Basic Information | |
---|---|
Family ID | F027336 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 195 |
Average Sequence Length | 44 residues |
Representative Sequence | ALATSADRRTALAHFALQMSPHDAALLREALDQALGEPEAGEAR |
Number of Associated Samples | 160 |
Number of Associated Scaffolds | 195 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.56 % |
% of genes near scaffold ends (potentially truncated) | 90.26 % |
% of genes from short scaffolds (< 2000 bps) | 92.82 % |
Associated GOLD sequencing projects | 150 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.45 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (57.436 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (21.538 % of family members) |
Environment Ontology (ENVO) | Unclassified (26.154 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.692 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.28% β-sheet: 0.00% Coil/Unstructured: 59.72% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 195 Family Scaffolds |
---|---|---|
PF01435 | Peptidase_M48 | 51.28 |
PF03965 | Penicillinase_R | 2.56 |
PF09995 | MPAB_Lcp_cat | 2.05 |
PF03640 | Lipoprotein_15 | 1.03 |
PF06053 | DUF929 | 0.51 |
PF04542 | Sigma70_r2 | 0.51 |
COG ID | Name | Functional Category | % Frequency in 195 Family Scaffolds |
---|---|---|---|
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 2.56 |
COG3682 | Transcriptional regulator, CopY/TcrY family | Transcription [K] | 2.56 |
COG4315 | Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown) | Function unknown [S] | 1.03 |
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.51 |
COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.51 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.51 |
COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.51 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 57.44 % |
Unclassified | root | N/A | 42.56 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001632|JGI20235J16296_1010597 | Not Available | 504 | Open in IMG/M |
3300001867|JGI12627J18819_10223899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 758 | Open in IMG/M |
3300003505|JGIcombinedJ51221_10436215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 530 | Open in IMG/M |
3300004479|Ga0062595_101829127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 578 | Open in IMG/M |
3300005355|Ga0070671_101799984 | Not Available | 544 | Open in IMG/M |
3300005406|Ga0070703_10430235 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 581 | Open in IMG/M |
3300005437|Ga0070710_10002331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 8988 | Open in IMG/M |
3300005439|Ga0070711_100827585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 786 | Open in IMG/M |
3300005471|Ga0070698_101165932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 719 | Open in IMG/M |
3300005471|Ga0070698_101530502 | Not Available | 619 | Open in IMG/M |
3300005546|Ga0070696_100850533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 754 | Open in IMG/M |
3300005552|Ga0066701_10802176 | Not Available | 561 | Open in IMG/M |
3300005563|Ga0068855_101718082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 639 | Open in IMG/M |
3300005591|Ga0070761_10106169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1622 | Open in IMG/M |
3300005610|Ga0070763_10293819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 891 | Open in IMG/M |
3300005614|Ga0068856_101466023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 696 | Open in IMG/M |
3300005921|Ga0070766_10072650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1985 | Open in IMG/M |
3300006050|Ga0075028_100676333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 619 | Open in IMG/M |
3300006059|Ga0075017_100634639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 819 | Open in IMG/M |
3300006163|Ga0070715_10126246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1226 | Open in IMG/M |
3300006163|Ga0070715_11010925 | Not Available | 519 | Open in IMG/M |
3300006173|Ga0070716_101033470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 651 | Open in IMG/M |
3300006175|Ga0070712_100435366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1089 | Open in IMG/M |
3300006175|Ga0070712_100513975 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
3300006175|Ga0070712_102006675 | Not Available | 507 | Open in IMG/M |
3300006176|Ga0070765_100193672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1841 | Open in IMG/M |
3300006176|Ga0070765_101325443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 679 | Open in IMG/M |
3300006176|Ga0070765_101662192 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 600 | Open in IMG/M |
3300006176|Ga0070765_101706062 | Not Available | 591 | Open in IMG/M |
3300006755|Ga0079222_12678958 | Not Available | 502 | Open in IMG/M |
3300006804|Ga0079221_11373400 | Not Available | 560 | Open in IMG/M |
3300006806|Ga0079220_11757987 | Not Available | 544 | Open in IMG/M |
3300006871|Ga0075434_100240248 | All Organisms → cellular organisms → Bacteria | 1831 | Open in IMG/M |
3300007265|Ga0099794_10269064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 880 | Open in IMG/M |
3300007788|Ga0099795_10271879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 737 | Open in IMG/M |
3300009090|Ga0099827_10934494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 752 | Open in IMG/M |
