NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F027335

Metagenome / Metatranscriptome Family F027335

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F027335
Family Type Metagenome / Metatranscriptome
Number of Sequences 195
Average Sequence Length 51 residues
Representative Sequence YMISLEENMIVALEINHYPVKLEHLLRVTHDGAEILSHYPVDPELVPA
Number of Associated Samples 172
Number of Associated Scaffolds 195

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.54 %
% of genes near scaffold ends (potentially truncated) 95.38 %
% of genes from short scaffolds (< 2000 bps) 90.26 %
Associated GOLD sequencing projects 163
AlphaFold2 3D model prediction Yes
3D model pTM-score0.45

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (94.872 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(8.205 % of family members)
Environment Ontology (ENVO) Unclassified
(29.744 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(34.872 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 30.26%    Coil/Unstructured: 69.74%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.45
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 195 Family Scaffolds
PF02738MoCoBD_1 18.97
PF13343SBP_bac_6 10.26
PF01979Amidohydro_1 6.15
PF04909Amidohydro_2 5.64
PF00565SNase 3.08
PF00903Glyoxalase 2.56
PF00753Lactamase_B 2.05
PF00892EamA 1.54
PF13147Obsolete Pfam Family 1.54
PF00557Peptidase_M24 1.03
PF07394DUF1501 0.51
PF01527HTH_Tnp_1 0.51
PF02012BNR 0.51
PF03070TENA_THI-4 0.51
PF13560HTH_31 0.51
PF13416SBP_bac_8 0.51
PF01717Meth_synt_2 0.51
PF04480DUF559 0.51
PF07944Glyco_hydro_127 0.51
PF04403PqiA 0.51
PF16881LIAS_N 0.51

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 195 Family Scaffolds
COG0620Methionine synthase II (cobalamin-independent)Amino acid transport and metabolism [E] 0.51
COG2995Intermembrane transporter PqiABC subunit PqiACell wall/membrane/envelope biogenesis [M] 0.51
COG3533Beta-L-arabinofuranosidase, GH127 familyCarbohydrate transport and metabolism [G] 0.51


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.38 %
UnclassifiedrootN/A4.62 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000033|ICChiseqgaiiDRAFT_c0549641All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium848Open in IMG/M
3300000550|F24TB_10015886All Organisms → cellular organisms → Bacteria1534Open in IMG/M
3300000559|F14TC_101099020All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium552Open in IMG/M
3300000789|JGI1027J11758_12146117All Organisms → cellular organisms → Bacteria → Proteobacteria604Open in IMG/M
3300000890|JGI11643J12802_10424700All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium556Open in IMG/M
3300000956|JGI10216J12902_103690891All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium561Open in IMG/M
3300002151|JGI24794J26673_10049662All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales900Open in IMG/M
3300002222|JGI24795J26692_1062872All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium620Open in IMG/M
3300003911|JGI25405J52794_10057243All Organisms → cellular organisms → Bacteria840Open in IMG/M
3300004061|Ga0055487_10101596All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300004070|Ga0055488_10166335All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300004114|Ga0062593_103003288All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Oceanospirillaceae → Marinobacterium → Marinobacterium jannaschii539Open in IMG/M
3300004268|Ga0066398_10026134All Organisms → cellular organisms → Bacteria1029Open in IMG/M
3300004463|Ga0063356_101859359All Organisms → cellular organisms → Bacteria → Proteobacteria906Open in IMG/M
3300004463|Ga0063356_103580330All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium669Open in IMG/M
3300004463|Ga0063356_105579406All Organisms → cellular organisms → Bacteria → Proteobacteria540Open in IMG/M
3300004633|Ga0066395_10012184All Organisms → cellular organisms → Bacteria3215Open in IMG/M
3300004778|Ga0062383_10427256All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300004782|Ga0062382_10331664All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300005171|Ga0066677_10045120All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2179Open in IMG/M
3300005333|Ga0070677_10667543All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300005333|Ga0070677_10853530All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium523Open in IMG/M
3300005338|Ga0068868_100446031All Organisms → cellular organisms → Bacteria1125Open in IMG/M
3300005339|Ga0070660_100260682All Organisms → cellular organisms → Bacteria1415Open in IMG/M
3300005354|Ga0070675_100313117All Organisms → cellular organisms → Bacteria1385Open in IMG/M
3300005366|Ga0070659_101860566All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300005367|Ga0070667_101353190All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300005444|Ga0070694_101740449All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Oceanospirillaceae → Marinobacterium → Marinobacterium jannaschii531Open in IMG/M
3300005459|Ga0068867_101445919All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300005518|Ga0070699_101506872All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300005536|Ga0070697_100808317All Organisms → cellular organisms → Bacteria → Proteobacteria830Open in IMG/M
3300005545|Ga0070695_100079855All Organisms → cellular organisms → Bacteria2160Open in IMG/M
3300005545|Ga0070695_100302513All Organisms → cellular organisms → Bacteria1183Open in IMG/M
3300005546|Ga0070696_100399616All Organisms → cellular organisms → Bacteria → Proteobacteria1075Open in IMG/M
3300005561|Ga0066699_10099741All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1913Open in IMG/M
3300005568|Ga0066703_10044742Not Available2456Open in IMG/M
3300005713|Ga0066905_101563144All Organisms → cellular organisms → Bacteria → Proteobacteria602Open in IMG/M
3300005764|Ga0066903_107277146All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300005764|Ga0066903_107277192All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300005764|Ga0066903_108855818All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300006049|Ga0075417_10135721All Organisms → cellular organisms → Bacteria → Proteobacteria1137Open in IMG/M
3300006163|Ga0070715_10145637All Organisms → cellular organisms → Bacteria1155Open in IMG/M
