M |
| 3300025281 | Marine viral communities from the Deep Pacific Ocean - MSP-97 (SPAdes) | Environmental | Open in IMG/M |
| 3300025286 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_215 (SPAdes) | Environmental | Open in IMG/M |
| 3300025287 | Marine viral communities from the Deep Pacific Ocean - MSP-131 (SPAdes) | Environmental | Open in IMG/M |
| 3300025300 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s6 (SPAdes) | Environmental | Open in IMG/M |
| 3300025873 | Marine viral communities from the Pacific Ocean - ETNP_6_1000 (SPAdes) | Environmental | Open in IMG/M |
| 3300026079 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_Bottom_ad_4513_LV_A (SPAdes) | Environmental | Open in IMG/M |
| 3300026080 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_NADW_ad_2500m_LV_A (SPAdes) | Environmental | Open in IMG/M |
| 3300026087 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_NADW_ad_2505m_LV_A (SPAdes) | Environmental | Open in IMG/M |
| 3300026103 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3321_4155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026253 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_Bottom_ad_5009_LV_A (SPAdes) | Environmental | Open in IMG/M |
| 3300028022 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750m | Environmental | Open in IMG/M |
| 3300031800 | Marine microbial communities from Western Arctic Ocean, Canada - CB6_Bottom_1051 | Environmental | Open in IMG/M |
| 3300031802 | Marine microbial communities from Western Arctic Ocean, Canada - CB6_AW_1057 | Environmental | Open in IMG/M |
| 3300031803 | Marine microbial communities from Western Arctic Ocean, Canada - CB27_AW_983 | Environmental | Open in IMG/M |
| 3300032820 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MG | Environmental | Open in IMG/M |
| 3300034628 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 543_2961 | Environmental | Open in IMG/M |
| 3300034629 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 543_2600 | Environmental | Open in IMG/M |
| 3300034654 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 487_2244 | Environmental | Open in IMG/M |
| 3300034655 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 494_2800 | Environmental | Open in IMG/M |
| 3300034656 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 502_2477 | Environmental | Open in IMG/M |
| 3300034658 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 524_CTD | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| TahiMoana_10636882 | 3300001516 | Hydrothermal Vent Plume | MLTSVIDVMNFIFIANDMWMLWTAFILGAAFIWKIKK* |