3300009094|Ga0111539_10619125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1261 | Open in IMG/M |
3300009148|Ga0105243_10666393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1010 | Open in IMG/M |
3300009162|Ga0075423_10380250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1481 | Open in IMG/M |
3300009162|Ga0075423_12988240 | Not Available | 518 | Open in IMG/M |
3300009174|Ga0105241_11870033 | Not Available | 588 | Open in IMG/M |
3300009672|Ga0116215_1230839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 811 | Open in IMG/M |
3300009698|Ga0116216_10425750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 805 | Open in IMG/M |
3300009700|Ga0116217_10436741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 827 | Open in IMG/M |
3300009759|Ga0116101_1016473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1410 | Open in IMG/M |
3300009824|Ga0116219_10483853 | Not Available | 685 | Open in IMG/M |
3300010360|Ga0126372_10838144 | Not Available | 915 | Open in IMG/M |
3300010371|Ga0134125_11764664 | Not Available | 673 | Open in IMG/M |
3300010375|Ga0105239_10272659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1903 | Open in IMG/M |
3300010401|Ga0134121_12094061 | Not Available | 600 | Open in IMG/M |
3300010876|Ga0126361_10000459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1273 | Open in IMG/M |
3300010880|Ga0126350_10346751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 760 | Open in IMG/M |
3300010880|Ga0126350_11395418 | Not Available | 521 | Open in IMG/M |
3300011270|Ga0137391_10141740 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2092 | Open in IMG/M |
3300012154|Ga0153953_1089887 | Not Available | 550 | Open in IMG/M |
3300012176|Ga0153952_1101866 | Not Available | 629 | Open in IMG/M |
3300012199|Ga0137383_10036934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3461 | Open in IMG/M |
3300012201|Ga0137365_10350514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1091 | Open in IMG/M |
3300012206|Ga0137380_10263165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1552 | Open in IMG/M |
3300012209|Ga0137379_11076526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 709 | Open in IMG/M |
3300012357|Ga0137384_10060376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3144 | Open in IMG/M |
3300012362|Ga0137361_11104733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 714 | Open in IMG/M |
3300012362|Ga0137361_11742869 | Not Available | 542 | Open in IMG/M |
3300012929|Ga0137404_10193754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1718 | Open in IMG/M |
3300012989|Ga0164305_11168660 | Not Available | 665 | Open in IMG/M |
3300013100|Ga0157373_10099807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2043 | Open in IMG/M |
3300013102|Ga0157371_11084062 | Not Available | 614 | Open in IMG/M |
3300013105|Ga0157369_11030703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 842 | Open in IMG/M |
3300013307|Ga0157372_12297202 | Not Available | 619 | Open in IMG/M |
3300014200|Ga0181526_10552431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 728 | Open in IMG/M |
3300014200|Ga0181526_11046561 | Not Available | 513 | Open in IMG/M |
3300014657|Ga0181522_10936831 | Not Available | 535 | Open in IMG/M |
3300014838|Ga0182030_11576634 | Not Available | 538 | Open in IMG/M |
3300014969|Ga0157376_10346026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1421 | Open in IMG/M |
3300015371|Ga0132258_11550784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1673 | Open in IMG/M |
3300015372|Ga0132256_102824082 | Not Available | 584 | Open in IMG/M |
3300015373|Ga0132257_100313278 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1889 | Open in IMG/M |
3300017792|Ga0163161_11363548 | Not Available | 618 | Open in IMG/M |
3300017942|Ga0187808_10402111 | Not Available | 626 | Open in IMG/M |
3300017948|Ga0187847_10288174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 897 | Open in IMG/M |
3300018037|Ga0187883_10569325 | Not Available | 586 | Open in IMG/M |
3300018037|Ga0187883_10590346 | Not Available | 576 | Open in IMG/M |
3300019888|Ga0193751_1144673 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 859 | Open in IMG/M |
3300020140|Ga0179590_1190890 | Not Available | 562 | Open in IMG/M |
3300020580|Ga0210403_10705739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 808 | Open in IMG/M |
3300020580|Ga0210403_11393333 | Not Available | 531 | Open in IMG/M |
3300020581|Ga0210399_10797727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 771 | Open in IMG/M |
3300020582|Ga0210395_10114014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2003 | Open in IMG/M |
3300020582|Ga0210395_10134441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1841 | Open in IMG/M |
3300020583|Ga0210401_10200650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1852 | Open in IMG/M |
3300020583|Ga0210401_11501371 | Not Available | 531 | Open in IMG/M |
3300021086|Ga0179596_10656218 | Not Available | 532 | Open in IMG/M |
3300021088|Ga0210404_10420369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 749 | Open in IMG/M |
3300021171|Ga0210405_10529021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 922 | Open in IMG/M |
3300021180|Ga0210396_10429706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1160 | Open in IMG/M |
3300021180|Ga0210396_10519640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1040 | Open in IMG/M |
3300021180|Ga0210396_11288555 | Not Available | 608 | Open in IMG/M |
