| Basic Information | |
|---|---|
| Family ID | F027335 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 195 |
| Average Sequence Length | 51 residues |
| Representative Sequence | YMISLEENMIVALEINHYPVKLEHLLRVTHDGAEILSHYPVDPELVPA |
| Number of Associated Samples | 172 |
| Number of Associated Scaffolds | 195 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.54 % |
| % of genes near scaffold ends (potentially truncated) | 95.38 % |
| % of genes from short scaffolds (< 2000 bps) | 90.26 % |
| Associated GOLD sequencing projects | 163 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.872 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (8.205 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.744 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (34.872 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 30.26% Coil/Unstructured: 69.74% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 195 Family Scaffolds |
|---|---|---|
| PF02738 | MoCoBD_1 | 18.97 |
| PF13343 | SBP_bac_6 | 10.26 |
| PF01979 | Amidohydro_1 | 6.15 |
| PF04909 | Amidohydro_2 | 5.64 |
| PF00565 | SNase | 3.08 |
| PF00903 | Glyoxalase | 2.56 |
| PF00753 | Lactamase_B | 2.05 |
| PF00892 | EamA | 1.54 |
| PF13147 | Obsolete Pfam Family | 1.54 |
| PF00557 | Peptidase_M24 | 1.03 |
| PF07394 | DUF1501 | 0.51 |
| PF01527 | HTH_Tnp_1 | 0.51 |
| PF02012 | BNR | 0.51 |
| PF03070 | TENA_THI-4 | 0.51 |
| PF13560 | HTH_31 | 0.51 |
| PF13416 | SBP_bac_8 | 0.51 |
| PF01717 | Meth_synt_2 | 0.51 |
| PF04480 | DUF559 | 0.51 |
| PF07944 | Glyco_hydro_127 | 0.51 |
| PF04403 | PqiA | 0.51 |
| PF16881 | LIAS_N | 0.51 |
| COG ID | Name | Functional Category | % Frequency in 195 Family Scaffolds |
|---|---|---|---|
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 0.51 |
| COG2995 | Intermembrane transporter PqiABC subunit PqiA | Cell wall/membrane/envelope biogenesis [M] | 0.51 |
| COG3533 | Beta-L-arabinofuranosidase, GH127 family | Carbohydrate transport and metabolism [G] | 0.51 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.38 % |
| Unclassified | root | N/A | 4.62 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000033|ICChiseqgaiiDRAFT_c0549641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 848 | Open in IMG/M |
| 3300000550|F24TB_10015886 | All Organisms → cellular organisms → Bacteria | 1534 | Open in IMG/M |
| 3300000559|F14TC_101099020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 552 | Open in IMG/M |
| 3300000789|JGI1027J11758_12146117 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 604 | Open in IMG/M |
| 3300000890|JGI11643J12802_10424700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 556 | Open in IMG/M |
| 3300000956|JGI10216J12902_103690891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 561 | Open in IMG/M |
| 3300002151|JGI24794J26673_10049662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 900 | Open in IMG/M |
| 3300002222|JGI24795J26692_1062872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 620 | Open in IMG/M |
| 3300003911|JGI25405J52794_10057243 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300004061|Ga0055487_10101596 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300004070|Ga0055488_10166335 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300004114|Ga0062593_103003288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Oceanospirillaceae → Marinobacterium → Marinobacterium jannaschii | 539 | Open in IMG/M |
| 3300004268|Ga0066398_10026134 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
| 3300004463|Ga0063356_101859359 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 906 | Open in IMG/M |
| 3300004463|Ga0063356_103580330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 669 | Open in IMG/M |
| 3300004463|Ga0063356_105579406 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 540 | Open in IMG/M |
| 3300004633|Ga0066395_10012184 | All Organisms → cellular organisms → Bacteria | 3215 | Open in IMG/M |
| 3300004778|Ga0062383_10427256 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300004782|Ga0062382_10331664 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300005171|Ga0066677_10045120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2179 | Open in IMG/M |
| 3300005333|Ga0070677_10667543 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300005333|Ga0070677_10853530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 523 | Open in IMG/M |
| 3300005338|Ga0068868_100446031 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300005339|Ga0070660_100260682 | All Organisms → cellular organisms → Bacteria | 1415 | Open in IMG/M |
| 3300005354|Ga0070675_100313117 | All Organisms → cellular organisms → Bacteria | 1385 | Open in IMG/M |
| 3300005366|Ga0070659_101860566 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300005367|Ga0070667_101353190 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300005444|Ga0070694_101740449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Oceanospirillaceae → Marinobacterium → Marinobacterium jannaschii | 531 | Open in IMG/M |
| 3300005459|Ga0068867_101445919 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300005518|Ga0070699_101506872 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300005536|Ga0070697_100808317 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 830 | Open in IMG/M |
| 3300005545|Ga0070695_100079855 | All Organisms → cellular organisms → Bacteria | 2160 | Open in IMG/M |
| 3300005545|Ga0070695_100302513 | All Organisms → cellular organisms → Bacteria | 1183 | Open in IMG/M |
| 3300005546|Ga0070696_100399616 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1075 | Open in IMG/M |
| 3300005561|Ga0066699_10099741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1913 | Open in IMG/M |
| 3300005568|Ga0066703_10044742 | Not Available | 2456 | Open in IMG/M |
| 3300005713|Ga0066905_101563144 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 602 | Open in IMG/M |
| 3300005764|Ga0066903_107277146 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300005764|Ga0066903_107277192 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300005764|Ga0066903_108855818 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300006049|Ga0075417_10135721 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1137 | Open in IMG/M |
| 3300006163|Ga0070715_10145637 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