| JGI24654J20067_10062725 | 3300001719 | Deep Ocean | MMLSDFIDVMNFIFIANDMWMLWIAFILGGAFIWKIKK* |
| JGI24653J20064_100090214 | 3300001726 | Deep Ocean | MWTDFINVMNFIFIANDMWLLWTAFIVGAAFGWKIKK* |
| JGI24653J20064_10037675 | 3300001726 | Deep Ocean | MMLSDFIDVMNFIFIANDMWMLWTAFILGGAFIWKIKK* |
| JGI24653J20064_10054464 | 3300001726 | Deep Ocean | MWIDFINVMNFIFIANDMWLLWTAFIVGAAFGWKIKK* |
| JGI24653J20064_10077294 | 3300001726 | Deep Ocean | DFIDVMNFIFIANDMWMLWTAFILGGAFVWKIKK* |
| JGI24653J20064_10225322 | 3300001726 | Deep Ocean | DFINVMNFIFIANDMWLLWTAFIVGAALAWKIKK* |
| JGI24529J20061_1004234 | 3300001727 | Marine | MMLSDFIDVMNFIFIANDMWMLWTAFILGGAFIWTIKK* |
| JGI24529J20061_1091721 | 3300001727 | Marine | WTDFIDVMNFIFIANDMWMLWTAFILGGAFIWKIKK* |
| JGI24652J20063_10304292 | 3300001732 | Deep Ocean | MMWTDVINVMNFIFIANDMWMLWTAFVLGGAFIWKIKK* |
| JGI24655J20075_10084792 | 3300001733 | Deep Ocean | MWTDFINVMNFIFIANDMWLLWTAFIVGAALAWKIKK* |
| JGI24655J20075_10097333 | 3300001733 | Deep Ocean | MRWTDVIDVMNFIFIANDMWMMWTGFILGIALIWKIKK* |
| JGI24655J20075_10249962 | 3300001733 | Deep Ocean | MWTDFIDVMNFIFIANDMWMLWTAFILGGAFVWKIGLNGS* |
| JGI24520J20079_10074971 | 3300001735 | Marine | MMWTDLIDIMNFIFIANDMWMLWTAFILGGAFIWKIK |
| JGI24520J20079_10111081 | 3300001735 | Marine | MLWTDVIDVLNFIFIANDMWMLWTAFILGGTFVWKIKK* |
| JGI24520J20079_10113571 | 3300001735 | Marine | FPTKMMWTDFIDVMNFIFIANDMWMLWTGFILGGAFIWKIKK* |
| JGI24657J20077_10267491 | 3300001738 | Deep Ocean | DVINVMNFIFIANDMWMLWTAFILGGAFIWKIKK* |
| JGI24657J20077_10273573 | 3300001738 | Deep Ocean | LMMWTDFIDVMNFIFIANDMWMLWTAFILGGAFIWKIKK* |
| JGI24657J20077_10331652 | 3300001738 | Deep Ocean | LLNDFINVMNFIFIANDMWMLWTAFVLGGAFIWKIKK* |
| JGI24658J20074_10061765 | 3300001739 | Deep Ocean | MMLSDFIDVMNFIFIANDMWMLWIAFILGGAFIWKVKK* |
| JGI24515J20084_10048142 | 3300001743 | Marine | MWTDFIDVMNFIFIASDMWMLWTAFILGGAFIWKIKK* |
| JGI25131J35506_10332551 | 3300002511 | Marine | LIMMWTDFVDVMNFIFIANDMWMMWTGFILGVALIWKIKK* |
| JGI25131J35506_10521882 | 3300002511 | Marine | GYNILMMWTDFIDVMNFIFIANDMWMLWTAFILGGAFIWKIKK* |
| JGI25136J39404_10660342 | 3300002760 | Marine | MIWTDFIDVMNFIFIANDAWMFWSAFIIANDAWMFWSAFILGGTLIWNIKK* |
| PicViral_10060517 | 3300003690 | Marine, Hydrothermal Vent Plume | MWTDFINVMNFIFIANDMWLLWTAFIVGAAFGWKIKKLKK* |
| Ga0066858_102542912 | 3300005398 | Marine | MMWTDIIDFMNFTFIANDAWIFWLVFILGTSLIWTIKENK* |
| Ga0066854_101142651 | 3300005431 | Marine | MMWTDLIDVMNFIFIANDAWMWWLAFILGASLIWNIKDSK* |