3300021180|Ga0210396_11370403 | Not Available | 586 | Open in IMG/M |
3300021180|Ga0210396_11578074 | Not Available | 537 | Open in IMG/M |
3300021180|Ga0210396_11599159 | Not Available | 532 | Open in IMG/M |
3300021401|Ga0210393_11474600 | Not Available | 542 | Open in IMG/M |
3300021402|Ga0210385_10595526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 843 | Open in IMG/M |
3300021403|Ga0210397_10734113 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 760 | Open in IMG/M |
3300021404|Ga0210389_10223693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1470 | Open in IMG/M |
3300021404|Ga0210389_11150681 | Not Available | 598 | Open in IMG/M |
3300021405|Ga0210387_10149113 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1999 | Open in IMG/M |
3300021405|Ga0210387_10561674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1014 | Open in IMG/M |
3300021406|Ga0210386_10823356 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 797 | Open in IMG/M |
3300021406|Ga0210386_11721830 | Not Available | 517 | Open in IMG/M |
3300021407|Ga0210383_11598298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 536 | Open in IMG/M |
3300021407|Ga0210383_11705126 | Not Available | 516 | Open in IMG/M |
3300021407|Ga0210383_11731361 | Not Available | 511 | Open in IMG/M |
3300021407|Ga0210383_11765522 | Not Available | 505 | Open in IMG/M |
3300021432|Ga0210384_10293123 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1464 | Open in IMG/M |
3300021433|Ga0210391_11348408 | Not Available | 549 | Open in IMG/M |
3300021474|Ga0210390_10334949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1281 | Open in IMG/M |
3300021474|Ga0210390_11416177 | Not Available | 553 | Open in IMG/M |
3300021475|Ga0210392_10269578 | Not Available | 1212 | Open in IMG/M |
3300021475|Ga0210392_10605223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 813 | Open in IMG/M |
3300021477|Ga0210398_11568172 | Not Available | 511 | Open in IMG/M |
3300021478|Ga0210402_11767669 | Not Available | 544 | Open in IMG/M |
3300022712|Ga0242653_1110928 | Not Available | 511 | Open in IMG/M |
3300024232|Ga0247664_1149508 | Not Available | 549 | Open in IMG/M |
3300025588|Ga0208586_1037089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1129 | Open in IMG/M |
3300025633|Ga0208480_1032035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1475 | Open in IMG/M |
3300025898|Ga0207692_10718735 | Not Available | 649 | Open in IMG/M |
3300025907|Ga0207645_10583362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 759 | Open in IMG/M |
3300025915|Ga0207693_10055600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 3105 | Open in IMG/M |
3300025916|Ga0207663_10232104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1349 | Open in IMG/M |
3300025916|Ga0207663_11245105 | Not Available | 599 | Open in IMG/M |
3300025922|Ga0207646_10864841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 803 | Open in IMG/M |
3300025924|Ga0207694_10348730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1225 | Open in IMG/M |
3300025924|Ga0207694_11023072 | Not Available | 699 | Open in IMG/M |
3300025928|Ga0207700_11518198 | Not Available | 594 | Open in IMG/M |
3300025942|Ga0207689_10131990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2056 | Open in IMG/M |
3300025961|Ga0207712_10174810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1682 | Open in IMG/M |
3300026121|Ga0207683_11517411 | Not Available | 619 | Open in IMG/M |
3300026285|Ga0209438_1122173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 725 | Open in IMG/M |
3300027047|Ga0208730_1021808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 727 | Open in IMG/M |
3300027089|Ga0207943_108722 | Not Available | 646 | Open in IMG/M |
3300027090|Ga0208604_1008329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 984 | Open in IMG/M |
3300027619|Ga0209330_1153858 | Not Available | 518 | Open in IMG/M |
3300027725|Ga0209178_1173552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 754 | Open in IMG/M |
3300027737|Ga0209038_10087874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 935 | Open in IMG/M |
3300027765|Ga0209073_10159418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 838 | Open in IMG/M |
3300027787|Ga0209074_10386799 | Not Available | 583 | Open in IMG/M |
3300027853|Ga0209274_10357926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 752 | Open in IMG/M |
3300027855|Ga0209693_10193171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1003 | Open in IMG/M |
3300027884|Ga0209275_10373557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 801 | Open in IMG/M |
3300027895|Ga0209624_10369038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 957 | Open in IMG/M |
3300028072|Ga0247675_1009652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1343 | Open in IMG/M |
3300028747|Ga0302219_10400341 | Not Available | 537 | Open in IMG/M |
3300028789|Ga0302232_10024039 | All Organisms → cellular organisms → Bacteria | 3404 | Open in IMG/M |
3300028789|Ga0302232_10506622 | Not Available | 593 | Open in IMG/M |
3300028806|Ga0302221_10329304 | Not Available | 665 | Open in IMG/M |
3300028879|Ga0302229_10115721 | Not Available | 1259 | Open in IMG/M |
3300028906|Ga0308309_10968916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 737 | Open in IMG/M |
3300029910|Ga0311369_11072363 | Not Available | 631 | Open in IMG/M |