3300006755|Ga0079222_12317927All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300006844|Ga0075428_100800813All Organisms → cellular organisms → Bacteria → Proteobacteria1002Open in IMG/M
3300006844|Ga0075428_101204960All Organisms → cellular organisms → Bacteria798Open in IMG/M
3300006844|Ga0075428_102139435All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium578Open in IMG/M
3300006846|Ga0075430_100177683All Organisms → cellular organisms → Bacteria1771Open in IMG/M
3300006847|Ga0075431_100351244All Organisms → cellular organisms → Bacteria → Proteobacteria1482Open in IMG/M
3300006852|Ga0075433_10712671All Organisms → cellular organisms → Bacteria879Open in IMG/M
3300006854|Ga0075425_102191750All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium616Open in IMG/M
3300006876|Ga0079217_10007945All Organisms → cellular organisms → Bacteria3287Open in IMG/M
3300006880|Ga0075429_100459176All Organisms → cellular organisms → Bacteria1116Open in IMG/M
3300006881|Ga0068865_101000474All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium732Open in IMG/M
3300006903|Ga0075426_10498254All Organisms → cellular organisms → Bacteria → Proteobacteria905Open in IMG/M
3300006903|Ga0075426_10592790All Organisms → cellular organisms → Bacteria827Open in IMG/M
3300006904|Ga0075424_100311200All Organisms → cellular organisms → Bacteria1677Open in IMG/M
3300006918|Ga0079216_10743771All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium708Open in IMG/M
3300006954|Ga0079219_11041466All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300007004|Ga0079218_13936088All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium505Open in IMG/M
3300009012|Ga0066710_104729969All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium509Open in IMG/M
3300009081|Ga0105098_10819889All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300009087|Ga0105107_10532225All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium819Open in IMG/M
3300009087|Ga0105107_10870090All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300009089|Ga0099828_11442428All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300009093|Ga0105240_12395977All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium546Open in IMG/M
3300009094|Ga0111539_11799466All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium710Open in IMG/M
3300009100|Ga0075418_13107818All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300009111|Ga0115026_11190164All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium620Open in IMG/M
3300009147|Ga0114129_12206617All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300009153|Ga0105094_10134342All Organisms → cellular organisms → Bacteria1406Open in IMG/M
3300009157|Ga0105092_10350871All Organisms → cellular organisms → Bacteria836Open in IMG/M
3300009162|Ga0075423_12689092All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300009176|Ga0105242_10290943All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1487Open in IMG/M
3300009553|Ga0105249_10592719All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1162Open in IMG/M
3300009816|Ga0105076_1078496All Organisms → cellular organisms → Bacteria → Proteobacteria622Open in IMG/M
3300009931|Ga0131746_139874Not Available729Open in IMG/M
3300010047|Ga0126382_11729633All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300010048|Ga0126373_10096315All Organisms → cellular organisms → Bacteria2728Open in IMG/M
3300010166|Ga0126306_10258393All Organisms → cellular organisms → Bacteria1331Open in IMG/M
3300010358|Ga0126370_10642202All Organisms → cellular organisms → Bacteria923Open in IMG/M
3300010359|Ga0126376_13175523All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300010371|Ga0134125_10470665All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1393Open in IMG/M
3300010376|Ga0126381_105021640All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium507Open in IMG/M
3300010399|Ga0134127_12051023All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium650Open in IMG/M
3300011271|Ga0137393_11540206All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300011333|Ga0127502_10049645All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium516Open in IMG/M
3300011432|Ga0137428_1008362All Organisms → cellular organisms → Bacteria2766Open in IMG/M
3300011437|Ga0137429_1027143All Organisms → cellular organisms → Bacteria → Proteobacteria1642Open in IMG/M
3300012034|Ga0137453_1118842All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium527Open in IMG/M
3300012040|Ga0137461_1054609All Organisms → cellular organisms → Bacteria1092Open in IMG/M
3300012040|Ga0137461_1214151All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300012164|Ga0137352_1063747All Organisms → cellular organisms → Bacteria728Open in IMG/M
3300012172|Ga0137320_1031773All Organisms → cellular organisms → Bacteria1068Open in IMG/M
3300012357|Ga0137384_10761063All Organisms → cellular organisms → Bacteria785Open in IMG/M
3300012511|Ga0157332_1008327All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium981Open in IMG/M
3300012512|Ga0157327_1040708All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium624Open in IMG/M
3300012922|Ga0137394_10156737All Organisms → cellular organisms → Bacteria → Proteobacteria1939Open in IMG/M
3300012922|Ga0137394_11122220All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium650Open in IMG/M
3300012923|Ga0137359_11415487All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium583Open in IMG/M
3300012929|Ga0137404_10467471All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1121Open in IMG/M
3300012929|Ga0137404_11234092All Organisms → cellular organisms → Bacteria688Open in IMG/M
3300012944|Ga0137410_10457915All Organisms → cellular organisms → Bacteria1037Open in IMG/M
3300012948|Ga0126375_11115367All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300013297|Ga0157378_11428719All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium735Open in IMG/M
3300013297|Ga0157378_11458780All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium728Open in IMG/M
3300014263|Ga0075324_1002235Not Available2745Open in IMG/M
3300014264|Ga0075308_1068934All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300014883|Ga0180086_1033787All Organisms → cellular organisms → Bacteria1192Open in IMG/M