| 3300006755|Ga0079222_12317927 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300006844|Ga0075428_100800813 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1002 | Open in IMG/M |
| 3300006844|Ga0075428_101204960 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300006844|Ga0075428_102139435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 578 | Open in IMG/M |
| 3300006846|Ga0075430_100177683 | All Organisms → cellular organisms → Bacteria | 1771 | Open in IMG/M |
| 3300006847|Ga0075431_100351244 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1482 | Open in IMG/M |
| 3300006852|Ga0075433_10712671 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300006854|Ga0075425_102191750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 616 | Open in IMG/M |
| 3300006876|Ga0079217_10007945 | All Organisms → cellular organisms → Bacteria | 3287 | Open in IMG/M |
| 3300006880|Ga0075429_100459176 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
| 3300006881|Ga0068865_101000474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 732 | Open in IMG/M |
| 3300006903|Ga0075426_10498254 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 905 | Open in IMG/M |
| 3300006903|Ga0075426_10592790 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300006904|Ga0075424_100311200 | All Organisms → cellular organisms → Bacteria | 1677 | Open in IMG/M |
| 3300006918|Ga0079216_10743771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 708 | Open in IMG/M |
| 3300006954|Ga0079219_11041466 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300007004|Ga0079218_13936088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 505 | Open in IMG/M |
| 3300009012|Ga0066710_104729969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 509 | Open in IMG/M |
| 3300009081|Ga0105098_10819889 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300009087|Ga0105107_10532225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 819 | Open in IMG/M |
| 3300009087|Ga0105107_10870090 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300009089|Ga0099828_11442428 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300009093|Ga0105240_12395977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 546 | Open in IMG/M |
| 3300009094|Ga0111539_11799466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 710 | Open in IMG/M |
| 3300009100|Ga0075418_13107818 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300009111|Ga0115026_11190164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 620 | Open in IMG/M |
| 3300009147|Ga0114129_12206617 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300009153|Ga0105094_10134342 | All Organisms → cellular organisms → Bacteria | 1406 | Open in IMG/M |
| 3300009157|Ga0105092_10350871 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300009162|Ga0075423_12689092 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300009176|Ga0105242_10290943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1487 | Open in IMG/M |
| 3300009553|Ga0105249_10592719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1162 | Open in IMG/M |
| 3300009816|Ga0105076_1078496 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 622 | Open in IMG/M |
| 3300009931|Ga0131746_139874 | Not Available | 729 | Open in IMG/M |
| 3300010047|Ga0126382_11729633 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300010048|Ga0126373_10096315 | All Organisms → cellular organisms → Bacteria | 2728 | Open in IMG/M |
| 3300010166|Ga0126306_10258393 | All Organisms → cellular organisms → Bacteria | 1331 | Open in IMG/M |
| 3300010358|Ga0126370_10642202 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
| 3300010359|Ga0126376_13175523 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300010371|Ga0134125_10470665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1393 | Open in IMG/M |
| 3300010376|Ga0126381_105021640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 507 | Open in IMG/M |
| 3300010399|Ga0134127_12051023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 650 | Open in IMG/M |
| 3300011271|Ga0137393_11540206 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300011333|Ga0127502_10049645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 516 | Open in IMG/M |
| 3300011432|Ga0137428_1008362 | All Organisms → cellular organisms → Bacteria | 2766 | Open in IMG/M |
| 3300011437|Ga0137429_1027143 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1642 | Open in IMG/M |
| 3300012034|Ga0137453_1118842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 527 | Open in IMG/M |
| 3300012040|Ga0137461_1054609 | All Organisms → cellular organisms → Bacteria | 1092 | Open in IMG/M |
| 3300012040|Ga0137461_1214151 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300012164|Ga0137352_1063747 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300012172|Ga0137320_1031773 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
| 3300012357|Ga0137384_10761063 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300012511|Ga0157332_1008327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 981 | Open in IMG/M |
| 3300012512|Ga0157327_1040708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 624 | Open in IMG/M |
| 3300012922|Ga0137394_10156737 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1939 | Open in IMG/M |
| 3300012922|Ga0137394_11122220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 650 | Open in IMG/M |
| 3300012923|Ga0137359_11415487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 583 | Open in IMG/M |
| 3300012929|Ga0137404_10467471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1121 | Open in IMG/M |
| 3300012929|Ga0137404_11234092 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300012944|Ga0137410_10457915 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
| 3300012948|Ga0126375_11115367 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300013297|Ga0157378_11428719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 735 | Open in IMG/M |
| 3300013297|Ga0157378_11458780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 728 | Open in IMG/M |
| 3300014263|Ga0075324_1002235 | Not Available | 2745 | Open in IMG/M |
| 3300014264|Ga0075308_1068934 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300014883|Ga0180086_1033787 | All Organisms → cellular organisms → Bacteria | 1192 | Open in IMG/M |