3300029943|Ga0311340_10082658 | All Organisms → cellular organisms → Bacteria | 3618 | Open in IMG/M |
3300029943|Ga0311340_10528557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1048 | Open in IMG/M |
3300029951|Ga0311371_10505153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1593 | Open in IMG/M |
3300030007|Ga0311338_10262964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1931 | Open in IMG/M |
3300030007|Ga0311338_10781388 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 954 | Open in IMG/M |
3300030043|Ga0302306_10225098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 721 | Open in IMG/M |
3300030053|Ga0302177_10300018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 857 | Open in IMG/M |
3300030056|Ga0302181_10111700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1342 | Open in IMG/M |
3300030058|Ga0302179_10168303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 968 | Open in IMG/M |
3300030549|Ga0210257_10427237 | Not Available | 589 | Open in IMG/M |
3300030580|Ga0311355_11409990 | Not Available | 605 | Open in IMG/M |
3300030706|Ga0310039_10355855 | Not Available | 545 | Open in IMG/M |
3300030730|Ga0307482_1103203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 783 | Open in IMG/M |
3300030738|Ga0265462_11498955 | Not Available | 627 | Open in IMG/M |
3300030739|Ga0302311_10467665 | Not Available | 873 | Open in IMG/M |
3300031028|Ga0302180_10170711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1191 | Open in IMG/M |
3300031233|Ga0302307_10649991 | Not Available | 530 | Open in IMG/M |
3300031344|Ga0265316_10007889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 9962 | Open in IMG/M |
3300031663|Ga0307484_108525 | Not Available | 667 | Open in IMG/M |
3300031708|Ga0310686_115504174 | Not Available | 671 | Open in IMG/M |
3300031715|Ga0307476_10125241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1833 | Open in IMG/M |
3300031715|Ga0307476_10368619 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1058 | Open in IMG/M |
3300031740|Ga0307468_102528260 | Not Available | 503 | Open in IMG/M |
3300031753|Ga0307477_10594858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 746 | Open in IMG/M |
3300031823|Ga0307478_11085078 | Not Available | 668 | Open in IMG/M |
3300031996|Ga0308176_10422505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1336 | Open in IMG/M |
3300032174|Ga0307470_10203702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1267 | Open in IMG/M |
3300032180|Ga0307471_100338333 | Not Available | 1610 | Open in IMG/M |
3300032180|Ga0307471_103783154 | Not Available | 535 | Open in IMG/M |
3300032515|Ga0348332_12262740 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 826 | Open in IMG/M |
3300033829|Ga0334854_188367 | Not Available | 504 | Open in IMG/M |
3300034124|Ga0370483_0252424 | Not Available | 604 | Open in IMG/M |
3300034163|Ga0370515_0474882 | Not Available | 527 | Open in IMG/M |
3300034199|Ga0370514_094417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 762 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.54% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 10.26% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 9.74% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.18% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.13% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.64% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.10% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.08% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.56% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.05% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.05% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.05% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.54% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.54% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.54% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.54% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.54% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.03% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.03% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.03% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.03% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.03% |
Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 1.03% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.51% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.51% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.51% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.51% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.51% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.51% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.51% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.51% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.51% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.51% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.51% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.51% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.51% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.51% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.51% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.51% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.51% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.51% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.51% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.51% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.51% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001632 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF001 | Environmental | Open in IMG/M |