| Ga0078432_1161834 | 3300005785 | Sediment | MLSDFINVMNFIFIANDMWMLWTAFILGGAFIWKIKK* |
| Ga0066369_100756823 | 3300005969 | Marine | MMWADVINVMNFIFIANDMWMLWTAFILGGAFIWKIKK* |
| Ga0066369_102253361 | 3300005969 | Marine | MMWTDVIDIMNFIFIANDMWMMWTGFILGIALIWKIKK* |
| Ga0066369_102343133 | 3300005969 | Marine | DVIDVMNFIFIANDMWMLWTAFILGGAFVWKIKK* |
| Ga0081592_10531871 | 3300006076 | Diffuse Hydrothermal Fluids | MMWTDFIDVMNFIFITNDMWMLWIAFILGGAFIWKIKK* |
| Ga0081592_10714913 | 3300006076 | Diffuse Hydrothermal Fluids | MLLNDFIDVMNFIFIANDMWMLWTAFILGAAFIWKIKK* |
| Ga0081592_11565522 | 3300006076 | Diffuse Hydrothermal Fluids | MWTDFIDVMNFIFIANDMWMLWIAFVLGGAFIWKIKK* |
| Ga0068490_11204404 | 3300006303 | Marine | KMMWNDFIDVMNFIFIANDMWMLWTAFVLGGAFIWKIKK* |
| Ga0068478_11353165 | 3300006311 | Marine | MMWTDFVDVMNFIFIANDMWMMWTGFILGVALIWKIKK* |
| Ga0068472_105376824 | 3300006313 | Marine | MMWTDVIDVMNFIFIANDMWMLWTAFILGAAFIWKIKK* |
| Ga0068473_13969033 | 3300006316 | Marine | MWTDFIDVMNFIFIANDMWMLWTAFVLGGAFVWKIKK* |
| Ga0068473_14181053 | 3300006316 | Marine | MMLNDFLDVMNFIFIANDMWMLWTAFILGGAFIWKIKK* |
| Ga0068473_15444322 | 3300006316 | Marine | MMLTDFIDVMNFIFIANDMWMLWTAFVLGGAFVWKIKK* |
| Ga0068501_12667636 | 3300006325 | Marine | NDFIDVMNFIFITNDMWMLWTAFILGGAFIWKIKK* |
| Ga0068477_12137566 | 3300006326 | Marine | MWTDFIDVMNFIFIANDMWMLWTAFILGGVFIWKIKK* |
| Ga0068488_13171462 | 3300006331 | Marine | MMWTDVIDIMNFIFIANDMWMLWTAFILGGAFIWNIK* |
| Ga0068488_13270821 | 3300006331 | Marine | MWTDFIDVMNFIFIANDMWMLWTAFILGGAFVWKIKK* |
| Ga0068488_13527392 | 3300006331 | Marine | MWTDFIDVMNFIFIANDMWMLWSAFILGGAFVWKIKK* |
| Ga0068482_16231083 | 3300006338 | Marine | MIWTDIIDVMNFIFIANDVWMFWVAFILGGALIWNIN* |
| Ga0068482_16296452 | 3300006338 | Marine | MMWTDFIDVMNFIFIANDMWMLWTAFILGGAFVWKIKK* |
| Ga0068503_1022261011 | 3300006340 | Marine | MMLNDFLDVMNFIFIANDMWMLWTAFVLGAAFVWKIKK* |
| Ga0068503_103161712 | 3300006340 | Marine | MWNDFIDVMNFIFIANDMWMLWTAFILGGAFIWKIKK* |
| Ga0068503_104262683 | 3300006340 | Marine | MTSVIDVMNFIFIAYDMWMLWTAFILGGAFVWKIKK* |
| Ga0068503_104375687 | 3300006340 | Marine | MLTSVIDVMNFIFIANDMWMLWTAFILGGAFIWKIKK* |
| Ga0068503_104387105 | 3300006340 | Marine | MMWTDVMNVMNFIFIANDMWMLWTAFILGGAFVWKIKKWH* |
| Ga0068503_104527155 | 3300006340 | Marine | MLTDFIDVMNFIFIANDMWMLWTAFVLGGAFIWKIKK* |
| Ga0068503_104694813 | 3300006340 | Marine | MDEKMMWNDFIDVMNFIFIANDMWMLWTAFILGGAFIWKIKK* |
| Ga0068503_104719271 | 3300006340 | Marine | SYYANILMMWTDFINVMNFIFIANDAWMFWLAFILGGTLIWNIKK* |