| 3300015256|Ga0180073_1003614 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → environmental samples → uncultured Verrucomicrobiota bacterium | 2184 | Open in IMG/M |
| 3300015357|Ga0134072_10087565 | Not Available | 936 | Open in IMG/M |
| 3300015373|Ga0132257_100417419 | All Organisms → cellular organisms → Bacteria | 1634 | Open in IMG/M |
| 3300015373|Ga0132257_102984591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 616 | Open in IMG/M |
| 3300016422|Ga0182039_11975159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 536 | Open in IMG/M |
| 3300017659|Ga0134083_10104067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1121 | Open in IMG/M |
| 3300017944|Ga0187786_10374300 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300018053|Ga0184626_10027851 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2322 | Open in IMG/M |
| 3300018053|Ga0184626_10253832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 737 | Open in IMG/M |
| 3300018072|Ga0184635_10092202 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 1194 | Open in IMG/M |
| 3300018076|Ga0184609_10304671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 745 | Open in IMG/M |
| 3300018076|Ga0184609_10429185 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 610 | Open in IMG/M |
| 3300018081|Ga0184625_10407610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 700 | Open in IMG/M |
| 3300018082|Ga0184639_10009437 | All Organisms → cellular organisms → Bacteria | 4659 | Open in IMG/M |
| 3300018084|Ga0184629_10080889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1555 | Open in IMG/M |
| 3300018084|Ga0184629_10241548 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 942 | Open in IMG/M |
| 3300018089|Ga0187774_10288328 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 949 | Open in IMG/M |
| 3300018089|Ga0187774_11099662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 562 | Open in IMG/M |
| 3300018422|Ga0190265_13158921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 550 | Open in IMG/M |
| 3300018429|Ga0190272_12019147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 611 | Open in IMG/M |
| 3300018469|Ga0190270_10154015 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1873 | Open in IMG/M |
| 3300020006|Ga0193735_1005947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3900 | Open in IMG/M |
| 3300020084|Ga0194110_10452585 | Not Available | 852 | Open in IMG/M |
| 3300020195|Ga0163150_10376415 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300021080|Ga0210382_10035976 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1886 | Open in IMG/M |
| 3300021081|Ga0210379_10062857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1500 | Open in IMG/M |
| 3300021082|Ga0210380_10020547 | Not Available | 2795 | Open in IMG/M |
| 3300021432|Ga0210384_11339654 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300021560|Ga0126371_10038621 | All Organisms → cellular organisms → Bacteria | 4512 | Open in IMG/M |
| 3300022774|Ga0242725_158604 | Not Available | 729 | Open in IMG/M |
| 3300025559|Ga0210087_1023989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1240 | Open in IMG/M |
| 3300025567|Ga0210076_1061756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 814 | Open in IMG/M |
| 3300025567|Ga0210076_1079482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 716 | Open in IMG/M |
| 3300025796|Ga0210113_1124541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 501 | Open in IMG/M |
| 3300025901|Ga0207688_10059575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2150 | Open in IMG/M |
| 3300025903|Ga0207680_11231863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 533 | Open in IMG/M |
| 3300025906|Ga0207699_10561367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 829 | Open in IMG/M |
| 3300025930|Ga0207701_11309694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 593 | Open in IMG/M |
| 3300025938|Ga0207704_10974516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 716 | Open in IMG/M |
| 3300025986|Ga0207658_10430437 | All Organisms → cellular organisms → Bacteria | 1165 | Open in IMG/M |
| 3300026023|Ga0207677_10324991 | All Organisms → cellular organisms → Bacteria | 1280 | Open in IMG/M |
| 3300026051|Ga0208911_1007464 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
| 3300026061|Ga0208541_1032488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 530 | Open in IMG/M |
| 3300026089|Ga0207648_10606909 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1009 | Open in IMG/M |
| 3300026116|Ga0207674_10793369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 914 | Open in IMG/M |
| 3300026314|Ga0209268_1056616 | All Organisms → cellular organisms → Bacteria | 1227 | Open in IMG/M |
| 3300026329|Ga0209375_1082752 | Not Available | 1483 | Open in IMG/M |
| 3300026550|Ga0209474_10283515 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
| 3300026552|Ga0209577_10341027 | All Organisms → cellular organisms → Bacteria | 1106 | Open in IMG/M |
| 3300027533|Ga0208185_1052270 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
| 3300027617|Ga0210002_1018351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1118 | Open in IMG/M |
| 3300027639|Ga0209387_1116096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 671 | Open in IMG/M |
| 3300027665|Ga0209983_1161476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 514 | Open in IMG/M |
| 3300027765|Ga0209073_10249253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 690 | Open in IMG/M |
| 3300027818|Ga0209706_10296245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 767 | Open in IMG/M |
| 3300027843|Ga0209798_10016317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 4014 | Open in IMG/M |
| 3300027843|Ga0209798_10363968 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300027874|Ga0209465_10041385 | All Organisms → cellular organisms → Bacteria | 2191 | Open in IMG/M |
| 3300028293|Ga0247662_1092756 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300028814|Ga0307302_10102972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1364 | Open in IMG/M |
| 3300028828|Ga0307312_10381942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 923 | Open in IMG/M |