3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012154 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ037 MetaG | Host-Associated | Open in IMG/M |
3300012176 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ036 MetaG | Host-Associated | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300022712 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300023056 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS2 | Environmental | Open in IMG/M |
3300024232 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05 | Environmental | Open in IMG/M |
3300025588 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025633 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
3300027047 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF042 (SPAdes) | Environmental | Open in IMG/M |
3300027089 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF015 (SPAdes) | Environmental | Open in IMG/M |
3300027090 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF016 (SPAdes) | Environmental | Open in IMG/M |
3300027619 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300028072 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK16 | Environmental | Open in IMG/M |
3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030043 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1 | Environmental | Open in IMG/M |
3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
3300030549 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO137-ANR102SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030738 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assembly | Environmental | Open in IMG/M |
3300030739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3 | Environmental | Open in IMG/M |
3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
3300031663 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300033829 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5 | Environmental | Open in IMG/M |
3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
3300034199 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI20235J16296_10105972 | 3300001632 | Forest Soil | DRRKALTHFALQMSPHDAALLRAALDQASREPEAGEAR* |
JGI12627J18819_102238992 | 3300001867 | Forest Soil | AALMNDALATSPDHRTALAHFALQMSPYDAALLREALEQALGEPEAGESR* |
JGIcombinedJ51221_104362152 | 3300003505 | Forest Soil | MNDALATSPDRRTALTHFALQMSPHDAALLREALDQALGEHKAGESQ* |
Ga0062595_1018291271 | 3300004479 | Soil | LMNDALATSSHRRTALAHFVLQMSPHDSGLLREALDQAQPESGEGRTR* |
Ga0070671_1017999842 | 3300005355 | Switchgrass Rhizosphere | LGTSTDRRTALTHFALQMSPHDAALLREALDQALSGPEAPEAGGDR* |
Ga0070703_104302351 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MNDALGTSADRRTALAHFVLQMSPHDAALLQQALDQARGQADEAG* |
Ga0070710_1000233110 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | ADRRRALAHFVLQMSPHDAALLREALEQARPEPEAGGNR* |
Ga0070711_1008275852 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | SPDRRTALAHFALQMSPHDAALLREALGQALGEPGVGESR* |
Ga0070708_1012320182 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | TSADRRTALAHFVLQMSPHDAALLQQALDQARGQADETG* |
Ga0070698_1011659321 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | ALATSADHRTALAHFALQMSPHDAALLREALDQAPGEAAAGESR* |
Ga0070698_1015305021 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | ATSADHRTALAHFALQMSPHDAALLREALDQAPGEPKAGESR* |
Ga0070696_1008505332 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | LMNEALGTSTDRRTALTHFALQMSPHDAALLREALDQTLSGPEAPEAGGDR* |
Ga0066701_108021762 | 3300005552 | Soil | HFALQMSPHDAALLREALEQALGEPKAGESKAGDSR* |
Ga0068855_1017180821 | 3300005563 | Corn Rhizosphere | ALMSDALATSSDRRTALRHFALQMSPHDAALLREALEQALGEPKADESKAGESR* |
Ga0070761_101061691 | 3300005591 | Soil | MSDALATSPDHRTALAHFALQMSPHDAAMLREALDQALGKAEAGESR* |
Ga0070763_102938191 | 3300005610 | Soil | NDALATSPDRRTALTHFALQMSPHDAALLREALDRALGEPKAGESR* |
Ga0068856_1014660232 | 3300005614 | Corn Rhizosphere | LRHFALQMSPHDAALLREALEQALGEPKADESKAGESR* |
Ga0070766_100726504 | 3300005921 | Soil | DRRRALAHFVLQMSPHDTALLREALEQARPEPEAGGNR* |
Ga0070717_116909132 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | DRRTALAHFVLQMSPHDAALLQQALDQARGQADEAG* |
Ga0075028_1006763332 | 3300006050 | Watersheds | DALGTSADRRRALAHFVLQMSPHDAALLREALEQARPEPEAGGNR* |
Ga0075017_1006346392 | 3300006059 | Watersheds | ATSADHRTALAHFALQMSPHDAALLREALGQAPGEAEAGESR* |
Ga0070715_101262461 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | DRRTALAHFALQMSPHDAAVLREALDRALREPEAGNDR* |
Ga0070715_110109251 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | RTALAHFALQMSPHDAALLREALDQALGEAAAGESR* |
Ga0070716_1010334701 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | PDRRTALTHFALQMSPHDAALLREALEQALGEREAGESR* |
Ga0070712_1004353662 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | TALKHFALQMSPHDAALLREALEQALGEPKAGESKAGESR* |
Ga0070712_1005139751 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | AALMSDALATSPDRRTALTHFALQMSPHDAALLREALEQALGEPTAGESKAGEAKVGESKAGESR* |
Ga0070712_1020066751 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | DRRRALAHFVLEMSPHDAALLREALEQARPEPEPGGNQ* |
Ga0070765_1001936721 | 3300006176 | Soil | MNDALATSPDRRTALAHFALQMSPHDAALLREALGQALGEPEAGESR* |