| Ga0068503_105902243 | 3300006340 | Marine | MWTDFIDVMNFIFITNDMWMLWTAFVLGGAFIWKIKK* |
| Ga0068503_106327193 | 3300006340 | Marine | MWTDFIDVMNFIFIANDMWLLWIAFNLAGAFIWKIKK* |
| Ga0068503_111229522 | 3300006340 | Marine | MMWTDFIDVMNFIFIANDMWMLWTGFILGGAFVWKIKK* |
| Ga0068493_103641753 | 3300006341 | Marine | MMWTDVINVMNFIFIANDMWMLWTAFILGGAFVWKIKKWH* |
| Ga0068493_104318923 | 3300006341 | Marine | MLNDFIDVMNFIFIANDMWMLWTAFILGGAFVWKIKK* |
| Ga0068493_104807164 | 3300006341 | Marine | MMWTDVVDVMNFIFIANDMWMMWTGFILGVALIWKIKK* |
| Ga0068493_105857153 | 3300006341 | Marine | MMWTDFIEVMNFIFIANDMWMLWTAFVLGGAFIWKI |
| Ga0099697_14388842 | 3300006347 | Marine | MWNDFIDVMNFIFIANDMWMLWSAFILGGAFVWKIKK* |
| Ga0101728_10102816 | 3300006654 | Marine | MMLNDFIDVMNFIFIANDMWMLWTAFILGGAFIWKIKK* |
| Ga0101728_10199011 | 3300006654 | Marine | MLTDFINVMNFIFIANDMWMLWTAFILGGAFIWKIKK* |
| Ga0066376_100429282 | 3300006900 | Marine | MWTDFINVVNFIFIANDMWLLWTAFFVGAALGWKIKK* |
| Ga0066376_104204151 | 3300006900 | Marine | KMMWTDVIDVMNFIFIANDMWMMWTGFILGVALIWKIKK* |
| Ga0075444_101582594 | 3300006947 | Marine | MLNDFLDVMNFIFIANDMWMLWTAFILGGAFIWKIKK* |
| Ga0114898_10504952 | 3300008216 | Deep Ocean | MMLNDFLDVMNFIFIANDMWMLWTAFILGGAFVWKIKK* |
| Ga0114898_10663265 | 3300008216 | Deep Ocean | MMWTDFIDVMNFIFIANDMWMLWTAFILGGAFIWKIKK* |
| Ga0114898_11134792 | 3300008216 | Deep Ocean | MWTDFIDVMNFIFIANDAWMFWLAFILGGTLIWNIKK* |
| Ga0114904_11679611 | 3300008218 | Deep Ocean | MMWTDFIDVMNFIFIANDAWMFWLAFILGGTLIWNIKK*N |
| Ga0114950_107193774 | 3300009030 | Deep Subsurface | MWADAIDIMNFIFIANDIWMMWTGFILGIALIWNIKK |
| Ga0114903_10324621 | 3300009412 | Deep Ocean | MWTDFIDVMNFIFIANDAWMFWLAFILGGTLIWNIKK |
| Ga0114902_10059111 | 3300009413 | Deep Ocean | MMWTDFIDVMNFIFIANDAWMFWLAFILGGTLIWNIKK* |
| Ga0105214_1020872 | 3300009595 | Marine Oceanic | MWTDFINVVDFIFIANDMWLLWTAFIVGAAFGWKIKK* |
| Ga0105173_10054793 | 3300009622 | Marine Oceanic | MGKTMEKMMWTDFIDIMNFIFIANDMWMMWTGFILGVALIWKIKK* |
| Ga0105173_10209981 | 3300009622 | Marine Oceanic | VVNIPMMWTDVIDVMNFIFIANDMWMLWTAFILGGAFIWKIKK* |
| Ga0105173_10345322 | 3300009622 | Marine Oceanic | MMWTDVINVMNFIFIANDMWMLWTAFILGGAFIWKIKK* |
| Ga0105173_10516442 | 3300009622 | Marine Oceanic | MMWTDFINVMNFIFIANDMWLLWTTFIVGIAFGWKIKK* |
| Ga0105173_10629562 | 3300009622 | Marine Oceanic | MLTDVIDVMNFIFIANDMWMLWTAFILGGAFIWKIKK* |
| Ga0105173_10702263 | 3300009622 | Marine Oceanic | DFIDIMNFIFIANDMWMMWTGFILGIALIWKIKK* |
| Ga0105173_10855831 | 3300009622 | Marine Oceanic | WTDFIDVMNFIFIANDMWMLWTGFILGGAFIWKIKK* |