| 3300030619|Ga0268386_10868260 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300030620|Ga0302046_10982804 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300031228|Ga0299914_11151791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 624 | Open in IMG/M |
| 3300031229|Ga0299913_10267971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1692 | Open in IMG/M |
| 3300031229|Ga0299913_10919416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 844 | Open in IMG/M |
| 3300031562|Ga0310886_10639722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 657 | Open in IMG/M |
| 3300031820|Ga0307473_10259565 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
| 3300031833|Ga0310917_11213275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 501 | Open in IMG/M |
| 3300031911|Ga0307412_12237840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 509 | Open in IMG/M |
| 3300031941|Ga0310912_11324141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 545 | Open in IMG/M |
| 3300031965|Ga0326597_11799954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 574 | Open in IMG/M |
| 3300032012|Ga0310902_10573841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 746 | Open in IMG/M |
| 3300032132|Ga0315336_1039370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2655 | Open in IMG/M |
| 3300032205|Ga0307472_100280411 | All Organisms → cellular organisms → Bacteria | 1326 | Open in IMG/M |
| 3300032211|Ga0310896_10603282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 613 | Open in IMG/M |
| 3300032261|Ga0306920_100320369 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2308 | Open in IMG/M |
| 3300032770|Ga0335085_10720670 | Not Available | 1107 | Open in IMG/M |
| 3300032770|Ga0335085_12480444 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300033004|Ga0335084_10355356 | All Organisms → cellular organisms → Bacteria | 1512 | Open in IMG/M |
| 3300033433|Ga0326726_10873406 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 872 | Open in IMG/M |
| 3300033475|Ga0310811_10890405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 806 | Open in IMG/M |
| 3300033557|Ga0316617_101873119 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300033814|Ga0364930_0240444 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300034090|Ga0326723_0082665 | All Organisms → cellular organisms → Bacteria | 1379 | Open in IMG/M |
| 3300034354|Ga0364943_0335736 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 576 | Open in IMG/M |
| 3300034690|Ga0364923_0107962 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.21% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 5.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.64% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.62% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.62% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.10% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.59% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.59% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.59% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 3.08% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 3.08% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.08% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.56% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 2.05% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.05% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.05% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.05% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.54% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.54% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.54% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.54% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.54% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.54% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.03% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.03% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.03% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.03% |
| Host-Associated | Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Host-Associated | 1.03% |
| Marine | Host-Associated → Porifera → Sponge → Unclassified → Unclassified → Marine | 1.03% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.03% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.03% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.03% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.51% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.51% |
| Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 0.51% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.51% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.51% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.51% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.51% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.51% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.51% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.51% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.51% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.51% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.51% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.51% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.51% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.51% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.51% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002151 | Host-associated microbial community of the marine sponge Aplysina aerophoba from Gulf of Piran - sponge mesohyl, lysed by proteinase K digestion | Host-Associated | Open in IMG/M |
| 3300002222 | Host-associated microbial community of the marine sponge Aplysina aerophoba from Gulf of Piran - sponge pinacoderm, lysed by bead beating | Host-Associated | Open in IMG/M |
| 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300004061 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300004070 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
| 3300004782 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009153 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009816 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 | Environmental | Open in IMG/M |