Ga0070765_1013254431 | 3300006176 | Soil | ALATSPDRRTALAHFALQMSPHDAALLREALDQALGEPKGGESR* |
Ga0070765_1016621922 | 3300006176 | Soil | NEALETSADRRRALAHFAFQMSPHDASVLRDALDQALREPDTGGAQ* |
Ga0070765_1017060622 | 3300006176 | Soil | HRTALAHFALQMSPHDAALLREALNQALGKAAAGESR* |
Ga0079222_126789581 | 3300006755 | Agricultural Soil | RRTALAHFVLQMSPRDAALLREALDRTRPEPGEARAR* |
Ga0079221_113734001 | 3300006804 | Agricultural Soil | FALQMSPHDAALLREALDQALDQEPGRREAGESR* |
Ga0079220_117579872 | 3300006806 | Agricultural Soil | DRRTALAHFALQMSPHDAALLREALDQALGEPEAEEAR* |
Ga0075434_1002402481 | 3300006871 | Populus Rhizosphere | LATSADRRTALAHFALQMSPHDAALLREALDQALGEPEAGEAR* |
Ga0099794_102690641 | 3300007265 | Vadose Zone Soil | ALTHFALQMSPHDAALLREALEQALGEPKAGESR* |
Ga0099795_102718792 | 3300007788 | Vadose Zone Soil | ALAHFALQMSPHDAALLREALGQALGEPGAGESR* |
Ga0099827_109344942 | 3300009090 | Vadose Zone Soil | MSDALTTSPDRRTALKHFALQMSPHDAALLREALDQALGGPEAGESR* |
Ga0111539_106191251 | 3300009094 | Populus Rhizosphere | DRRTALAHFALQMSPHDAALLREALDQALGEPEAGEAG* |
Ga0105243_106663931 | 3300009148 | Miscanthus Rhizosphere | ALATSPDHRTALAHFALQMSPHDAGLLREALDQALGEAATGESR* |
Ga0075423_103802501 | 3300009162 | Populus Rhizosphere | ALATSADRRTALAHFALQMSPHDAALLREALDQALGEPEAGEAR* |
Ga0075423_129882402 | 3300009162 | Populus Rhizosphere | ALATSADRRTALAHFALQMSPHDAALLREALDQALGEPEAGQAR* |
Ga0105241_118700332 | 3300009174 | Corn Rhizosphere | ALAHFALQMSPHDAALLREALDQALGEPEAGEAR* |
Ga0116215_12308391 | 3300009672 | Peatlands Soil | TSPDHRTALAHFALQMSPHDAALLREALDQALGEPKAGESKAGESR* |
Ga0116216_104257501 | 3300009698 | Peatlands Soil | SADHRTALAHFALQMSPHDAALLREALDQALGEPKAGESR* |
Ga0116217_104367411 | 3300009700 | Peatlands Soil | MSDALATSPDHRTALAHFALQMSPHDAALLREALDQALAEPKAAEPKAGGSKAGGSKAGESR* |
Ga0116101_10164733 | 3300009759 | Peatland | DRRTALAHFALQMSPHDAALLREALDHAGREPEAGEAR* |
Ga0116219_104838532 | 3300009824 | Peatlands Soil | NDALATSADHRTALAHFALQMSPHDAALLREALDQALGEPKAGESR* |
Ga0126372_108381442 | 3300010360 | Tropical Forest Soil | MNDALATSSDRRTALAHFVLQMSPHDAALLREALEGAAPESGEGRAR* |
Ga0134125_117646641 | 3300010371 | Terrestrial Soil | HFALQMSPHDAALLREALEQALGEPKAGESKAGESR* |
Ga0105239_102726593 | 3300010375 | Corn Rhizosphere | DALATSADRRTALAHFALQMSPHDAALLREALDQALGEPEAGEAR* |
Ga0134121_120940611 | 3300010401 | Terrestrial Soil | RRTALAHFALQMSPHDAALLREALDQALGEPEAGEAR* |
Ga0126361_100004591 | 3300010876 | Boreal Forest Soil | TALAHFALQMSPHDAALLREALDQALGKAEAGRSR* |
Ga0126350_103467512 | 3300010880 | Boreal Forest Soil | DRRTALAHFALQMSPHDAALLREALDQALGEPKAGDPR* |
Ga0126350_113954182 | 3300010880 | Boreal Forest Soil | DALATSPDRRTALAHFALQMSPHDAALLREALGEAAAGESR* |
Ga0137391_101417404 | 3300011270 | Vadose Zone Soil | ALMNDALATSPDRRTALTHFALQMSPHDAALLREALEQALGEPKAGESR* |
Ga0153953_10898872 | 3300012154 | Attine Ant Fungus Gardens | LATSADRRTALAHFALQMSPHDAALLREALDQANREPEAGEAR* |
Ga0153952_11018662 | 3300012176 | Attine Ant Fungus Gardens | PVQLHRGADERRAATSADRRTALAHFALQMSPHDAALLREALGQAPGKAAAGESR* |
Ga0137383_100369343 | 3300012199 | Vadose Zone Soil | MSDALATSPDRSTALKHFALQMSPHDAALLREALDQALDQEPGRREAGESR* |
Ga0137365_103505142 | 3300012201 | Vadose Zone Soil | DALATSSDRRTALRHFALQMSPNDAALLREALEQALGEPKAGEPKAGESR* |
Ga0137380_102631653 | 3300012206 | Vadose Zone Soil | ALGTSADRRTALAHFVLQMSPHDAALLQQALDQARGEPEAGEAQ* |
Ga0137379_110765262 | 3300012209 | Vadose Zone Soil | MNEALGTSADRRTALAHFVLQMSPHDAALLQQALDQGRRQPEGGEAR* |
Ga0137384_100603764 | 3300012357 | Vadose Zone Soil | ALGTSADRRTALAHFVLQMSPHDAALLQQALDQGRRQPEGGEAR* |
Ga0137361_111047331 | 3300012362 | Vadose Zone Soil | TSADRRTALAHFALQMSPHDAALLREALDQALREPEAGGAR* |
Ga0137361_117428692 | 3300012362 | Vadose Zone Soil | LGTSADRRRALAHFVLQMSPHDAALLREALEQARPEPEPGGNR* |
Ga0137404_101937543 | 3300012929 | Vadose Zone Soil | LTTSPDRRTALKHFALQMSPHDAALLREALDQALSEPEAGESR* |
Ga0164305_111686601 | 3300012989 | Soil | SADRRTALAHFALQMNPHDAALLREALDQALGEAAAGESR* |
Ga0157373_100998071 | 3300013100 | Corn Rhizosphere | LMSDALATSSDRRTALRHFALQMSPHDAALLREALEQALGEPKADESKAGESR* |
Ga0157371_110840621 | 3300013102 | Corn Rhizosphere | PNRRTALTHFAPQMSPHDAALLREALEQALGEPKADESKAGESR* |
Ga0157369_110307031 | 3300013105 | Corn Rhizosphere | TAALMNEALGTSTDRRTALTHFALQMSPHDAALLREALDQTLSGPEAPEAGGDR* |
Ga0157372_122972021 | 3300013307 | Corn Rhizosphere | SPDRRTALKHFALQMSPHDAALLREALDQAPGEPKAGESKAGESR* |
Ga0181526_105524311 | 3300014200 | Bog | TADHRTALAHFALQMSPHDAALLREALGQAPGEAEAGESR* |
Ga0181526_110465612 | 3300014200 | Bog | NDALATSADHRTALTHFALQMSPHDAALLREALDQAPEAEAGESR* |
Ga0181522_109368312 | 3300014657 | Bog | RTALAHFALQMSPHDAALLREALDQALGEPKAGESR* |
Ga0182030_115766341 | 3300014838 | Bog | ALAHFALQMSPHDAALLREALEQALGEPEAGESR* |
Ga0157376_103460263 | 3300014969 | Miscanthus Rhizosphere | FALQMSPHDAALLREALEQALGEPKADESKAGESR* |
Ga0132258_115507841 | 3300015371 | Arabidopsis Rhizosphere | MSDALATSSDRRTALRHFALQMSPHDAALLREALEQALGEPEADGSKAGESR* |
Ga0132256_1028240822 | 3300015372 | Arabidopsis Rhizosphere | ALQMSPHDAALLREALDQALGEPKAGESKAGESG* |
Ga0132257_1003132781 | 3300015373 | Arabidopsis Rhizosphere | MSDALATSSDRRTALRHFALQMSPHDAALLREALEQALGEPKADESKAGESR* |
Ga0163161_113635481 | 3300017792 | Switchgrass Rhizosphere | ALATSSDRRTALAHFVLQMSPHDAALLREALGQAPSEAAAGESR |
Ga0187808_104021111 | 3300017942 | Freshwater Sediment | TAALMNDALATSADHRTALAHFALQMSPYDAALLREALDRALGKAQAGESR |
Ga0187847_102881742 | 3300017948 | Peatland | MSDALATSPDRRTALAHFALQMSPHDAALLREALGQAPGESEAGESR |