| Ga0181370_10173871 | 3300017715 | Marine | TDIIDFMNFTFIANDAWIFWLVFILGTSLIWTIKENK |
| Ga0211537_10217824 | 3300020262 | Marine | MMWTDIIDFMNFTFIANDAWIFWLVFILGTSLIWTIKENK |
| Ga0211578_102337304 | 3300020444 | Marine | MMWTDIIDFMNFIFIANDAWIFWLVFILGTSLIWTIKESK |
| Ga0211691_101411073 | 3300020447 | Marine | MMWTDIIDFMNLIFIANDAWMFWLVFILGTSLIWTIKESK |
| Ga0232635_10519931 | 3300021973 | Hydrothermal Vent Fluids | MMLNDFIDVMNFIFIANDMWMLWTAFILGGAFIWKIKK |
| Ga0232646_10226561 | 3300021978 | Hydrothermal Vent Fluids | KMMWTDVINVMNFIFIANDMWMLWTAFVLGGAFIWKIKK |
| Ga0232646_10538703 | 3300021978 | Hydrothermal Vent Fluids | MLNDFIDVMNFIFIANDMWMLWTAFILGGAFIWKIKK |
| Ga0232646_11705701 | 3300021978 | Hydrothermal Vent Fluids | MLTDFINVMNFIFIANDMWMLWTAFILGGAFIWKIK |
| Ga0232641_11598093 | 3300021979 | Hydrothermal Vent Fluids | MMWTDVIDVMNFIFIANDMWMLWTAFILGGAFVWKIKK |
| Ga0232641_12138483 | 3300021979 | Hydrothermal Vent Fluids | MWTDVINVMNFIFIANDMWMLWTAFILGGAFIWKIKK |
| Ga0232641_12930933 | 3300021979 | Hydrothermal Vent Fluids | IKITVVNIPMMWTDVINVMNFIFIANDMWMLWTAFILGGAFIWKIKK |
| Ga0187833_104375273 | 3300022225 | Seawater | MMWTDIIDFMNFTFIANDAWIFWLVFILGASLIWTIKESK |
| Ga0209988_102179671 | 3300024431 | Deep Subsurface | MMLNDFLDVMNFIFIANDMWMLWTAFILGAAFIWKIKK |
| Ga0207900_1086104 | 3300025029 | Marine | MLTDFIDVMNFIFIANDMWMLWTAFVLGGAFIWKIKK |
| Ga0207900_1222001 | 3300025029 | Marine | MMWNDFIDVMNFIFIANDVWMFWVAFILGGTLIWN |
| Ga0207891_10316191 | 3300025044 | Marine | MLNDVIDVMNFIFIANDMWMLWTAFILGGAFIWKIKK |
| Ga0207902_10134703 | 3300025046 | Marine | MMLSDFIDVMNFIFIANDMWMLWIAFILGGAFIWKVKK |
| Ga0207902_10139762 | 3300025046 | Marine | MMLNDFIDVMNFIFIANDMWMLWTAFIFGGAFIWKIKK |
| Ga0207902_10249223 | 3300025046 | Marine | TDFIDVMNFIFIANDMWMLWTAFILGGTFIWKIKK |
| Ga0207902_10250392 | 3300025046 | Marine | MMWTDFINVLNFIFIANDMWLLWTAFIVGAAFGWKIKK |
| Ga0207902_10410733 | 3300025046 | Marine | MIWTDFVDVMNFIFIANDMWMLWIAFVLGGACIWKIKK |
| Ga0207902_10416541 | 3300025046 | Marine | MWTDFIDVMNFIFIANDMWMLWTAFVLGGAFIWKIKK |
| Ga0207898_10100121 | 3300025049 | Marine | LIMWTDFIDVMNFIFIANDMWMLWTAFVLGGAFVWKIKK |
| Ga0207898_10311253 | 3300025049 | Marine | MMWTDVVDVMNFIFIANDMWMMWTGFILGVALIWKIK |
| Ga0209644_10022277 | 3300025125 | Marine | MMWTDFIDVMNFIFIANDMWMLWSAFVLGGAFVWKIKK |
| Ga0209644_10035683 | 3300025125 | Marine | MTSVIDVMNFIFIANDMWMLWTAFILGGAFIWKIKK |
| Ga0209644_10087652 | 3300025125 | Marine | MWNDFIDVMNFIFIANGAWMFWLAFILGGTLVWNIKK |
| Ga0209644_10162543 | 3300025125 | Marine | MWTDVINVMNFIFIANDMWMLWTGFILGAAFIWKIKK |