| 3300009931 | Microbial communities of marine sponge Rhopaloides odorabile from Great Barrier Reef, Australia - R7 | Host-Associated | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011333 | Cornfield soil microbial communities from Stanford, California, USA - CI-CA-CRN metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011432 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2 | Environmental | Open in IMG/M |
| 3300011437 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2 | Environmental | Open in IMG/M |
| 3300012034 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT526_2 | Environmental | Open in IMG/M |
| 3300012040 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT746_2 | Environmental | Open in IMG/M |
| 3300012164 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT730_2 | Environmental | Open in IMG/M |
| 3300012172 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT366_2 | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012511 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_10 | Environmental | Open in IMG/M |
| 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Host-Associated | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014263 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014264 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D2_rd | Environmental | Open in IMG/M |
| 3300014883 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10D | Environmental | Open in IMG/M |
| 3300015256 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT333_16_10D | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300020084 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m | Environmental | Open in IMG/M |
| 3300020195 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.P2.IB | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022774 | Microbial communities of marine sponge Rhopaloides odorabile from Great Barrier Reef, Australia - R7 Version 2 | Host-Associated | Open in IMG/M |
| 3300025559 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025567 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025796 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026051 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026061 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027533 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 (SPAdes) | Environmental | Open in IMG/M |
| 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027639 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027818 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027843 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300028293 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK03 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
| 3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
| 3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032132 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - ASW #5 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| 3300033814 | Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17 | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| 3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
| 3300034690 | Sediment microbial communities from East River floodplain, Colorado, United States - 60_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiDRAFT_05496413 | 3300000033 | Soil | INHYPVKLEHLLRVTSDGAEILSKYPVDPELISA* |
| F24TB_100158863 | 3300000550 | Soil | VTLEENMIIALEINHNPVKLEHLLRVTESGVEILSNYPLDPELIPA* |
| F14TC_1010990202 | 3300000559 | Soil | ENMIVALEINHYPVKLEHLLRVTADGAEILSQYPVDPELVPA* |
| JGI1027J11758_121461172 | 3300000789 | Soil | GGDPEEYEVTLEENMIIALEINHNPVKLEHLLRVTDSGIEILSKYQLDPELVPA* |
| JGI11643J12802_104247001 | 3300000890 | Soil | VYESPWLRGGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTSDGAEILSKYPVDPELISA* |
| JGI10216J12902_1036908912 | 3300000956 | Soil | MIVACEINHYPVKLEHLLRVTKDGPEILSEYPVDPELVAA* |
| JGI24794J26673_100496621 | 3300002151 | Host-Associated | PPEYELALEENMIVALEINHHPVKLEHLLRVTADGAEILSTYPMEPELAPA* |
| JGI24795J26692_10628722 | 3300002222 | Host-Associated | EYELALEENMIVALEINHHPVKLEHLLRVTADGAEILSTYPMEPELAPA* |
| JGI25405J52794_100572432 | 3300003911 | Tabebuia Heterophylla Rhizosphere | GDPEEYGVTLEKNMIIALEINHNPVKLEHLLRVTESGVEILSTYPMDPELIAA* |
| Ga0055487_101015962 | 3300004061 | Natural And Restored Wetlands | YMISLEENMIVACEINHYPVKLEHLLRVTKDGPEILSEYPVDPELVPA* |
| Ga0055488_101663351 | 3300004070 | Natural And Restored Wetlands | ENMIVACEINHYPVKLEHLLRVTKDGPEILSEYPVDPELVPA* |
| Ga0062593_1030032881 | 3300004114 | Soil | GVGLCVYESPWLRGGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTSDGAEILSKYPVDPELISA* |
| Ga0066398_100261341 | 3300004268 | Tropical Forest Soil | GGDPEEFGVTLEENMIITLEINHNPVKLEHLLRVTDMGVEILSQYQLDPELIPA* |
| Ga0063356_1018593591 | 3300004463 | Arabidopsis Thaliana Rhizosphere | DPEKYMISLEENMIVALEINHYPVKLEHLLRVTANGAEILSQYPVDPELVPA* |
| Ga0063356_1035803301 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VNLEENMIVALEINHYPVKLEHLLRITDSGAEILSRYPVDPELIPA* |
| Ga0063356_1055794061 | 3300004463 | Arabidopsis Thaliana Rhizosphere | LCVYESPWLRGGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTVDGAEILSEYPVDPELVPA* |
| Ga0066395_100121844 | 3300004633 | Tropical Forest Soil | VTLEENMIITLEINHNPVKLEHLLRVTDMGVEILSQYQLDPELIPA* |
| Ga0062383_104272561 | 3300004778 | Wetland Sediment | DPEKYMISLEENMIVACEINHYPVKLEHLLRVTKDGPEILSEYPVDPELVPA* |
| Ga0062382_103316642 | 3300004782 | Wetland Sediment | LEENMIVACEINHYPVKLEHLLRVTKDGPEILSEYPVDPELVPA* |
| Ga0066677_100451203 | 3300005171 | Soil | WLRGGDPDEYLVTLEENMIIALEINHNPVKLEHLLRVTDSGVEILSNYQLDTELVPA* |
| Ga0070677_106675431 | 3300005333 | Miscanthus Rhizosphere | LEENMIVALEINHYPVKLEHLLRVTHDGAEILSHYPVDPELVPA* |
| Ga0070677_108535301 | 3300005333 | Miscanthus Rhizosphere | SPWLRGDDPPEYAVDLEENMIVALEINHYPVKLEHLLRITDAGAEILSRYPVNPELVPA* |
| Ga0068868_1004460312 | 3300005338 | Miscanthus Rhizosphere | YMISLEENMIVALEINHYPVKLEHLLRVTHDGAEILSHYPVDPELVPA* |
| Ga0070660_1002606822 | 3300005339 | Corn Rhizosphere | CIYESPWLRGGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTHDGAEILSHYPVDPELVPA* |
| Ga0070675_1003131171 | 3300005354 | Miscanthus Rhizosphere | GGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTHDGAEILSHYPVDPELVPA* |
| Ga0070659_1018605661 | 3300005366 | Corn Rhizosphere | YESPWLRGGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTHDGAKILSHYPVDPELVPA* |
| Ga0070667_1013531902 | 3300005367 | Switchgrass Rhizosphere | MISLEENMIVALEINHYPVKLEHLLRVTHDGAEILSHYPVDPELVPA* |