Ga0187883_105693252 | 3300018037 | Peatland | LGTSTDRRTALAHFALQMSPHDAALLREALDQALRGPEAGEDR |
Ga0187883_105903462 | 3300018037 | Peatland | TSTDRRTALAHFALQMSPHDAALLREALDQALGAPKDGEPR |
Ga0193751_11446731 | 3300019888 | Soil | TSTDRRTALAHFALQMSPHDAALLREALDQAPGEPKAGESR |
Ga0179590_11908902 | 3300020140 | Vadose Zone Soil | MSDALATSQDRRTALKHFALQMSPHDAALLREALDQALGEPKPGESKAGQSKAGESR |
Ga0210403_107057392 | 3300020580 | Soil | DALTTSPDRRTALKHFALQMSPHDAALLREALDQALGEPEAGESR |
Ga0210403_113933332 | 3300020580 | Soil | MSDALATSPDRRTALKHFALQMSPHDAALLREALEQALGEPKADESKAGESR |
Ga0210399_107977271 | 3300020581 | Soil | NDALATSPDRRTALTHFALQMSPHDAALLREALEQALGEPKTGESR |
Ga0210395_101140141 | 3300020582 | Soil | ALMNDALATSPDRRTALTHFALQMSPHDAALLREALDQALGEHKAGESQ |
Ga0210395_101344411 | 3300020582 | Soil | RPRALAHFALQMRPGDAALLRDALDLALRESQSGEAT |
Ga0210401_102006501 | 3300020583 | Soil | DALATSADHRTALAHFALQMSPHDAALLREALNQALGKAAAGESR |
Ga0210401_115013711 | 3300020583 | Soil | YTAALMNEALETSADRRRALAHFALQMSPHDAAVLRDALDQALHESETGDAK |
Ga0179596_106562182 | 3300021086 | Vadose Zone Soil | AALMSDALATSADHRTALAHFALQMSPHDAALLREALDQALGEPEAGEAR |
Ga0210404_104203691 | 3300021088 | Soil | ATSADHRTALAHFALQMSPHDAALLREALDQALGEAAAGESR |
Ga0210405_105290212 | 3300021171 | Soil | NDALATSADHRTALAHFALQMSPHDAALLREALNQALGKAAAGESR |
Ga0210396_104297061 | 3300021180 | Soil | ALATSPDRRTALAHFALQMSPGDAALLREALDQALGEPKAGESR |
Ga0210396_105196402 | 3300021180 | Soil | TSADHRTALAHFALQMSPHDAALLREALNQALGKAAAGESR |
Ga0210396_112885551 | 3300021180 | Soil | ALMSDALATSPDRRTALKHFALQMSPHDAALLREALEQALGEPKADESKAGESR |
Ga0210396_113704032 | 3300021180 | Soil | DRRTALAHFALQMSPYDAALLREALDQALGEPTAGESR |
Ga0210396_115780741 | 3300021180 | Soil | RTALAHFVLQMSPHDAALLREALEQAGPEPEEEEAR |
Ga0210396_115991591 | 3300021180 | Soil | MNEALETSADRRRALAHFALQMSPHDAAVLRDALDQALHESETGEAQ |
Ga0210393_114746002 | 3300021401 | Soil | ATSPDRRTALTHFALQMSPHDAALLREALEQALGEPEAGESR |
Ga0210385_105955261 | 3300021402 | Soil | ALATSADHRTALAHFALQMSPHDAALLREALDQAPGEAKAGESR |
Ga0210397_107341132 | 3300021403 | Soil | ALMNDALATSPDRRTALTHFALQMSPHDAALLREALEQALGEPKAGESR |
Ga0210389_102236931 | 3300021404 | Soil | LATSSDRRTALRHFALQMSPHDAALLREALEQALGEPKAGESKAGESR |
Ga0210389_111506812 | 3300021404 | Soil | TAALMNDALATSTDHRTALAHFALQMSPHDAALLREALDQALGETEAGESR |
Ga0210387_101491131 | 3300021405 | Soil | NDALATSADHRTALAHFALQMSPHDAALLREALGQALGEAAAGESR |
Ga0210387_105616741 | 3300021405 | Soil | SADHRTALAHFALQMSPHDAALLREALNQALGKAAAGESR |
Ga0210386_108233561 | 3300021406 | Soil | SPDRRTALAHFALQMSPHDAALLREALDQALGEPTAGESR |
Ga0210386_117218301 | 3300021406 | Soil | MSDALATSADHRTALAHFALQMSPHDAALLREALGQAPGESEAGESR |
Ga0210383_115982982 | 3300021407 | Soil | ALMNDALATSPDRRTALAHFALQMSPHDAALLREALDRALGEPEAGESR |
Ga0210383_117051262 | 3300021407 | Soil | ALMNDALATSADHRTALAHFALQMSPHDAALLRRALDQALGGAEAGESR |
Ga0210383_117313612 | 3300021407 | Soil | DALATSPDHRTALAHFALQMSPYDAALLREALEQALGEPEAGESR |
Ga0210383_117655221 | 3300021407 | Soil | HRKALAHFALQMSPHDAALLREALDQALGSPKAGESR |
Ga0210384_102931233 | 3300021432 | Soil | DRRTALKHFALQMSPHDAALLREALEQALGEPRAGESKAGESR |
Ga0210391_113484081 | 3300021433 | Soil | ALATSPDRRTALAHFALQMSPNDAALLREALEQALGEPKAGEPKAGESR |
Ga0210390_103349492 | 3300021474 | Soil | TSADRRKALTHFALQMSPHDAALLRAALDQASREPEAGEAR |
Ga0210390_114161771 | 3300021474 | Soil | AALMNEALQTSADRPRALAHFAIQMSPHDAAVLRDALDLALREPETGEAQ |
Ga0210392_102695782 | 3300021475 | Soil | MNDALATSSDRRTALTYFGLQISLHDPALLREALDQAAREPEAGEAR |
Ga0210392_106052232 | 3300021475 | Soil | SSYTSALMNDALATSPDRRTALTHFALQMSPNDAALLREALEQALGKPEAGDSR |
Ga0210398_115681721 | 3300021477 | Soil | LATSPDRRTALAHFALQMSPNDAALLREALEQALGEPKAGESR |
Ga0210402_117676692 | 3300021478 | Soil | DRRTALAHFALQMSPHDAALLREALGQPPGEPAAGEPAAGEPR |
Ga0242653_11109282 | 3300022712 | Soil | MNDALATSPDRRTALKHFALQMSPHDAALLREALEQALGEPKTGESR |
Ga0233357_10204372 | 3300023056 | Soil | ADRRTALAHFVLQMSPHDAALLQQALDQARPPDEAGEAQ |
Ga0247664_11495081 | 3300024232 | Soil | PDHRTALAHFALQMSPHDAGLLREALDQALGEAATGESR |
Ga0208586_10370892 | 3300025588 | Arctic Peat Soil | AGLMNDALATSADHRTALAHFALQMSPHDAALLREALDQALGEAEAGESR |
Ga0208480_10320351 | 3300025633 | Arctic Peat Soil | RRTALAHFALQMSPHDAALLREALDQARPGPQAGEPQ |
Ga0207692_107187352 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | RRTALRHFALQMSPHDAALLREALEQALGEPKADESKAGESR |
Ga0207645_105833621 | 3300025907 | Miscanthus Rhizosphere | TALAHFALQMSPHDAGLLREALDQALGEAATGESR |
Ga0207693_100556001 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MNDALATSADRRTALAHFALQMSPHDAALLREALDQALGEPEAGQAR |
Ga0207663_102321042 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | ALMNEALGTSTDRRTALTHFALQMSPHDAALLREALDQALSGPEAPEAGGDR |
Ga0207663_112451051 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | RHFALQMSPHDAALLREALEQALGEPKADESKAGESR |
Ga0207646_108648411 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | ALATSSDRRTALRHFALQMSPHDAALLREALEQALGEPKAGESKAGESR |
Ga0207694_103487302 | 3300025924 | Corn Rhizosphere | AALMSDALATSPDHRTALAHFALQMSPHDAGLLREALDQALGEAATGESR |
Ga0207694_110230722 | 3300025924 | Corn Rhizosphere | DALATSSDRRTALRHFALQMSPHDAALLREALEQALGEPKAGESKAGESKAGESKAGESR |
Ga0207700_115181981 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | TSPDRRTALAHFVLQMSPHDAALLREAFDQARPESEEGQAR |
Ga0207689_101319901 | 3300025942 | Miscanthus Rhizosphere | LMSDALATSPDHRTALAHFALQMSPHDAGLLREALDQALGEAATGESR |
Ga0207712_101748101 | 3300025961 | Switchgrass Rhizosphere | DRSTALKHFALQMSPHDAALLREALEQALGEPKAGESKAGESR |