| Ga0209644_10337674 | 3300025125 | Marine | YNILMMWTDFIDVMNFIFIANDMWMLWTAFILGGAFVWKIKK |
| Ga0209644_10343683 | 3300025125 | Marine | MMWNDFIDVMNFIFIANDMWMLWTAFILGGALVWKIKK |
| Ga0209644_10910161 | 3300025125 | Marine | LMMWTDVIDVMNFIFIANDMWMLWTAFILGGAFIWKIKK |
| Ga0209644_11105702 | 3300025125 | Marine | MMWTDFIDVMNFIFIANDMWMLWTAFVLGGVVVWKIKK |
| Ga0209644_11412793 | 3300025125 | Marine | MLTSVVDVMNFIFIANDMWMLWTAFILGGAFIWKIKK |
| Ga0209644_11531641 | 3300025125 | Marine | MWTDFVDVMNFIFIANDMWMMWTGFILGVAFIWKIKK |
| Ga0209644_11564092 | 3300025125 | Marine | NILMMLTDFIDVMNFIFITNDMWMLWTAFILGGAFIWKIKK |
| Ga0209644_11595442 | 3300025125 | Marine | IFSYNGGFLMMWTDVIDVMNFIFIANDMWMLWTAFILGGAFVWKIKK |
| Ga0207883_10078753 | 3300025216 | Deep Ocean | MMLTDFINVMNFIFIANDMWMLWTAFILGGAFIWKIKK |
| Ga0207882_10044616 | 3300025218 | Deep Ocean | MWTDFINVMNFIFIANDMWLLWTAFIVGAAFGWKIKK |
| Ga0207882_10083574 | 3300025218 | Deep Ocean | TKKMMWTDVINVMNFIFIANDMWMLWTAFILGGAFIWKIKK |
| Ga0207882_10311121 | 3300025218 | Deep Ocean | NDFINVMNFIFIANDMWMLWTAFVLGGAFIWKIKK |
| Ga0207884_10198973 | 3300025236 | Deep Ocean | MMLNDFINVMNFIFIANDMWMLWTAFILGGAFIWKIKK |
| Ga0207884_10491061 | 3300025236 | Deep Ocean | KIRGRRRLMMWTDFIDVMNFIFIANDMWMLWTAFVLGGAFIWKIKK |
| Ga0207893_10027614 | 3300025241 | Deep Ocean | MMLSDFIDVMNFIFIANDMWMLWTAFILGGAFIWKIKK |
| Ga0207893_10360861 | 3300025241 | Deep Ocean | WTDFINVMNFIFIANDMWLLWTAFIVGAAFGWKIKK |
| Ga0207908_10330673 | 3300025244 | Deep Ocean | MWTDVIDVMNFIFIANDMWMMWTGFILGIALIWNIKK |
| Ga0207880_10436322 | 3300025247 | Deep Ocean | MWADAIDIMNFIFIANDMWMMWTGFILGIALIWNIKK |
| Ga0207904_10339751 | 3300025248 | Deep Ocean | KMMWTDVINVMNFIFIANDMWMLWTAFILGGAFIWKIKK |
| Ga0208182_100073819 | 3300025251 | Deep Ocean | MMMWTDFIDVMNFIFIANDAWMFWLAFILGGTLIWNIKK |
| Ga0208029_10066812 | 3300025264 | Deep Ocean | MMWTTDFIDVMNFIFIANDAWMFWLAFILGGTLIWNIKK |
| Ga0208179_100841011 | 3300025267 | Deep Ocean | LMMWTDFIDVMNFIFIANDAWMFWLAFILGGTLIWNIKK |
| Ga0208179_10280302 | 3300025267 | Deep Ocean | MLNDFLDVMNFIFIANDMWMLWTAFILGGAFVWKIKK |
| Ga0208183_10001784 | 3300025274 | Deep Ocean | MMWTDFIDVMNFIFIANDAWMFWLAFILGGTLIWNIKK |
| Ga0208180_10357953 | 3300025277 | Deep Ocean | MMLNDFLDVMNFIFIANDMWMLWTAFILGGAFVWKIKK |
| Ga0207881_10094106 | 3300025281 | Deep Ocean | TWTDVIDVMNFIFIANDMWMLWTAFILGGAFVWKIKK |
| Ga0208315_10248571 | 3300025286 | Deep Ocean | MMWTDFIDVMNFIFIANDAWMFWLAFILGGTLIWN |
| Ga0207903_10348913 | 3300025287 | Deep Ocean | TTVVNIPMMWTDVIDVMNFIFIANDMWMLWTAFILGGAFIWKIKK |
| Ga0207903_10448691 | 3300025287 | Deep Ocean | MLLNDFIDVMNFIFIANDMWMLWTAFVLGGAFIWKI |