| Ga0070694_1017404491 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | WLRGGDPEKYMISLEENMIVALEVNHYPVKLEHLLRVTADGAEILSQYPVDAELVPA* |
| Ga0068867_1014459192 | 3300005459 | Miscanthus Rhizosphere | KYMISLEENMIVALEINHYPVKLEHLLRVTHDGAEILSHYPVDPELVPA* |
| Ga0070699_1015068722 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | YLVTLEENMIIALEINHLPVKLEHLLRVTDSGVEILSQYQLDPELVPA* |
| Ga0070697_1008083171 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | NMIVALEVNHYPVKLEHLLRVTADGAEILSQYPVDAELVPA* |
| Ga0070695_1000798552 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | ISLEENMIVALEINHYPVKLEHLLRVTHDGAEILSHYPVDPELVPA* |
| Ga0070695_1003025131 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | KYMISLEENMIVALEINHYPVKLEHLLRVTADSAEILSQYPVDPELVPA* |
| Ga0070696_1003996161 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | YESPWLRGGDPEKYMISLEENMIVALEVNHYPVKLEHLLRVTADGAEILSQYPVDAELVPA* |
| Ga0066699_100997411 | 3300005561 | Soil | GDPDEYLVTLEENMIIALEINHNPVKLEHLLRVTDSGVEILSNYQLDPELVPA* |
| Ga0066703_100447421 | 3300005568 | Soil | INHNPVKLEHLLRVTDSGVEILSNYQLDPELVPA* |
| Ga0066905_1015631442 | 3300005713 | Tropical Forest Soil | EYGVTLEENMIIALEINHNPVKLEHLLRVTESGVEILSTHPMDPELIAA* |
| Ga0066903_1072771461 | 3300005764 | Tropical Forest Soil | YAVTLEENMIIALEVNHLPVKLEHLLRVTDSGVEILSTYHLDPELVPA* |
| Ga0066903_1072771921 | 3300005764 | Tropical Forest Soil | YAVTLEENMIIALEVNHLPVKLEHLLRVTDSGVEILSTYQLDPELVPA* |
| Ga0066903_1088558181 | 3300005764 | Tropical Forest Soil | LCIYEAPWLRGGDPDEYAVTLEENMIIALEINHLPVKLEHLLRVTDSGVEILSMYQLDPELVPA* |
| Ga0075417_101357211 | 3300006049 | Populus Rhizosphere | VTLEENMIIALEINHNPVKLEHLLRVTESGVEILSNYLLDPELIPA* |
| Ga0070715_101456371 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | IYESPWLRGGDPEKYLISLEENMIVALEINHYPVKLEHLMRVTHDGAEILSHYPVDPELVPA* |
| Ga0079222_123179272 | 3300006755 | Agricultural Soil | YMISLEENMIVALEINHYPVKLEHLLRVTADGAEILSHYPVDPGLLPA* |
| Ga0075428_1008008131 | 3300006844 | Populus Rhizosphere | PEKYMISLEENMIVACEINHYPVKLEHLLRVTQDGAEILSEYPVDPELVPA* |
| Ga0075428_1012049601 | 3300006844 | Populus Rhizosphere | WLRGGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTHDGAEVLSRYPVDAELVPA* |
| Ga0075428_1021394351 | 3300006844 | Populus Rhizosphere | CIYESPWLRGGDPPEYVVNLEEDMIVALEINHYPVKLEHLLRVTDSGAEILSRYPVDPELVPA* |
| Ga0075430_1001776833 | 3300006846 | Populus Rhizosphere | EENMIIALEINHNPVKLEHLLRVTESGVEILSNYPLDPELIPA* |
| Ga0075431_1003512442 | 3300006847 | Populus Rhizosphere | LEENMIIALEINHNPVKLEHLLRVTESGVEILSNYPLDPELIPA* |
| Ga0075433_107126711 | 3300006852 | Populus Rhizosphere | EINHYPVKLEHLLRVTADGAEILSQYPVDPELMPA* |
| Ga0075425_1021917501 | 3300006854 | Populus Rhizosphere | GLCIYESPWLRGGDPEKYMISLAENMIVALEINHYPVKLEHLLRVTADGAEILSNYPVEPELMPA* |
| Ga0079217_100079451 | 3300006876 | Agricultural Soil | QKYMISLEENMIVALEINHYPVKLEHLLRVTANGAEILSQYPVDPELVPA* |
| Ga0075429_1004591761 | 3300006880 | Populus Rhizosphere | NMIVALEINHYPVKLEHLLRVTADGAEILSQYPVDPELVPA* |
| Ga0068865_1010004742 | 3300006881 | Miscanthus Rhizosphere | MISLEENMIVALEINHYPVKLEHLLRVTADGAEILSNYPVEPELVPA* |
| Ga0075426_104982542 | 3300006903 | Populus Rhizosphere | VGLCIYESPWLRGGDPEKYLISLEEDMIVALEINHYPVKLEHLLRVTHDGAEILSHYPVDPELVPA* |
| Ga0075426_105927902 | 3300006903 | Populus Rhizosphere | ALEINHYPVKLEHLLRVTADGAEILSHYPVDPVLLPA* |
| Ga0075424_1003112001 | 3300006904 | Populus Rhizosphere | PWLRGGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTADGAEILSHYPVDPGLLPA* |
| Ga0079216_107437711 | 3300006918 | Agricultural Soil | LEINHYPVKLEHLLRVTDSGAEILSRYPVDPELVPA* |
| Ga0079219_110414662 | 3300006954 | Agricultural Soil | MVIALEINHLPVKLEHLLGVTAAGAEILSTYQLDPELMPA* |
| Ga0079218_139360882 | 3300007004 | Agricultural Soil | WLRGGDPQKYMISLEENMIVALEINHYPVKLEHLLRVTAGGAEILSQYPVDPELVPA* |
| Ga0066710_1047299692 | 3300009012 | Grasslands Soil | VGLCIYESPWLRGGDPAKYMISLEENMIVALEINHYPVKLEHLLRVTADGAEILSQYPVDPELVSA |
| Ga0105098_108198891 | 3300009081 | Freshwater Sediment | ENMIVALEINHYPVKLEHLLRVTDKGAEVLSTYPMDPELVPA* |
| Ga0105107_105322252 | 3300009087 | Freshwater Sediment | DPEKYMISLEENMIVALEINHYPVKLEHLLRVTADGAEILSLYPIDPELVPA* |
| Ga0105107_108700901 | 3300009087 | Freshwater Sediment | MIVACEINHYPVKLEHLLRVTKDGPEILSEYPVDPELIPA* |
| Ga0099828_114424282 | 3300009089 | Vadose Zone Soil | LRGGDPDEYLVTLEENMIVALEINHLPVKLEHLLRVTESGAEILSTYPLDPELVPA* |
| Ga0105240_123959771 | 3300009093 | Corn Rhizosphere | LEINHYPVKLEHLLRVSADGAEILSQYPVDPELVAA* |
| Ga0111539_117994662 | 3300009094 | Populus Rhizosphere | SLEENMIVALEINHYPVKLEHLLRVTADGAEILSHYPVDPGLLPA* |
| Ga0075418_131078181 | 3300009100 | Populus Rhizosphere | RGGDPEEYGVTLEENMIIALEINHNPVKLEHLLRVTESGVEILSNYPLDRELVPA* |
| Ga0115026_111901641 | 3300009111 | Wetland | MIVACEINHYPVKLEHLLRVTKDGPEILSEYPVDPELVPA* |
| Ga0114129_122066172 | 3300009147 | Populus Rhizosphere | WLRGGDPDEYAATLEENMIIALEINHLPVKLEHLLRVTDSGVEILSTYQLDSELVPA* |
| Ga0105094_101343422 | 3300009153 | Freshwater Sediment | WLRGGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTADGAEILSLYPIDPELVPA* |
| Ga0105092_103508712 | 3300009157 | Freshwater Sediment | LEINHNPVKLEHLLRVTGSGVEILSNYQLDPELIPA* |
| Ga0075423_126890922 | 3300009162 | Populus Rhizosphere | ALEINHLPVKLEHLLRVTDSGVEILSTYQLDSELVPA* |
| Ga0105242_102909431 | 3300009176 | Miscanthus Rhizosphere | WLRGGDPEKYMISLAENMIVALEINHYPVKLEHLLRVTADGAEILSNYPVEPELMPA* |
| Ga0105249_105927193 | 3300009553 | Switchgrass Rhizosphere | VGLCIYESPWLRGGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTHDGAKILSHYPVDPELVPA* |
| Ga0105076_10784961 | 3300009816 | Groundwater Sand | GVTLEKNMIIALEINHNPVKLEHLLRVTESGVEILSNYPMDPELIPA* |
| Ga0131746_1398743 | 3300009931 | Marine | GFDPPEYNLTLAENMIIALEINHHPVKLEHLLRVTADGAEILSTYPMEPELAPA* |
| Ga0126382_117296332 | 3300010047 | Tropical Forest Soil | LSIYEAPWLRGGDPEEYGVTLEENMIIALEINHNPVKLEHLLRVTDNGVEILSQYQLDPKLIPS* |
| Ga0126373_100963152 | 3300010048 | Tropical Forest Soil | VTLEENMIITLEINHNSVKLEHLLRVTDMGVEILSQYQLDPELIPA* |
| Ga0126306_102583932 | 3300010166 | Serpentine Soil | LCIYESPWLRGGDPEKYMISLEENMIVACEINHYPVKLEHLLRVTNDGPEILSEYPVDPELVPA* |
| Ga0126370_106422022 | 3300010358 | Tropical Forest Soil | PWLRGGDPEEYGVTLEENMIIALEINHNPVKLEHLLRVAESGVEILSTYPMDPELIAA* |
| Ga0126376_131755232 | 3300010359 | Tropical Forest Soil | TLEENMIITLEINHNPVKLEHLLRVTDNGVEILSQYQLDPELIPA* |