Ga0207683_115174111 | 3300026121 | Miscanthus Rhizosphere | MSDALATSPDPRTALKHFALQMSPHDAALLREALDQALGEPKAGQPKAGESR |
Ga0209438_11221732 | 3300026285 | Grasslands Soil | ATSSDRRTALAHFVLQMSPRDAALLREALDQARPEPMGGEAQ |
Ga0208730_10218082 | 3300027047 | Forest Soil | ATSPDRRTALTHFALQMSPHDAALLREALDQTLGEHKAGESR |
Ga0207943_1087221 | 3300027089 | Forest Soil | DALATSPDHRTALAHFALQMSPHDAAMLREALDQALGKAEAGESR |
Ga0208604_10083291 | 3300027090 | Forest Soil | NDALATSADHRTALAHFALQMSPHDAALLREALDQALGEAEAGESR |
Ga0209330_11538581 | 3300027619 | Forest Soil | DRGRALAHFAIQMSPHDAAVLRDALNLALHESEAGEAR |
Ga0209178_11735522 | 3300027725 | Agricultural Soil | SADRRTALAHFALQMSPHDAALLREALDQALGEPEAGPAR |
Ga0209038_100878742 | 3300027737 | Bog Forest Soil | TAALMSDALATSPDRRTALTHFALQMSPHDAALLREALDQALGEPKAGESR |
Ga0209073_101594181 | 3300027765 | Agricultural Soil | TALKHFALQMSPHDAALLREALDQALDQEPGRREAGESR |
Ga0209074_103867991 | 3300027787 | Agricultural Soil | MSDALATSPDRSTALKHFALQMSPHDAALLREALDQALDQEPGRREAGESR |
Ga0209274_103579261 | 3300027853 | Soil | LDASPDRRTALTHFALQMSPHDAALLREALNQALGEPKAGESR |
Ga0209693_101931711 | 3300027855 | Soil | DALGTSTDRRTALTHFALQMSPHDAALLREALDQALGEPKAGESR |
Ga0209275_103735571 | 3300027884 | Soil | ALATSADRRKALAHFALQMSPHDAAALRDALDQALRVGDADDQR |
Ga0209624_103690382 | 3300027895 | Forest Soil | MNDALATSPDRRTALAHFALQMSPHDAALLREALGQALGEPKAGQPEAGESR |
Ga0247675_10096521 | 3300028072 | Soil | LMSDALATSSDRRTALRHFALQMSPHDAALLREALEQALGEPKADESKAGESR |
Ga0302219_104003411 | 3300028747 | Palsa | LATSPDRRTALAHFALQMSPHDAALLREALGQALGESEAGESR |
Ga0302232_100240396 | 3300028789 | Palsa | AALMSDALATSADHRTALAHFALQMSPHDAALLREALGQAPGESEAGESR |
Ga0302232_105066222 | 3300028789 | Palsa | TALAHFALQMSPHDAALLREALGQAPGEAEAGESR |
Ga0302221_103293041 | 3300028806 | Palsa | AHFALQMSPRDAALLREALGQALGEPQASQAQAGESR |
Ga0302229_101157211 | 3300028879 | Palsa | RTALAHFALQMSPHDAALLREALGQAPGEPQAGEPR |
Ga0308309_109689162 | 3300028906 | Soil | ADHRTALAHFALQMSPHDAALLREALNQALGKAAAGESR |
Ga0311369_110723631 | 3300029910 | Palsa | ATSPDRRTALAHFALQMSPHDAALLREALGQALGESEAGESR |
Ga0311340_100826586 | 3300029943 | Palsa | TALAHFALQMSPHDAALLREALGQAPGESEAGESR |
Ga0311340_105285572 | 3300029943 | Palsa | MSDALATSADHRTALAHFALQMSPHDAALLREALGQAPGEAEAGESR |
Ga0311371_105051531 | 3300029951 | Palsa | LATSPDHRTALAHFALQMSPRDAALLREALGQALGEPQASQAQAGESR |
Ga0311338_102629641 | 3300030007 | Palsa | TSADHRTALAHFALQMSPHDAALLREALGQAPGEAEAGESR |
Ga0311338_107813881 | 3300030007 | Palsa | TALAHFALQMSPHDAALLREALGQAPGEPQAGEPR |
Ga0302306_102250982 | 3300030043 | Palsa | TSSDHRTALAHFALQMSPHDAALLREALDQALGEPKAGESR |
Ga0302177_103000182 | 3300030053 | Palsa | ALMSDALATSADHRTALAHFALQMSPHDAALLREALGQAPGEAEAGESR |
Ga0302181_101117002 | 3300030056 | Palsa | TALTHFALQMSPHDAALLREALGQPSREPEAGEAR |
Ga0302179_101683032 | 3300030058 | Palsa | ALAHFALQMSPHDAALLREALGQAPGEPQASESEAGESR |
Ga0210257_104272372 | 3300030549 | Soil | MSDALATSADHRTALAHFALQMSPHDAALLREALGQAPGEPKAGESR |
Ga0311355_114099902 | 3300030580 | Palsa | ALMSDALATSADHRTALAHFALQMSPHDAALLREALGQAPGESEAGESR |
Ga0310039_103558552 | 3300030706 | Peatlands Soil | ATSSDRRTALAHFALQMSPHDAALLREALDQALGEPKAGESR |
Ga0307482_11032031 | 3300030730 | Hardwood Forest Soil | RRTALAHFALQMSPHDAALLREALGQALGEPEAGESR |
Ga0265462_114989552 | 3300030738 | Soil | MSDALATSPDHGTALAHFALQMSPHDAALLREALDQALGKAGAGDSR |
Ga0302311_104676651 | 3300030739 | Palsa | DALATSADHRTALAHFALQMSPHDAALLREALGQAPGEAEAGESR |
Ga0302180_101707111 | 3300031028 | Palsa | RTALAHFALQMSPHDAALLREALDHAGREPEAGEAR |
Ga0302307_106499911 | 3300031233 | Palsa | RTALAHFALQMSPHDAALLREALGQAPGEPEAGGSR |
Ga0265316_100078891 | 3300031344 | Rhizosphere | MNDALATSPDRRTALAHFALQMSPHDAALLREALDRALGEPRAGESR |
Ga0307484_1085251 | 3300031663 | Hardwood Forest Soil | AALMNDALATSADRRTALAHFALQMSPHDAALLREALDRAIGEPKAGEPKAGESR |
Ga0310686_1155041741 | 3300031708 | Soil | MRRFGELEAALDTSADRRTALAHFALQMSPHDAALLREALDRALGEPGAGESR |
Ga0307476_101252411 | 3300031715 | Hardwood Forest Soil | AGLMNDALATSPDRRTALTHFALQMSPHDAALLREALDQALSEPKAGESR |
Ga0307476_103686191 | 3300031715 | Hardwood Forest Soil | NDALATSPDRRTALAHFALQMSPHDAALLREALGQALGEPEAGESR |
Ga0307468_1025282602 | 3300031740 | Hardwood Forest Soil | DAQATSPDRRTALTHFALQMSPHDAALLREALEQALGEPTADEPEAGESKVGESKAGESR |
Ga0307477_105948581 | 3300031753 | Hardwood Forest Soil | LGTSTDRRTALAHFALQMSPHDAAVLREALDRALREPEAGNDR |
Ga0307478_110850782 | 3300031823 | Hardwood Forest Soil | RRRALAHFALQMSPHDAAVLRDALDQALQESETGEAQ |
Ga0308176_104225052 | 3300031996 | Soil | LMSDALATSPDRSTALKHFALQMSPHDAALLREALDQALDQEPGRREAGESR |
Ga0307470_102037022 | 3300032174 | Hardwood Forest Soil | GTSADRRRALAHFVLQMSPHDAALLREALEQARPEPEAGGNR |
Ga0307471_1003383333 | 3300032180 | Hardwood Forest Soil | ATSSVRRTALAHFVLQMSPHVAALLREALDQAEPEPGAGETR |
Ga0307471_1037831541 | 3300032180 | Hardwood Forest Soil | DALATSPDRRTALAHFALQMSPHDAALLREALDQALGEPKADQSKAGESR |
Ga0348332_122627403 | 3300032515 | Plant Litter | MNEALETSADRRRALAHFALQMSPHDAAVLRDALDQALHDSETGEAQ |
Ga0334854_188367_303_446 | 3300033829 | Soil | MNDALATSPDRRTALAHFALQMSPHDAALLREALDQALGEPKAGESR |
Ga0370483_0252424_461_604 | 3300034124 | Untreated Peat Soil | MNEALATTADRRTALAHFALQMSPHDAELLREALDQALGEHEAGESR |
Ga0370515_0474882_333_476 | 3300034163 | Untreated Peat Soil | MSDALATSPDRRTALTHFALQMSPHDAALLREALDQALGEPKAGESR |
Ga0370514_094417_40_183 | 3300034199 | Untreated Peat Soil | MNDALASSPDRRTALAHFALQMSPHDAALLREALDQALGEPKAGESR |
⦗Top⦘ |