| Ga0207903_10486473 | 3300025287 | Deep Ocean | YLMMWTDFIDVMNFIFIANDMWMLWTAFILGGAFVWKIKK |
| Ga0207903_10645493 | 3300025287 | Deep Ocean | RLMMWTDFIDVMNFIFIANDMWMLWTAFILGGAFIWKIKK |
| Ga0208181_11142721 | 3300025300 | Deep Ocean | MMWTDFIDVMNFIFIANDAWMFWLAFILGGTLIWNIKKXNG |
| Ga0209757_100119437 | 3300025873 | Marine | MMWTDVINVMNFIFIANDMWMMWTGFILGVALIWKIKK |
| Ga0209757_100153522 | 3300025873 | Marine | MWTDFLDVMNFIFIANDMWMLWTAFILGGAFVWKIKK |
| Ga0209757_100449534 | 3300025873 | Marine | MMWTDFIDVMNFIFIANDMWMLWTAFILGGVFIWKIKK |
| Ga0209757_100552013 | 3300025873 | Marine | MMWTDVINVMNFIFIANDMWMLWTGFILGAAFIWKIKK |
| Ga0209757_100648194 | 3300025873 | Marine | IMLTSVIDVMNFIFIANDMWMLWTAFVLGGAFIWKIKK |
| Ga0209757_100742923 | 3300025873 | Marine | MWTDFIDVMNFIFIANGVWMYWLAFILGGAFIWKIKK |
| Ga0209757_101263142 | 3300025873 | Marine | MLWTDFIDVMNFIFIANDMWMLWTAFILGGAFVWKIKK |
| Ga0209757_101881763 | 3300025873 | Marine | MWNDFIDVMNFIFIANDMWMLWTAFVLGGAFVWKIKK |
| Ga0209757_102049582 | 3300025873 | Marine | MWTDFIDVMNFIFIANDMWMLWTAFVLGGVVVWKIKK |
| Ga0209757_102222891 | 3300025873 | Marine | SYYDNILMMWTDFIDVMNFIFIANDMWMLWTAFVLGGAFIWKIKK |
| Ga0209757_102784562 | 3300025873 | Marine | MWNDFIDVMNFIFIANDMWMLWAAFILGGAFVWKIKK |
| Ga0209757_102834432 | 3300025873 | Marine | ILMMWTDFIDVMNFIFIANDMWMLWTAFILGGAFIWKIKK |
| Ga0208748_10900491 | 3300026079 | Marine | QILMMWTDFINVMNFIFIANDMWLLWTTFIVGIAFGWKIKK |
| Ga0207963_10274606 | 3300026080 | Marine | LLNDFIDVMNFIFIANDMWMLWTAFVLGGAFIWKIKK |
| Ga0207963_10935571 | 3300026080 | Marine | TDFIDVMNFIFIANDMWMLWTAFVLGGAFIWKIKK |
| Ga0208113_10478223 | 3300026087 | Marine | MWTDFIDVMNFIFITNDMWMLWTAFILGGAFIWKIKK |
| Ga0208451_10188371 | 3300026103 | Marine Oceanic | MEKMMWTDFIDIMNFIFIANDMWMMWTGFILGVALIWKIKK |
| Ga0208451_10544001 | 3300026103 | Marine Oceanic | PMMWTDVIDVMNFIFIANDMWMLWTAFILGGAFIWKIKK |
| Ga0208879_10446589 | 3300026253 | Marine | MMWTDFINVMNFIFIANDMWLLWTTFIVGIAFGWKIKK |
| Ga0208879_11460473 | 3300026253 | Marine | MWTDVIDVMNFIFIANDMWMLWIAFVLGGAFVWKIKK |
| Ga0208879_12852231 | 3300026253 | Marine | MMWADVINVMNFIFIANDMWMLWTAFILGGAFIWKIKK |
| Ga0256382_10041553 | 3300028022 | Seawater | RLMIWTDFIDVMNFIFIANDMWMLWTAFILGGAFIWKIKK |
| Ga0310122_100582801 | 3300031800 | Marine | IWTDFINVMNFIFIANDMWLLWTAFIVGIAFGWKIKK |
| Ga0310122_102536152 | 3300031800 | Marine | MLNDFINVMNFIFIANDMWMLWTAFVLGGAFIWKIKK |
| Ga0310122_102565173 | 3300031800 | Marine | MLNDFINVMNFIFIANDMWMLWTAFILGGAFIWKIKK |