3300015256|Ga0180073_1003614All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → environmental samples → uncultured Verrucomicrobiota bacterium2184Open in IMG/M
3300015357|Ga0134072_10087565Not Available936Open in IMG/M
3300015373|Ga0132257_100417419All Organisms → cellular organisms → Bacteria1634Open in IMG/M
3300015373|Ga0132257_102984591All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium616Open in IMG/M
3300016422|Ga0182039_11975159All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium536Open in IMG/M
3300017659|Ga0134083_10104067All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1121Open in IMG/M
3300017944|Ga0187786_10374300All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300018053|Ga0184626_10027851All Organisms → cellular organisms → Bacteria → Proteobacteria2322Open in IMG/M
3300018053|Ga0184626_10253832All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium737Open in IMG/M
3300018072|Ga0184635_10092202All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira1194Open in IMG/M
3300018076|Ga0184609_10304671All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium745Open in IMG/M
3300018076|Ga0184609_10429185All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira610Open in IMG/M
3300018081|Ga0184625_10407610All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium700Open in IMG/M
3300018082|Ga0184639_10009437All Organisms → cellular organisms → Bacteria4659Open in IMG/M
3300018084|Ga0184629_10080889All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1555Open in IMG/M
3300018084|Ga0184629_10241548All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira942Open in IMG/M
3300018089|Ga0187774_10288328All Organisms → cellular organisms → Bacteria → Proteobacteria949Open in IMG/M
3300018089|Ga0187774_11099662All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium562Open in IMG/M
3300018422|Ga0190265_13158921All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium550Open in IMG/M
3300018429|Ga0190272_12019147All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium611Open in IMG/M
3300018469|Ga0190270_10154015All Organisms → cellular organisms → Bacteria → Proteobacteria1873Open in IMG/M
3300020006|Ga0193735_1005947All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium3900Open in IMG/M
3300020084|Ga0194110_10452585Not Available852Open in IMG/M
3300020195|Ga0163150_10376415All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300021080|Ga0210382_10035976All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon1886Open in IMG/M
3300021081|Ga0210379_10062857All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1500Open in IMG/M
3300021082|Ga0210380_10020547Not Available2795Open in IMG/M
3300021432|Ga0210384_11339654All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300021560|Ga0126371_10038621All Organisms → cellular organisms → Bacteria4512Open in IMG/M
3300022774|Ga0242725_158604Not Available729Open in IMG/M
3300025559|Ga0210087_1023989All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1240Open in IMG/M
3300025567|Ga0210076_1061756All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium814Open in IMG/M
3300025567|Ga0210076_1079482All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium716Open in IMG/M
3300025796|Ga0210113_1124541All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium501Open in IMG/M
3300025901|Ga0207688_10059575All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2150Open in IMG/M
3300025903|Ga0207680_11231863All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium533Open in IMG/M
3300025906|Ga0207699_10561367All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium829Open in IMG/M
3300025930|Ga0207701_11309694All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium593Open in IMG/M
3300025938|Ga0207704_10974516All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium716Open in IMG/M
3300025986|Ga0207658_10430437All Organisms → cellular organisms → Bacteria1165Open in IMG/M
3300026023|Ga0207677_10324991All Organisms → cellular organisms → Bacteria1280Open in IMG/M
3300026051|Ga0208911_1007464All Organisms → cellular organisms → Bacteria993Open in IMG/M
3300026061|Ga0208541_1032488All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium530Open in IMG/M
3300026089|Ga0207648_10606909All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1009Open in IMG/M
3300026116|Ga0207674_10793369All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium914Open in IMG/M
3300026314|Ga0209268_1056616All Organisms → cellular organisms → Bacteria1227Open in IMG/M
3300026329|Ga0209375_1082752Not Available1483Open in IMG/M
3300026550|Ga0209474_10283515All Organisms → cellular organisms → Bacteria993Open in IMG/M
3300026552|Ga0209577_10341027All Organisms → cellular organisms → Bacteria1106Open in IMG/M
3300027533|Ga0208185_1052270All Organisms → cellular organisms → Bacteria984Open in IMG/M
3300027617|Ga0210002_1018351All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1118Open in IMG/M
3300027639|Ga0209387_1116096All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium671Open in IMG/M
3300027665|Ga0209983_1161476All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium514Open in IMG/M
3300027765|Ga0209073_10249253All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium690Open in IMG/M
3300027818|Ga0209706_10296245All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium767Open in IMG/M
3300027843|Ga0209798_10016317All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium4014Open in IMG/M
3300027843|Ga0209798_10363968All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300027874|Ga0209465_10041385All Organisms → cellular organisms → Bacteria2191Open in IMG/M
3300028293|Ga0247662_1092756All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300028814|Ga0307302_10102972All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1364Open in IMG/M
3300028828|Ga0307312_10381942All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium923Open in IMG/M
3300030619|Ga0268386_10868260All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300030620|Ga0302046_10982804All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300031228|Ga0299914_11151791All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium624Open in IMG/M