| Ga0134125_104706652 | 3300010371 | Terrestrial Soil | LCIYESPWLRGGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTHDGAEILSHYPVDPELVQA* |
| Ga0126381_1050216402 | 3300010376 | Tropical Forest Soil | EENMIVALEINHYPVKLEHLLRVTADGAEILSHYPVDPELVPA* |
| Ga0134127_120510232 | 3300010399 | Terrestrial Soil | PWLRGGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTHDGAEILSHYPVDPELVPA* |
| Ga0137393_115402061 | 3300011271 | Vadose Zone Soil | EYLVTLEENMIVALEINHLPVKLEHLLRVTESGAEILSTYPLDPELVPA* |
| Ga0127502_100496451 | 3300011333 | Soil | VGLCIYESPWLRGGDPEHYMVGLQENMIVALEINHYPVKLEHLLRVTATGAEILSTYPMDAELVPA* |
| Ga0137428_10083621 | 3300011432 | Soil | GLCIYEAPWLRGSDPEEYGVTLERNMIIALEINHNPVKLEHLLRVTESGVEILSKYPMDPELLPA* |
| Ga0137429_10271433 | 3300011437 | Soil | EKYMISLEENMIVACEINHYPVKLEHLLRVTKDGAEILSEYPVDPELVPA* |
| Ga0137453_11188421 | 3300012034 | Soil | HGVGLCIYESPWLRGGDPGKYMISLEENMIVALEINHYPVKLEHLLRVTKDGAEILSEYPVDPELVPA* |
| Ga0137461_10546092 | 3300012040 | Soil | LRGGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTKDGGEILSEYPVDPELVPA* |
| Ga0137461_12141511 | 3300012040 | Soil | MISLEENMIVACEINHYPVKLEHLLRVTKDGGEILSEYPVDPELVPA* |
| Ga0137352_10637472 | 3300012164 | Soil | VALEINHYPVKLEHLLRVTDKGAEILSTYPMDPELVPA* |
| Ga0137320_10317732 | 3300012172 | Soil | DPEKYMISLEENMIVACEINHYPVKLEHLLRVTKDGAEILSEYPVDPELVPA* |
| Ga0137384_107610631 | 3300012357 | Vadose Zone Soil | NMIIALEINHNPVKLEHLLRVTDSGVEILSNYQLDAELVPA* |
| Ga0157332_10083272 | 3300012511 | Soil | PWLRGGDPEKYMISLAENMIVALEINHYPVKLEHLLRVTADGAEILSNYPVEPELVSA* |
| Ga0157327_10407082 | 3300012512 | Arabidopsis Rhizosphere | GDPEKYMISLAENMIVALEINHYPVKLEHLLRVTADGAEILSNYPVEPELMPA* |
| Ga0137394_101567373 | 3300012922 | Vadose Zone Soil | CIYESPWLRGGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTADGAEILSHYPVDPELVPA* |
| Ga0137394_111222201 | 3300012922 | Vadose Zone Soil | VGLCIYESPWLRGGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTADGAEILSQYPVDPELMPA* |
| Ga0137359_114154871 | 3300012923 | Vadose Zone Soil | DPEKYMISLEENMIVALEINHYPVKLEHLLRVTADGAEILSHYPVDPELVPA* |
| Ga0137404_104674711 | 3300012929 | Vadose Zone Soil | MISLEENMIVALEINHYPVKLEHLLRVTADGAEILSQYPVDPELVAA* |
| Ga0137404_112340922 | 3300012929 | Vadose Zone Soil | RGGDPEEYGVTLEENMIIALEINHNPVKLEHLLRVADDGVGILSNYQLDPELVPA* |
| Ga0137410_104579151 | 3300012944 | Vadose Zone Soil | YGVTLEENMIIALEINHNPVKLEHLLRVADDGVEILSNYQLDPELVPA* |
| Ga0126375_111153672 | 3300012948 | Tropical Forest Soil | ALEMNHNPVKLEHLLRVTVSGVEILSTYPMDPELIAA* |
| Ga0157378_114287192 | 3300013297 | Miscanthus Rhizosphere | SPWLRGGDPEKYMISLEENMIVALEVNHYPVKLEHLLRVTADGAEILSQYQVDPELTPA* |
| Ga0157378_114587801 | 3300013297 | Miscanthus Rhizosphere | WLRGGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTHDGAEILSHYPVDPELVPA* |
| Ga0075324_10022351 | 3300014263 | Natural And Restored Wetlands | MIVALEVNHYPVKLEHLLRVTANGAEILSQYPVDPELVPA* |
| Ga0075308_10689341 | 3300014264 | Natural And Restored Wetlands | NMIVACEINHYPVKLEHLLRVTKDGGEILSEYPVDPELVPA* |
| Ga0180086_10337872 | 3300014883 | Soil | GDPEKYMISLEENMIVACEINHYPVKLEHLMRVTKDGGEILSEYPVDPELVPA* |
| Ga0180073_10036141 | 3300015256 | Soil | MIVALEINHYPVKLEHLLRVTKDGGEILSEYPVDPELVPA* |
| Ga0134072_100875651 | 3300015357 | Grasslands Soil | VGLCIYEAPWLRGGDPDEYLVTLEENMIIALEINHNPVKLEHLLRVTDSGVEILSSYQLDAELVPA* |
| Ga0132257_1004174193 | 3300015373 | Arabidopsis Rhizosphere | WLRGGDPEKYLISLEEDMIVALEINHYPVKLEHLLRVTHDGAEILSHYPVDPELVPA* |
| Ga0132257_1029845911 | 3300015373 | Arabidopsis Rhizosphere | VALEINHYPVKLEHLLRVTADGAEILSNYPVEPELVSA* |
| Ga0182039_119751591 | 3300016422 | Soil | RGGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTADGAEILSHYPVDPELVPA |
| Ga0134083_101040672 | 3300017659 | Grasslands Soil | DPAKYMISLEENMIVALEINHYPVKLEHLLRVTAGGAEILSQYPVDPELVPA |
| Ga0187786_103743001 | 3300017944 | Tropical Peatland | LISLEENMIVACEINHYPVKLEHLLRVTKDGAEILSDYPVDPELVAA |
| Ga0184626_100278511 | 3300018053 | Groundwater Sediment | ENMIVALEINHYPVKLEHLLRVTADGAEILSQYPVDPELVPA |
| Ga0184626_102538322 | 3300018053 | Groundwater Sediment | MIVALEINHYPVKLEHLLRVTASGAEILSTYQMDPELVAA |
| Ga0184635_100922022 | 3300018072 | Groundwater Sediment | EENMIIALEINHNPVKLEHLLRVTESGVEILSNYPLDPELVSA |
| Ga0184609_103046712 | 3300018076 | Groundwater Sediment | HGVGLCIYESPWLRGGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTADGAEILSQYPVDPELVPA |
| Ga0184609_104291851 | 3300018076 | Groundwater Sediment | MIIALEINHNPVKLEHLLRVTESGVEILSNYPLDPELIPA |
| Ga0184625_104076101 | 3300018081 | Groundwater Sediment | RGGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTADGAEILSQYTVDPELVPA |
| Ga0184639_100094376 | 3300018082 | Groundwater Sediment | EENMIVALEINHYPVKLEHLLRVTASGAEILSTYQMDPELVAA |
| Ga0184629_100808891 | 3300018084 | Groundwater Sediment | LEENMIVALEINHYPVKLEHLLRVTNKGAEILSTYPMDPELVPA |
| Ga0184629_102415482 | 3300018084 | Groundwater Sediment | YEAPWLRGGDPEEYGMTLEENMIIALEINHNPVKLEHLLRVTESGVEILSNYPLDPELVP |
| Ga0187774_102883283 | 3300018089 | Tropical Peatland | GVTLEENMIIALEINHDPVKLEHLLRVTDDGVEILSNYQLDPELLPA |
| Ga0187774_110996622 | 3300018089 | Tropical Peatland | AKYMIALEENMIVALEINHYPVKLEHLLRVTADGAEILSEYPVDPELMPA |
| Ga0190265_131589212 | 3300018422 | Soil | GLCVYESPWLRGGDPEKYMISLEEDMIVALEINHYPVKLEHLLRVTTDGAEILSKYPVDPELVPA |
| Ga0190272_120191472 | 3300018429 | Soil | MCVYESPWLRGGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTANGAEILSQYPVDPELIPA |
| Ga0190270_101540153 | 3300018469 | Soil | CEINHYPVKLEHLLRVTKDGGEILSEYPVDPELVPA |
| Ga0193735_10059474 | 3300020006 | Soil | LEINHYPVKLEHLLRVTADGAEILSQYPVDPELVPA |
| Ga0194110_104525852 | 3300020084 | Freshwater Lake | EAPWLRGGDPAEYMVSLEANMIVALEINHYPVKLENLLRVTANGYEILSEYPMDPELVPA |
| Ga0163150_103764152 | 3300020195 | Freshwater Microbial Mat | PEKYMISLEENMIVACEINHYPVKLEHLMRVTKDGGEILSEYPVDPELVPA |
| Ga0210382_100359761 | 3300021080 | Groundwater Sediment | PAKYMISLEENMIVALEINHYPVKLEHLLRVTADGAEILSQYPVDSELVPA |
| Ga0210379_100628571 | 3300021081 | Groundwater Sediment | EKYMISLEENMIVACEINHYPVKLEHLLRVTKDGAEILSEYPVDPELVPA |
| Ga0210380_100205471 | 3300021082 | Groundwater Sediment | KCMISLEENMIVACEINHYPVKLEHLLRVTKDGAEILSEYPVDPELVPA |
| Ga0210384_113396542 | 3300021432 | Soil | ENMIVALEINHLPVKLEHLLRVTDSGVEILSTYQLDPELVPA |
| Ga0126371_100386217 | 3300021560 | Tropical Forest Soil | VTLEENMIITLEINHNPVKLEHLLRVTDMGVEILSQYQLDPELIPA |
| Ga0242725_1586043 | 3300022774 | Marine | GFDPPEYNLTLAENMIIALEINHHPVKLEHLLRVTADGAEILSTYPMEPELAPA |