| Ga0310123_102611352 | 3300031802 | Marine | MMLNDFIDVMNFIFIANDMWMLWTAFVLGGAFIWKIKK |
| Ga0310123_105120532 | 3300031802 | Marine | MIWTDFINVMNFIFIANDMWLIWAAFIVGAAIGWKI |
| Ga0310123_105729361 | 3300031802 | Marine | IMWTDFIDIMNFIFIANDMWMLWTAFILGGAFIWKIKK |
| Ga0310120_105850213 | 3300031803 | Marine | TDFINVMNFIFIANDMWMLWTAFIVGAALGWRIKK |
| Ga0310342_1014403151 | 3300032820 | Seawater | MIWTDVIDVMNFIFIASDMWMLWTAFILGGAFIWK |
| Ga0326755_001281_2853_2969 | 3300034628 | Filtered Seawater | MMWNDVIDVMNFIFIANDMWMLWTAFILGGAFVWKIKK |
| Ga0326755_010297_33_146 | 3300034628 | Filtered Seawater | MWTDVINVMNFIFIANGMWMLWTAFILGGAFIWKIKK |
| Ga0326755_023534_1_108 | 3300034628 | Filtered Seawater | MMWTDVINVINFIFIANDAWMFWLAFILGGTLIWNI |
| Ga0326756_003351_761_877 | 3300034629 | Filtered Seawater | MMLNNVIDVMNFIFIANDMWMLWTAFILGGAFIWKVKK |
| Ga0326756_004569_39_152 | 3300034629 | Filtered Seawater | MWADVIDVMNFIFIANDMWMMWTGFILGVALIWNIKK |
| Ga0326756_017530_3_119 | 3300034629 | Filtered Seawater | MMWTDFIDVMNFIFIANDMWMLWTAFILGATFIWKIKK |
| Ga0326756_021874_1_114 | 3300034629 | Filtered Seawater | MMWTDVIDVMNFIFIANDMWMMWTGFILGVALIWKIKK |
| Ga0326756_036732_486_596 | 3300034629 | Filtered Seawater | WTDFIDVMNFIFIANDMWMLWTAFILGGAFIWKIKK |
| Ga0326756_037856_2_112 | 3300034629 | Filtered Seawater | WTDVIDVMNFIFIANDMWMMWTGFILGVALIWKIKK |
| Ga0326756_047282_1_108 | 3300034629 | Filtered Seawater | TDFIDVMNFIFIANDMWMLWTAFILGGAFIWKIKK |
| Ga0326741_021086_3_116 | 3300034654 | Filtered Seawater | MMWTDFLDVMNFIFIANDMWMLWTAFVLGGAFIWKIKK |
| Ga0326741_045127_73_186 | 3300034654 | Filtered Seawater | MWTDFIDVMNFIFIANGMWMLWTAFVLGGAFIWKIKK |
| Ga0326741_047752_1_117 | 3300034654 | Filtered Seawater | MLWTDFIDVMNFIFIANDMWMLWTAFVLGGAFIWKIKK |
| Ga0326741_050988_128_244 | 3300034654 | Filtered Seawater | MLLNDFLDVMNFIFIANDMWMLWAAFILGGAFIWKIKK |
| Ga0326741_088857_3_125 | 3300034654 | Filtered Seawater | FLMMWTDVIDVLNFIFIANDMWMLWTAFILGGTFVWKIKK |
| Ga0326746_011698_642_755 | 3300034655 | Filtered Seawater | MWNDVIDVMNFIFIANDMWMLWTAFVLGGAFIWKIKK |
| Ga0326746_029268_468_575 | 3300034655 | Filtered Seawater | GGEGDVMNFIFIANDMWMLWTAFVLGGAFIWKIKK |
| Ga0326748_026442_663_788 | 3300034656 | Filtered Seawater | RRLMMWTDVIDVMNFIFIANDMWMLWTAFILGGAFVWKIKK |
| Ga0326748_046015_2_130 | 3300034656 | Filtered Seawater | FTKKMMWTDVIHVMNFIFIANDMWMLWTALILGGAFIWKIKK |
| Ga0326748_056081_451_558 | 3300034656 | Filtered Seawater | TDFIDIMNFIFIANDMWMMWTGFILGVALIWKIKK |
| Ga0326751_014567_740_865 | 3300034658 | Filtered Seawater | IKKMMWTDFIDVMNFIFIANGMWMLWTAFVLGGAFIWKIKK |
| ⦗Top⦘ |