3300031229|Ga0299913_10267971All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1692Open in IMG/M
3300031229|Ga0299913_10919416All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium844Open in IMG/M
3300031562|Ga0310886_10639722All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium657Open in IMG/M
3300031820|Ga0307473_10259565All Organisms → cellular organisms → Bacteria1070Open in IMG/M
3300031833|Ga0310917_11213275All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium501Open in IMG/M
3300031911|Ga0307412_12237840All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium509Open in IMG/M
3300031941|Ga0310912_11324141All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium545Open in IMG/M
3300031965|Ga0326597_11799954All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium574Open in IMG/M
3300032012|Ga0310902_10573841All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium746Open in IMG/M
3300032132|Ga0315336_1039370All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2655Open in IMG/M
3300032205|Ga0307472_100280411All Organisms → cellular organisms → Bacteria1326Open in IMG/M
3300032211|Ga0310896_10603282All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium613Open in IMG/M
3300032261|Ga0306920_100320369All Organisms → cellular organisms → Bacteria → Proteobacteria2308Open in IMG/M
3300032770|Ga0335085_10720670Not Available1107Open in IMG/M
3300032770|Ga0335085_12480444All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300033004|Ga0335084_10355356All Organisms → cellular organisms → Bacteria1512Open in IMG/M
3300033433|Ga0326726_10873406All Organisms → cellular organisms → Bacteria → Proteobacteria872Open in IMG/M
3300033475|Ga0310811_10890405All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium806Open in IMG/M
3300033557|Ga0316617_101873119All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300033814|Ga0364930_0240444All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300034090|Ga0326723_0082665All Organisms → cellular organisms → Bacteria1379Open in IMG/M
3300034354|Ga0364943_0335736All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira576Open in IMG/M
3300034690|Ga0364923_0107962All Organisms → cellular organisms → Bacteria703Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere8.21%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil5.13%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.13%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.64%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment4.62%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.62%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.10%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.59%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil3.59%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.59%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment3.08%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands3.08%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.08%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere2.56%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment2.05%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.05%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.05%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands2.05%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil1.54%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.54%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.54%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.54%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.54%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.54%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.03%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.03%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.03%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.03%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.03%
Host-AssociatedHost-Associated → Porifera → Unclassified → Unclassified → Unclassified → Host-Associated1.03%
MarineHost-Associated → Porifera → Sponge → Unclassified → Unclassified → Marine1.03%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.03%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.03%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.03%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland0.51%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.51%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat0.51%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.51%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.51%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.51%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.51%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.51%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.51%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.51%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.51%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.51%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.51%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.51%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.51%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.51%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.51%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.51%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000789Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002151Host-associated microbial community of the marine sponge Aplysina aerophoba from Gulf of Piran - sponge mesohyl, lysed by proteinase K digestionHost-AssociatedOpen in IMG/M
3300002222Host-associated microbial community of the marine sponge Aplysina aerophoba from Gulf of Piran - sponge pinacoderm, lysed by bead beatingHost-AssociatedOpen in IMG/M
3300003911Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300004061Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqC_D2EnvironmentalOpen in IMG/M
3300004070Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004268Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBioEnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300004778Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3FreshEnvironmentalOpen in IMG/M