| Ga0210087_10239893 | 3300025559 | Natural And Restored Wetlands | GGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTSDGAEILSKYPVDPELIPA |
| Ga0210076_10617561 | 3300025567 | Natural And Restored Wetlands | ENMIVALEINHYPVKLEHLLRVTSDGAEILSKYPVDPELIPA |
| Ga0210076_10794822 | 3300025567 | Natural And Restored Wetlands | WLRGGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTSDGAEILSKYPVDPELIPA |
| Ga0210113_11245411 | 3300025796 | Natural And Restored Wetlands | ALEINHYPVKLEHLLRVTSDGAEILSKYPVDPELIPA |
| Ga0207688_100595752 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | LCIYESPWLRGGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTHDGAEILSHYPVDPELVPA |
| Ga0207680_112318631 | 3300025903 | Switchgrass Rhizosphere | IVALEINHYPVKLEHLLRVTHDGAEILSHYPVDPELVPA |
| Ga0207699_105613671 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MIVALEINHYPVKLEHLMRVTHDGAEILSHYPVDPELVPA |
| Ga0207701_113096942 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | NMIVACEINHYPVKLEHLLRVTKDGAEILSEYPVDPELVPA |
| Ga0207704_109745161 | 3300025938 | Miscanthus Rhizosphere | MISLEENMIVALEINHYPVKLEHLLRVTHDGAEILSHYPVDPELVPA |
| Ga0207658_104304372 | 3300025986 | Switchgrass Rhizosphere | GLCIYESPWLRGGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTHDGAEILSHYPVDPELVPA |
| Ga0207677_103249912 | 3300026023 | Miscanthus Rhizosphere | YMISLEENMIVALEINHYPVKLEHLLRVTHDGAEILSHYPVDPELVPA |
| Ga0208911_10074643 | 3300026051 | Natural And Restored Wetlands | EVNHYPVKLEHLLRVTADGAEILSQYPVDPELTPA |
| Ga0208541_10324881 | 3300026061 | Natural And Restored Wetlands | LEENMIVACEINHYPVKLEHLLRVTKDGPEILSEYPVDPELVPA |
| Ga0207648_106069092 | 3300026089 | Miscanthus Rhizosphere | VGLCIYESPWLRGGDPEEYIVDLEENMIVALEINHYPVKVEHLLRVTANGYEILSEYPMDSELIPA |
| Ga0207674_107933691 | 3300026116 | Corn Rhizosphere | PWLRGGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTHDGAKILSHYPVDPELVPA |
| Ga0209268_10566162 | 3300026314 | Soil | GDPDEYLVTLEENMIIALEINHNPVKLEHLLRVTDSGVEILSNYQLDAELVPA |
| Ga0209375_10827521 | 3300026329 | Soil | DADEYLVTLEENMIIALEINHNPVKLEHLLRVTDSGVEILSSYQLDAELVPA |
| Ga0209474_102835152 | 3300026550 | Soil | IIALEINHNPVKLEHLLRVTDSGVEILSSYQLDAELVPA |
| Ga0209577_103410272 | 3300026552 | Soil | DEYLVTLEENMIIALEINHNPVKLEHLLRVTDSGVEILSNYQLDAELVPA |
| Ga0208185_10522701 | 3300027533 | Soil | DPEKYMISLEENMIVACEINHYPVKLEHLLRVTKDGGEILSEYPVDPELVPA |
| Ga0210002_10183511 | 3300027617 | Arabidopsis Thaliana Rhizosphere | RGGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTSDGAEILSKYPVDPELISA |
| Ga0209387_11160961 | 3300027639 | Agricultural Soil | EEDMIVALEINHYPVKLEHLLRVTDSGAEILSRYPVDPELVPA |
| Ga0209983_11614762 | 3300027665 | Arabidopsis Thaliana Rhizosphere | GVGLCVYESPWLRGGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTSDGAEILSKYPVDPELISA |
| Ga0209073_102492531 | 3300027765 | Agricultural Soil | GDPEKYMISLEENMIVALEINHYPVKLEHLLRVTHDGAEILSHYPVDPELVPA |
| Ga0209706_102962452 | 3300027818 | Freshwater Sediment | ENMIVALEINHYPVKLEHLLRVTADGAEILSLYPIDPELVPA |
| Ga0209798_100163176 | 3300027843 | Wetland Sediment | PEKYMISLEENMIVACEINHYPVKLEHLLRVTKDGPEILSEYPVDPELVPA |
| Ga0209798_103639681 | 3300027843 | Wetland Sediment | GGDPEKYMISLEENMIVACEINHYPVKLEHLLRVTKDGPEILSEYPVDPELVPA |
| Ga0209465_100413853 | 3300027874 | Tropical Forest Soil | MIITLEINHNPVKLEHLLRVTDMGVEILSQYQLDPELIPA |
| Ga0247662_10927561 | 3300028293 | Soil | RGGDPEKYMISLEENMIVACEINHYPVKLEHLLRVTKDGAEILSEYPVDPELVPA |
| Ga0307302_101029721 | 3300028814 | Soil | SPWLRGGDPAKYMISLEENMIVALEINHYPVKLEHLLRVTADGAEILSQYPVDPELVPA |
| Ga0307312_103819421 | 3300028828 | Soil | MIVALEINHYPVKLEHLLRVTADGAEILSQYPVDPELMPA |
| Ga0268386_108682602 | 3300030619 | Soil | EINHYPVKLEHLLRVTAGGAEILSQYPVDPELVPA |
| Ga0302046_109828042 | 3300030620 | Soil | YMVSLEENMIVALEINHYPVKLEHLLRVTNEGAEILSTYPMDPELVPA |
| Ga0299914_111517911 | 3300031228 | Soil | AKYMISLEENMIVALEINHYPVKLEHLLRVTADGAEILSRYPVDPELVPA |
| Ga0299913_102679711 | 3300031229 | Soil | YMVSLEENMIVALEVNHYPVKLEHLLRVTARGAEILSQYPVDPELVPA |
| Ga0299913_109194161 | 3300031229 | Soil | PWLRGGDPPQYAVNLEENMIVALEINHYPVKLEHLLRVTDCGAEVLSTYPMDPELTPA |
| Ga0310886_106397222 | 3300031562 | Soil | PWLRGGDPEKYMISLEENMIVALEVNHYPVKLEHLLRVTADGAEILSQYPVDPELMPA |
| Ga0307473_102595651 | 3300031820 | Hardwood Forest Soil | IYEAPWLRGGDPDEYAVTLEENMIIALEINHLPVKLEHLLRVTDSGVEILSTYQLDPELVPA |
| Ga0310917_112132752 | 3300031833 | Soil | CIYESPWLRGGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTADGAEILSRYPVDRELVPA |
| Ga0307412_122378401 | 3300031911 | Rhizosphere | IYESPWLRGGDAPEYAVNLEEDMIVALEINHYPVKLEHLLRVTDSGAEILSRYPVDPELVPA |
| Ga0310912_113241411 | 3300031941 | Soil | ENMIVALEINHYPVKLEHLLRVTADGAEILSRYPVDRELVPA |
| Ga0326597_117999541 | 3300031965 | Soil | GLCIYESPWLRGGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTSNGAEILSEYPVDPELVPA |
| Ga0310902_105738412 | 3300032012 | Soil | PEKYLISLEEDMIVALEINHYPVKLEHLLRVTHDGAEILSHYPVDPELVPA |
| Ga0315336_10393704 | 3300032132 | Seawater | PAKYQLELEENMIIALEMNHHPVKLEHLLRVTATGSEILSTYPMEPELTPA |
| Ga0307472_1002804112 | 3300032205 | Hardwood Forest Soil | MIIALEVNHLPVKLEHLLRVTDSGVEILSTYQLDPELVPA |
| Ga0310896_106032822 | 3300032211 | Soil | LCIYESPWLRGGDPEKYLISLEENMIVALEINHYPVKLEHLLRVTRDGAEILSRYPVDPELVPA |
| Ga0306920_1003203691 | 3300032261 | Soil | YESPWLRGGDPEKYMISLEENMIVALEINHYPVKLEHLLRVTADGAEILSRYPVDRELVP |
| Ga0335085_107206701 | 3300032770 | Soil | EINHLPVKLEHLLRVTDSGVEILSKYQLDPELVPA |
| Ga0335085_124804442 | 3300032770 | Soil | CEINHYPVKLEHLLRVTKDGAEILSEYPVDPELVPA |
| Ga0335084_103553563 | 3300033004 | Soil | SPWLRGGDPEKYMIALEENMIVACEINHYPVKLEHLLRVTKDGAEILSEYPVDPELVPA |
| Ga0326726_108734061 | 3300033433 | Peat Soil | YQVALEENMIIALEINHNPVKLEHLLRVTENGVEILSNYPMDPELIPA |
| Ga0310811_108904051 | 3300033475 | Soil | KYMISLEENMIVALEINHYPVKLEHLLRVTHGGAEILSHYPVDPELVPA |
| Ga0316617_1018731192 | 3300033557 | Soil | VGLCIYESPWLRGGDPEKYMISLEENMIVACEINHYPVKLEHLLRVTKDGPEILSEYPVDPELVPA |
| Ga0364930_0240444_2_124 | 3300033814 | Sediment | MIVALEINHYPVKLEHLLRVTDKGAEILSTYPMDPELVPA |
| Ga0326723_0082665_1176_1376 | 3300034090 | Peat Soil | VGLCIYEAPWLRGGDPEEYGVTLEENMIIALEINHNPVKLEHLLRVTENGVEILSNYPMDPELIPA |
| Ga0364943_0335736_418_558 | 3300034354 | Sediment | MTLEENMIIALEINHNPVKLEHLLRVTESGVEILSNYPLDPELVPA |
| Ga0364923_0107962_7_129 | 3300034690 | Sediment | MIVALEINHYPVKLEHFLRVTDKGAEILSTYPMDPELVPA |
| ⦗Top⦘ |