3300004782Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2FreshEnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005333Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaGHost-AssociatedOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009087Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009111Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009153Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015EnvironmentalOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009816Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10EnvironmentalOpen in IMG/M
3300009931Microbial communities of marine sponge Rhopaloides odorabile from Great Barrier Reef, Australia - R7Host-AssociatedOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300011333Cornfield soil microbial communities from Stanford, California, USA - CI-CA-CRN metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300011432Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2EnvironmentalOpen in IMG/M
3300011437Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2EnvironmentalOpen in IMG/M
3300012034Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT526_2EnvironmentalOpen in IMG/M
3300012040Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT746_2EnvironmentalOpen in IMG/M
3300012164Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT730_2EnvironmentalOpen in IMG/M
3300012172Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT366_2EnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012511Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_10EnvironmentalOpen in IMG/M
3300012512Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510Host-AssociatedOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014263Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1EnvironmentalOpen in IMG/M
3300014264Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D2_rdEnvironmentalOpen in IMG/M
3300014883Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10DEnvironmentalOpen in IMG/M
3300015256Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT333_16_10DEnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017659Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300017944Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MGEnvironmentalOpen in IMG/M
3300018053Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1EnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300020006Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2EnvironmentalOpen in IMG/M
3300020084Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200mEnvironmentalOpen in IMG/M
3300020195Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.P2.IBEnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redoEnvironmentalOpen in IMG/M
3300021082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redoEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022774Microbial communities of marine sponge Rhopaloides odorabile from Great Barrier Reef, Australia - R7 Version 2Host-AssociatedOpen in IMG/M
3300025559Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025567Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025796Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026051Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026061Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026314Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes)EnvironmentalOpen in IMG/M
3300026329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027533Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 (SPAdes)EnvironmentalOpen in IMG/M
3300027617Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027639Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes)EnvironmentalOpen in IMG/M
3300027665Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027818Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027843Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300028293Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK03EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300030619Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq)EnvironmentalOpen in IMG/M
3300030620Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111EnvironmentalOpen in IMG/M
3300031228Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57EnvironmentalOpen in IMG/M
3300031229Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38EnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031911Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1Host-AssociatedOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032132Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - ASW #5EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M
3300033557Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_BEnvironmentalOpen in IMG/M
3300033814Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17EnvironmentalOpen in IMG/M
3300034090Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00NEnvironmentalOpen in IMG/M
3300034354Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17EnvironmentalOpen in IMG/M
3300034690Sediment microbial communities from East River floodplain, Colorado, United States - 60_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ICChiseqgaiiDRAFT_054964133300000033SoilINHYPVKLEHLLRVTSDGAEILSKYPVDPELISA*
F24TB_1001588633300000550SoilVTLEENMIIALEINHNPVKLEHLLRVTESGVEILSNYPLDPELIPA*
F14TC_10109902023300000559SoilENMIVALEINHYPVKLEHLLRVTADGAEILSQYPVDPELVPA*
JGI1027J11758_1214611723300000789SoilGGDPEEYEVTLEENMIIALEINHNPVKLEHLLRVTDSGIEILSKYQLDPELVPA*
JGI11643J12802_1042470013300000890SoilVYESPWLRGGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTSDGAEILSKYPVDPELISA*
JGI10216J12902_10369089123300000956SoilMIVACEINHYPVKLEHLLRVTKDGPEILSEYPVDPELVAA*
JGI24794J26673_1004966213300002151Host-AssociatedPPEYELALEENMIVALEINHHPVKLEHLLRVTADGAEILSTYPMEPELAPA*
JGI24795J26692_106287223300002222Host-AssociatedEYELALEENMIVALEINHHPVKLEHLLRVTADGAEILSTYPMEPELAPA*
JGI25405J52794_1005724323300003911Tabebuia Heterophylla RhizosphereGDPEEYGVTLEKNMIIALEINHNPVKLEHLLRVTESGVEILSTYPMDPELIAA*
Ga0055487_1010159623300004061Natural And Restored WetlandsYMISLEENMIVACEINHYPVKLEHLLRVTKDGPEILSEYPVDPELVPA*
Ga0055488_1016633513300004070Natural And Restored WetlandsENMIVACEINHYPVKLEHLLRVTKDGPEILSEYPVDPELVPA*
Ga0062593_10300328813300004114SoilGVGLCVYESPWLRGGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTSDGAEILSKYPVDPELISA*
Ga0066398_1002613413300004268Tropical Forest SoilGGDPEEFGVTLEENMIITLEINHNPVKLEHLLRVTDMGVEILSQYQLDPELIPA*
Ga0063356_10185935913300004463Arabidopsis Thaliana RhizosphereDPEKYMISLEENMIVALEINHYPVKLEHLLRVTANGAEILSQYPVDPELVPA*
Ga0063356_10358033013300004463Arabidopsis Thaliana RhizosphereVNLEENMIVALEINHYPVKLEHLLRITDSGAEILSRYPVDPELIPA*
Ga0063356_10557940613300004463Arabidopsis Thaliana RhizosphereLCVYESPWLRGGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTVDGAEILSEYPVDPELVPA*
Ga0066395_1001218443300004633Tropical Forest SoilVTLEENMIITLEINHNPVKLEHLLRVTDMGVEILSQYQLDPELIPA*
Ga0062383_1042725613300004778Wetland SedimentDPEKYMISLEENMIVACEINHYPVKLEHLLRVTKDGPEILSEYPVDPELVPA*
Ga0062382_1033166423300004782Wetland SedimentLEENMIVACEINHYPVKLEHLLRVTKDGPEILSEYPVDPELVPA*
Ga0066677_1004512033300005171SoilWLRGGDPDEYLVTLEENMIIALEINHNPVKLEHLLRVTDSGVEILSNYQLDTELVPA*
Ga0070677_1066754313300005333Miscanthus RhizosphereLEENMIVALEINHYPVKLEHLLRVTHDGAEILSHYPVDPELVPA*
Ga0070677_1085353013300005333Miscanthus RhizosphereSPWLRGDDPPEYAVDLEENMIVALEINHYPVKLEHLLRITDAGAEILSRYPVNPELVPA*
Ga0068868_10044603123300005338Miscanthus RhizosphereYMISLEENMIVALEINHYPVKLEHLLRVTHDGAEILSHYPVDPELVPA*
Ga0070660_10026068223300005339Corn RhizosphereCIYESPWLRGGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTHDGAEILSHYPVDPELVPA*
Ga0070675_10031311713300005354Miscanthus RhizosphereGGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTHDGAEILSHYPVDPELVPA*
Ga0070659_10186056613300005366Corn RhizosphereYESPWLRGGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTHDGAKILSHYPVDPELVPA*
Ga0070667_10135319023300005367Switchgrass RhizosphereMISLEENMIVALEINHYPVKLEHLLRVTHDGAEILSHYPVDPELVPA*
Ga0070694_10174044913300005444Corn, Switchgrass And Miscanthus RhizosphereWLRGGDPEKYMISLEENMIVALEVNHYPVKLEHLLRVTADGAEILSQYPVDAELVPA*
Ga0068867_10144591923300005459Miscanthus RhizosphereKYMISLEENMIVALEINHYPVKLEHLLRVTHDGAEILSHYPVDPELVPA*
Ga0070699_10150687223300005518Corn, Switchgrass And Miscanthus RhizosphereYLVTLEENMIIALEINHLPVKLEHLLRVTDSGVEILSQYQLDPELVPA*
Ga0070697_10080831713300005536Corn, Switchgrass And Miscanthus RhizosphereNMIVALEVNHYPVKLEHLLRVTADGAEILSQYPVDAELVPA*
Ga0070695_10007985523300005545Corn, Switchgrass And Miscanthus RhizosphereISLEENMIVALEINHYPVKLEHLLRVTHDGAEILSHYPVDPELVPA*
Ga0070695_10030251313300005545Corn, Switchgrass And Miscanthus RhizosphereKYMISLEENMIVALEINHYPVKLEHLLRVTADSAEILSQYPVDPELVPA*
Ga0070696_10039961613300005546Corn, Switchgrass And Miscanthus RhizosphereYESPWLRGGDPEKYMISLEENMIVALEVNHYPVKLEHLLRVTADGAEILSQYPVDAELVPA*
Ga0066699_1009974113300005561SoilGDPDEYLVTLEENMIIALEINHNPVKLEHLLRVTDSGVEILSNYQLDPELVPA*
Ga0066703_1004474213300005568SoilINHNPVKLEHLLRVTDSGVEILSNYQLDPELVPA*
Ga0066905_10156314423300005713Tropical Forest SoilEYGVTLEENMIIALEINHNPVKLEHLLRVTESGVEILSTHPMDPELIAA*
Ga0066903_10727714613300005764Tropical Forest SoilYAVTLEENMIIALEVNHLPVKLEHLLRVTDSGVEILSTYHLDPELVPA*
Ga0066903_10727719213300005764Tropical Forest SoilYAVTLEENMIIALEVNHLPVKLEHLLRVTDSGVEILSTYQLDPELVPA*
Ga0066903_10885581813300005764Tropical Forest SoilLCIYEAPWLRGGDPDEYAVTLEENMIIALEINHLPVKLEHLLRVTDSGVEILSMYQLDPELVPA*
Ga0075417_1013572113300006049Populus RhizosphereVTLEENMIIALEINHNPVKLEHLLRVTESGVEILSNYLLDPELIPA*
Ga0070715_1014563713300006163Corn, Switchgrass And Miscanthus RhizosphereIYESPWLRGGDPEKYLISLEENMIVALEINHYPVKLEHLMRVTHDGAEILSHYPVDPELVPA*
Ga0079222_1231792723300006755Agricultural SoilYMISLEENMIVALEINHYPVKLEHLLRVTADGAEILSHYPVDPGLLPA*
Ga0075428_10080081313300006844Populus RhizospherePEKYMISLEENMIVACEINHYPVKLEHLLRVTQDGAEILSEYPVDPELVPA*
Ga0075428_10120496013300006844Populus RhizosphereWLRGGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTHDGAEVLSRYPVDAELVPA*
Ga0075428_10213943513300006844Populus RhizosphereCIYESPWLRGGDPPEYVVNLEEDMIVALEINHYPVKLEHLLRVTDSGAEILSRYPVDPELVPA*
Ga0075430_10017768333300006846Populus RhizosphereEENMIIALEINHNPVKLEHLLRVTESGVEILSNYPLDPELIPA*
Ga0075431_10035124423300006847Populus RhizosphereLEENMIIALEINHNPVKLEHLLRVTESGVEILSNYPLDPELIPA*
Ga0075433_1071267113300006852Populus RhizosphereEINHYPVKLEHLLRVTADGAEILSQYPVDPELMPA*
Ga0075425_10219175013300006854Populus RhizosphereGLCIYESPWLRGGDPEKYMISLAENMIVALEINHYPVKLEHLLRVTADGAEILSNYPVEPELMPA*
Ga0079217_1000794513300006876Agricultural SoilQKYMISLEENMIVALEINHYPVKLEHLLRVTANGAEILSQYPVDPELVPA*
Ga0075429_10045917613300006880Populus RhizosphereNMIVALEINHYPVKLEHLLRVTADGAEILSQYPVDPELVPA*
Ga0068865_10100047423300006881Miscanthus RhizosphereMISLEENMIVALEINHYPVKLEHLLRVTADGAEILSNYPVEPELVPA*
Ga0075426_1049825423300006903Populus RhizosphereVGLCIYESPWLRGGDPEKYLISLEEDMIVALEINHYPVKLEHLLRVTHDGAEILSHYPVDPELVPA*
Ga0075426_1059279023300006903Populus RhizosphereALEINHYPVKLEHLLRVTADGAEILSHYPVDPVLLPA*
Ga0075424_10031120013300006904Populus RhizospherePWLRGGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTADGAEILSHYPVDPGLLPA*
Ga0079216_1074377113300006918Agricultural SoilLEINHYPVKLEHLLRVTDSGAEILSRYPVDPELVPA*
Ga0079219_1104146623300006954Agricultural SoilMVIALEINHLPVKLEHLLGVTAAGAEILSTYQLDPELMPA*
Ga0079218_1393608823300007004Agricultural SoilWLRGGDPQKYMISLEENMIVALEINHYPVKLEHLLRVTAGGAEILSQYPVDPELVPA*
Ga0066710_10472996923300009012Grasslands SoilVGLCIYESPWLRGGDPAKYMISLEENMIVALEINHYPVKLEHLLRVTADGAEILSQYPVDPELVSA
Ga0105098_1081988913300009081Freshwater SedimentENMIVALEINHYPVKLEHLLRVTDKGAEVLSTYPMDPELVPA*
Ga0105107_1053222523300009087Freshwater SedimentDPEKYMISLEENMIVALEINHYPVKLEHLLRVTADGAEILSLYPIDPELVPA*
Ga0105107_1087009013300009087Freshwater SedimentMIVACEINHYPVKLEHLLRVTKDGPEILSEYPVDPELIPA*
Ga0099828_1144242823300009089Vadose Zone SoilLRGGDPDEYLVTLEENMIVALEINHLPVKLEHLLRVTESGAEILSTYPLDPELVPA*
Ga0105240_1239597713300009093Corn RhizosphereLEINHYPVKLEHLLRVSADGAEILSQYPVDPELVAA*
Ga0111539_1179946623300009094Populus RhizosphereSLEENMIVALEINHYPVKLEHLLRVTADGAEILSHYPVDPGLLPA*
Ga0075418_1310781813300009100Populus RhizosphereRGGDPEEYGVTLEENMIIALEINHNPVKLEHLLRVTESGVEILSNYPLDRELVPA*
Ga0115026_1119016413300009111WetlandMIVACEINHYPVKLEHLLRVTKDGPEILSEYPVDPELVPA*
Ga0114129_1220661723300009147Populus RhizosphereWLRGGDPDEYAATLEENMIIALEINHLPVKLEHLLRVTDSGVEILSTYQLDSELVPA*
Ga0105094_1013434223300009153Freshwater SedimentWLRGGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTADGAEILSLYPIDPELVPA*
Ga0105092_1035087123300009157Freshwater SedimentLEINHNPVKLEHLLRVTGSGVEILSNYQLDPELIPA*
Ga0075423_1268909223300009162Populus RhizosphereALEINHLPVKLEHLLRVTDSGVEILSTYQLDSELVPA*
Ga0105242_1029094313300009176Miscanthus RhizosphereWLRGGDPEKYMISLAENMIVALEINHYPVKLEHLLRVTADGAEILSNYPVEPELMPA*
Ga0105249_1059271933300009553Switchgrass RhizosphereVGLCIYESPWLRGGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTHDGAKILSHYPVDPELVPA*
Ga0105076_107849613300009816Groundwater SandGVTLEKNMIIALEINHNPVKLEHLLRVTESGVEILSNYPMDPELIPA*
Ga0131746_13987433300009931MarineGFDPPEYNLTLAENMIIALEINHHPVKLEHLLRVTADGAEILSTYPMEPELAPA*
Ga0126382_1172963323300010047Tropical Forest SoilLSIYEAPWLRGGDPEEYGVTLEENMIIALEINHNPVKLEHLLRVTDNGVEILSQYQLDPKLIPS*
Ga0126373_1009631523300010048Tropical Forest SoilVTLEENMIITLEINHNSVKLEHLLRVTDMGVEILSQYQLDPELIPA*
Ga0126306_1025839323300010166Serpentine SoilLCIYESPWLRGGDPEKYMISLEENMIVACEINHYPVKLEHLLRVTNDGPEILSEYPVDPELVPA*
Ga0126370_1064220223300010358Tropical Forest SoilPWLRGGDPEEYGVTLEENMIIALEINHNPVKLEHLLRVAESGVEILSTYPMDPELIAA*
Ga0126376_1317552323300010359Tropical Forest SoilTLEENMIITLEINHNPVKLEHLLRVTDNGVEILSQYQLDPELIPA*
Ga0134125_1047066523300010371Terrestrial SoilLCIYESPWLRGGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTHDGAEILSHYPVDPELVQA*
Ga0126381_10502164023300010376Tropical Forest SoilEENMIVALEINHYPVKLEHLLRVTADGAEILSHYPVDPELVPA*
Ga0134127_1205102323300010399Terrestrial SoilPWLRGGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTHDGAEILSHYPVDPELVPA*
Ga0137393_1154020613300011271Vadose Zone SoilEYLVTLEENMIVALEINHLPVKLEHLLRVTESGAEILSTYPLDPELVPA*
Ga0127502_1004964513300011333SoilVGLCIYESPWLRGGDPEHYMVGLQENMIVALEINHYPVKLEHLLRVTATGAEILSTYPMDAELVPA*
Ga0137428_100836213300011432SoilGLCIYEAPWLRGSDPEEYGVTLERNMIIALEINHNPVKLEHLLRVTESGVEILSKYPMDPELLPA*
Ga0137429_102714333300011437SoilEKYMISLEENMIVACEINHYPVKLEHLLRVTKDGAEILSEYPVDPELVPA*
Ga0137453_111884213300012034SoilHGVGLCIYESPWLRGGDPGKYMISLEENMIVALEINHYPVKLEHLLRVTKDGAEILSEYPVDPELVPA*
Ga0137461_105460923300012040SoilLRGGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTKDGGEILSEYPVDPELVPA*
Ga0137461_121415113300012040SoilMISLEENMIVACEINHYPVKLEHLLRVTKDGGEILSEYPVDPELVPA*
Ga0137352_106374723300012164SoilVALEINHYPVKLEHLLRVTDKGAEILSTYPMDPELVPA*
Ga0137320_103177323300012172SoilDPEKYMISLEENMIVACEINHYPVKLEHLLRVTKDGAEILSEYPVDPELVPA*
Ga0137384_1076106313300012357Vadose Zone SoilNMIIALEINHNPVKLEHLLRVTDSGVEILSNYQLDAELVPA*
Ga0157332_100832723300012511SoilPWLRGGDPEKYMISLAENMIVALEINHYPVKLEHLLRVTADGAEILSNYPVEPELVSA*
Ga0157327_104070823300012512Arabidopsis RhizosphereGDPEKYMISLAENMIVALEINHYPVKLEHLLRVTADGAEILSNYPVEPELMPA*
Ga0137394_1015673733300012922Vadose Zone SoilCIYESPWLRGGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTADGAEILSHYPVDPELVPA*
Ga0137394_1112222013300012922Vadose Zone SoilVGLCIYESPWLRGGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTADGAEILSQYPVDPELMPA*
Ga0137359_1141548713300012923Vadose Zone SoilDPEKYMISLEENMIVALEINHYPVKLEHLLRVTADGAEILSHYPVDPELVPA*
Ga0137404_1046747113300012929Vadose Zone SoilMISLEENMIVALEINHYPVKLEHLLRVTADGAEILSQYPVDPELVAA*
Ga0137404_1123409223300012929Vadose Zone SoilRGGDPEEYGVTLEENMIIALEINHNPVKLEHLLRVADDGVGILSNYQLDPELVPA*
Ga0137410_1045791513300012944Vadose Zone SoilYGVTLEENMIIALEINHNPVKLEHLLRVADDGVEILSNYQLDPELVPA*
Ga0126375_1111536723300012948Tropical Forest SoilALEMNHNPVKLEHLLRVTVSGVEILSTYPMDPELIAA*
Ga0157378_1142871923300013297Miscanthus RhizosphereSPWLRGGDPEKYMISLEENMIVALEVNHYPVKLEHLLRVTADGAEILSQYQVDPELTPA*
Ga0157378_1145878013300013297Miscanthus RhizosphereWLRGGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTHDGAEILSHYPVDPELVPA*
Ga0075324_100223513300014263Natural And Restored WetlandsMIVALEVNHYPVKLEHLLRVTANGAEILSQYPVDPELVPA*
Ga0075308_106893413300014264Natural And Restored WetlandsNMIVACEINHYPVKLEHLLRVTKDGGEILSEYPVDPELVPA*
Ga0180086_103378723300014883SoilGDPEKYMISLEENMIVACEINHYPVKLEHLMRVTKDGGEILSEYPVDPELVPA*
Ga0180073_100361413300015256SoilMIVALEINHYPVKLEHLLRVTKDGGEILSEYPVDPELVPA*
Ga0134072_1008756513300015357Grasslands SoilVGLCIYEAPWLRGGDPDEYLVTLEENMIIALEINHNPVKLEHLLRVTDSGVEILSSYQLDAELVPA*
Ga0132257_10041741933300015373Arabidopsis RhizosphereWLRGGDPEKYLISLEEDMIVALEINHYPVKLEHLLRVTHDGAEILSHYPVDPELVPA*
Ga0132257_10298459113300015373Arabidopsis RhizosphereVALEINHYPVKLEHLLRVTADGAEILSNYPVEPELVSA*
Ga0182039_1197515913300016422SoilRGGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTADGAEILSHYPVDPELVPA
Ga0134083_1010406723300017659Grasslands SoilDPAKYMISLEENMIVALEINHYPVKLEHLLRVTAGGAEILSQYPVDPELVPA
Ga0187786_1037430013300017944Tropical PeatlandLISLEENMIVACEINHYPVKLEHLLRVTKDGAEILSDYPVDPELVAA
Ga0184626_1002785113300018053Groundwater SedimentENMIVALEINHYPVKLEHLLRVTADGAEILSQYPVDPELVPA
Ga0184626_1025383223300018053Groundwater SedimentMIVALEINHYPVKLEHLLRVTASGAEILSTYQMDPELVAA
Ga0184635_1009220223300018072Groundwater SedimentEENMIIALEINHNPVKLEHLLRVTESGVEILSNYPLDPELVSA
Ga0184609_1030467123300018076Groundwater SedimentHGVGLCIYESPWLRGGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTADGAEILSQYPVDPELVPA
Ga0184609_1042918513300018076Groundwater SedimentMIIALEINHNPVKLEHLLRVTESGVEILSNYPLDPELIPA
Ga0184625_1040761013300018081Groundwater SedimentRGGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTADGAEILSQYTVDPELVPA
Ga0184639_1000943763300018082Groundwater SedimentEENMIVALEINHYPVKLEHLLRVTASGAEILSTYQMDPELVAA
Ga0184629_1008088913300018084Groundwater SedimentLEENMIVALEINHYPVKLEHLLRVTNKGAEILSTYPMDPELVPA
Ga0184629_1024154823300018084Groundwater SedimentYEAPWLRGGDPEEYGMTLEENMIIALEINHNPVKLEHLLRVTESGVEILSNYPLDPELVP
Ga0187774_1028832833300018089Tropical PeatlandGVTLEENMIIALEINHDPVKLEHLLRVTDDGVEILSNYQLDPELLPA
Ga0187774_1109966223300018089Tropical PeatlandAKYMIALEENMIVALEINHYPVKLEHLLRVTADGAEILSEYPVDPELMPA
Ga0190265_1315892123300018422SoilGLCVYESPWLRGGDPEKYMISLEEDMIVALEINHYPVKLEHLLRVTTDGAEILSKYPVDPELVPA
Ga0190272_1201914723300018429SoilMCVYESPWLRGGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTANGAEILSQYPVDPELIPA
Ga0190270_1015401533300018469SoilCEINHYPVKLEHLLRVTKDGGEILSEYPVDPELVPA
Ga0193735_100594743300020006SoilLEINHYPVKLEHLLRVTADGAEILSQYPVDPELVPA
Ga0194110_1045258523300020084Freshwater LakeEAPWLRGGDPAEYMVSLEANMIVALEINHYPVKLENLLRVTANGYEILSEYPMDPELVPA
Ga0163150_1037641523300020195Freshwater Microbial MatPEKYMISLEENMIVACEINHYPVKLEHLMRVTKDGGEILSEYPVDPELVPA
Ga0210382_1003597613300021080Groundwater SedimentPAKYMISLEENMIVALEINHYPVKLEHLLRVTADGAEILSQYPVDSELVPA
Ga0210379_1006285713300021081Groundwater SedimentEKYMISLEENMIVACEINHYPVKLEHLLRVTKDGAEILSEYPVDPELVPA
Ga0210380_1002054713300021082Groundwater SedimentKCMISLEENMIVACEINHYPVKLEHLLRVTKDGAEILSEYPVDPELVPA
Ga0210384_1133965423300021432SoilENMIVALEINHLPVKLEHLLRVTDSGVEILSTYQLDPELVPA
Ga0126371_1003862173300021560Tropical Forest SoilVTLEENMIITLEINHNPVKLEHLLRVTDMGVEILSQYQLDPELIPA
Ga0242725_15860433300022774MarineGFDPPEYNLTLAENMIIALEINHHPVKLEHLLRVTADGAEILSTYPMEPELAPA
Ga0210087_102398933300025559Natural And Restored WetlandsGGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTSDGAEILSKYPVDPELIPA
Ga0210076_106175613300025567Natural And Restored WetlandsENMIVALEINHYPVKLEHLLRVTSDGAEILSKYPVDPELIPA
Ga0210076_107948223300025567Natural And Restored WetlandsWLRGGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTSDGAEILSKYPVDPELIPA
Ga0210113_112454113300025796Natural And Restored WetlandsALEINHYPVKLEHLLRVTSDGAEILSKYPVDPELIPA
Ga0207688_1005957523300025901Corn, Switchgrass And Miscanthus RhizosphereLCIYESPWLRGGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTHDGAEILSHYPVDPELVPA
Ga0207680_1123186313300025903Switchgrass RhizosphereIVALEINHYPVKLEHLLRVTHDGAEILSHYPVDPELVPA
Ga0207699_1056136713300025906Corn, Switchgrass And Miscanthus RhizosphereMIVALEINHYPVKLEHLMRVTHDGAEILSHYPVDPELVPA
Ga0207701_1130969423300025930Corn, Switchgrass And Miscanthus RhizosphereNMIVACEINHYPVKLEHLLRVTKDGAEILSEYPVDPELVPA
Ga0207704_1097451613300025938Miscanthus RhizosphereMISLEENMIVALEINHYPVKLEHLLRVTHDGAEILSHYPVDPELVPA
Ga0207658_1043043723300025986Switchgrass RhizosphereGLCIYESPWLRGGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTHDGAEILSHYPVDPELVPA
Ga0207677_1032499123300026023Miscanthus RhizosphereYMISLEENMIVALEINHYPVKLEHLLRVTHDGAEILSHYPVDPELVPA
Ga0208911_100746433300026051Natural And Restored WetlandsEVNHYPVKLEHLLRVTADGAEILSQYPVDPELTPA
Ga0208541_103248813300026061Natural And Restored WetlandsLEENMIVACEINHYPVKLEHLLRVTKDGPEILSEYPVDPELVPA
Ga0207648_1060690923300026089Miscanthus RhizosphereVGLCIYESPWLRGGDPEEYIVDLEENMIVALEINHYPVKVEHLLRVTANGYEILSEYPMDSELIPA
Ga0207674_1079336913300026116Corn RhizospherePWLRGGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTHDGAKILSHYPVDPELVPA
Ga0209268_105661623300026314SoilGDPDEYLVTLEENMIIALEINHNPVKLEHLLRVTDSGVEILSNYQLDAELVPA
Ga0209375_108275213300026329SoilDADEYLVTLEENMIIALEINHNPVKLEHLLRVTDSGVEILSSYQLDAELVPA
Ga0209474_1028351523300026550SoilIIALEINHNPVKLEHLLRVTDSGVEILSSYQLDAELVPA
Ga0209577_1034102723300026552SoilDEYLVTLEENMIIALEINHNPVKLEHLLRVTDSGVEILSNYQLDAELVPA
Ga0208185_105227013300027533SoilDPEKYMISLEENMIVACEINHYPVKLEHLLRVTKDGGEILSEYPVDPELVPA
Ga0210002_101835113300027617Arabidopsis Thaliana RhizosphereRGGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTSDGAEILSKYPVDPELISA
Ga0209387_111609613300027639Agricultural SoilEEDMIVALEINHYPVKLEHLLRVTDSGAEILSRYPVDPELVPA
Ga0209983_116147623300027665Arabidopsis Thaliana RhizosphereGVGLCVYESPWLRGGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTSDGAEILSKYPVDPELISA
Ga0209073_1024925313300027765Agricultural SoilGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTHDGAEILSHYPVDPELVPA
Ga0209706_1029624523300027818Freshwater SedimentENMIVALEINHYPVKLEHLLRVTADGAEILSLYPIDPELVPA
Ga0209798_1001631763300027843Wetland SedimentPEKYMISLEENMIVACEINHYPVKLEHLLRVTKDGPEILSEYPVDPELVPA
Ga0209798_1036396813300027843Wetland SedimentGGDPEKYMISLEENMIVACEINHYPVKLEHLLRVTKDGPEILSEYPVDPELVPA
Ga0209465_1004138533300027874Tropical Forest SoilMIITLEINHNPVKLEHLLRVTDMGVEILSQYQLDPELIPA
Ga0247662_109275613300028293SoilRGGDPEKYMISLEENMIVACEINHYPVKLEHLLRVTKDGAEILSEYPVDPELVPA
Ga0307302_1010297213300028814SoilSPWLRGGDPAKYMISLEENMIVALEINHYPVKLEHLLRVTADGAEILSQYPVDPELVPA
Ga0307312_1038194213300028828SoilMIVALEINHYPVKLEHLLRVTADGAEILSQYPVDPELMPA
Ga0268386_1086826023300030619SoilEINHYPVKLEHLLRVTAGGAEILSQYPVDPELVPA
Ga0302046_1098280423300030620SoilYMVSLEENMIVALEINHYPVKLEHLLRVTNEGAEILSTYPMDPELVPA
Ga0299914_1115179113300031228SoilAKYMISLEENMIVALEINHYPVKLEHLLRVTADGAEILSRYPVDPELVPA
Ga0299913_1026797113300031229SoilYMVSLEENMIVALEVNHYPVKLEHLLRVTARGAEILSQYPVDPELVPA
Ga0299913_1091941613300031229SoilPWLRGGDPPQYAVNLEENMIVALEINHYPVKLEHLLRVTDCGAEVLSTYPMDPELTPA
Ga0310886_1063972223300031562SoilPWLRGGDPEKYMISLEENMIVALEVNHYPVKLEHLLRVTADGAEILSQYPVDPELMPA
Ga0307473_1025956513300031820Hardwood Forest SoilIYEAPWLRGGDPDEYAVTLEENMIIALEINHLPVKLEHLLRVTDSGVEILSTYQLDPELVPA
Ga0310917_1121327523300031833SoilCIYESPWLRGGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTADGAEILSRYPVDRELVPA
Ga0307412_1223784013300031911RhizosphereIYESPWLRGGDAPEYAVNLEEDMIVALEINHYPVKLEHLLRVTDSGAEILSRYPVDPELVPA
Ga0310912_1132414113300031941SoilENMIVALEINHYPVKLEHLLRVTADGAEILSRYPVDRELVPA
Ga0326597_1179995413300031965SoilGLCIYESPWLRGGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTSNGAEILSEYPVDPELVPA
Ga0310902_1057384123300032012SoilPEKYLISLEEDMIVALEINHYPVKLEHLLRVTHDGAEILSHYPVDPELVPA
Ga0315336_103937043300032132SeawaterPAKYQLELEENMIIALEMNHHPVKLEHLLRVTATGSEILSTYPMEPELTPA
Ga0307472_10028041123300032205Hardwood Forest SoilMIIALEVNHLPVKLEHLLRVTDSGVEILSTYQLDPELVPA
Ga0310896_1060328223300032211SoilLCIYESPWLRGGDPEKYLISLEENMIVALEINHYPVKLEHLLRVTRDGAEILSRYPVDPELVPA
Ga0306920_10032036913300032261SoilYESPWLRGGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTADGAEILSRYPVDRELVP
Ga0335085_1072067013300032770SoilEINHLPVKLEHLLRVTDSGVEILSKYQLDPELVPA
Ga0335085_1248044423300032770SoilCEINHYPVKLEHLLRVTKDGAEILSEYPVDPELVPA
Ga0335084_1035535633300033004SoilSPWLRGGDPEKYMIALEENMIVACEINHYPVKLEHLLRVTKDGAEILSEYPVDPELVPA
Ga0326726_1087340613300033433Peat SoilYQVALEENMIIALEINHNPVKLEHLLRVTENGVEILSNYPMDPELIPA
Ga0310811_1089040513300033475SoilKYMISLEENMIVALEINHYPVKLEHLLRVTHGGAEILSHYPVDPELVPA
Ga0316617_10187311923300033557SoilVGLCIYESPWLRGGDPEKYMISLEENMIVACEINHYPVKLEHLLRVTKDGPEILSEYPVDPELVPA
Ga0364930_0240444_2_1243300033814SedimentMIVALEINHYPVKLEHLLRVTDKGAEILSTYPMDPELVPA
Ga0326723_0082665_1176_13763300034090Peat SoilVGLCIYEAPWLRGGDPEEYGVTLEENMIIALEINHNPVKLEHLLRVTENGVEILSNYPMDPELIPA
Ga0364943_0335736_418_5583300034354SedimentMTLEENMIIALEINHNPVKLEHLLRVTESGVEILSNYPLDPELVPA
Ga0364923_0107962_7_1293300034690SedimentMIVALEINHYPVKLEHFLRVTDKGAEILSTYPMDPELVPA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.