NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F027308

Metagenome / Metatranscriptome Family F027308

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F027308
Family Type Metagenome / Metatranscriptome
Number of Sequences 195
Average Sequence Length 37 residues
Representative Sequence MAPRRPALFPDQYALALVTAIVLLGSIALVLWAVFG
Number of Associated Samples 124
Number of Associated Scaffolds 195

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 51.79 %
% of genes near scaffold ends (potentially truncated) 10.26 %
% of genes from short scaffolds (< 2000 bps) 92.82 %
Associated GOLD sequencing projects 120
AlphaFold2 3D model prediction Yes
3D model pTM-score0.60

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (69.231 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(24.103 % of family members)
Environment Ontology (ENVO) Unclassified
(25.641 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(46.667 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 40.62%    β-sheet: 0.00%    Coil/Unstructured: 59.38%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.60
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 195 Family Scaffolds
PF02771Acyl-CoA_dh_N 61.54
PF03741TerC 5.64
PF00248Aldo_ket_red 1.54
PF03466LysR_substrate 1.54
PF00795CN_hydrolase 1.03
PF07883Cupin_2 0.51
PF07690MFS_1 0.51
PF04545Sigma70_r4 0.51
PF027373HCDH_N 0.51
PF05977MFS_3 0.51

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 195 Family Scaffolds
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 61.54
COG0861Tellurite resistance membrane protein TerCInorganic ion transport and metabolism [P] 5.64
COG0240Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.51
COG0287Prephenate dehydrogenaseAmino acid transport and metabolism [E] 0.51
COG0677UDP-N-acetyl-D-mannosaminuronate dehydrogenaseCell wall/membrane/envelope biogenesis [M] 0.51
COG1004UDP-glucose 6-dehydrogenaseCell wall/membrane/envelope biogenesis [M] 0.51
COG12503-hydroxyacyl-CoA dehydrogenaseLipid transport and metabolism [I] 0.51
COG1748Saccharopine dehydrogenase, NADP-dependentAmino acid transport and metabolism [E] 0.51
COG20843-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenaseLipid transport and metabolism [I] 0.51
COG2814Predicted arabinose efflux permease AraJ, MFS familyCarbohydrate transport and metabolism [G] 0.51


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms69.23 %
UnclassifiedrootN/A30.77 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2119805009|FNTS007_GKN1E7E02ILO8SNot Available500Open in IMG/M
3300000033|ICChiseqgaiiDRAFT_c2098337All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei576Open in IMG/M
3300001205|C688J13580_1043642All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei594Open in IMG/M
3300001686|C688J18823_10083070All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2222Open in IMG/M
3300001990|JGI24737J22298_10063392All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1110Open in IMG/M
3300004081|Ga0063454_101338672All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales602Open in IMG/M
3300005093|Ga0062594_101702733All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria659Open in IMG/M
3300005564|Ga0070664_101409626Not Available659Open in IMG/M
3300005578|Ga0068854_101851554All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales554Open in IMG/M
3300005616|Ga0068852_102405950All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria547Open in IMG/M
3300005844|Ga0068862_100229164All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1685Open in IMG/M
3300006031|Ga0066651_10319972All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales832Open in IMG/M
3300006038|Ga0075365_10714132All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales708Open in IMG/M
3300006169|Ga0082029_1320080All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales634Open in IMG/M
3300006169|Ga0082029_1333616All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei2414Open in IMG/M
3300006755|Ga0079222_12586996All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales510Open in IMG/M
3300006844|Ga0075428_102264526All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales560Open in IMG/M
3300006853|Ga0075420_100394663All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1197Open in IMG/M
3300006854|Ga0075425_102901428All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei526Open in IMG/M
3300006854|Ga0075425_102914316All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei525Open in IMG/M
3300006881|Ga0068865_100698548All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales866Open in IMG/M
3300006969|Ga0075419_10854852All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales654Open in IMG/M
3300007004|Ga0079218_11691365All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei700Open in IMG/M
3300007004|Ga0079218_12210424All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales639Open in IMG/M
3300007790|Ga0105679_10494013All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei1461Open in IMG/M
3300007790|Ga0105679_10576603All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1088Open in IMG/M
3300009094|Ga0111539_11267490All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales856Open in IMG/M
3300009094|Ga0111539_11719014Not Available728Open in IMG/M
3300009094|Ga0111539_12086637Not Available658Open in IMG/M
3300009100|Ga0075418_12083073All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium618Open in IMG/M
3300009147|Ga0114129_10962616Not Available1077Open in IMG/M
3300009147|Ga0114129_11159707Not Available964Open in IMG/M
3300009156|Ga0111538_10768557All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1220Open in IMG/M
3300009162|Ga0075423_12426750All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium572Open in IMG/M
3300009177|Ga0105248_10740576All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1109Open in IMG/M
3300009551|Ga0105238_11235720All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium772Open in IMG/M
3300009789|Ga0126307_10278284Not Available1346Open in IMG/M
3300009789|Ga0126307_10283561All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1333Open in IMG/M
3300009789|Ga0126307_10310114All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1269Open in IMG/M
3300009789|Ga0126307_10345291All Organisms → cellular organisms → Bacteria1198Open in IMG/M
3300009789|Ga0126307_10448943All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1040Open in IMG/M
3300009789|Ga0126307_10820725All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales751Open in IMG/M
3300009789|Ga0126307_10844065All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales739Open in IMG/M
3300009789|Ga0126307_11658754Not Available519Open in IMG/M
3300009789|Ga0126307_11710284Not Available511Open in IMG/M
3300009840|Ga0126313_10041647All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3202Open in IMG/M
3300009840|Ga0126313_10143320All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1797Open in IMG/M
3300009840|Ga0126313_10356898Not Available1153Open in IMG/M
3300009840|Ga0126313_10875933All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria732Open in IMG/M
3300009840|Ga0126313_10985736Not Available690Open in IMG/M
3300009840|Ga0126313_11350558All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium590Open in IMG/M
3300009840|Ga0126313_11533097Not Available554Open in IMG/M
3300010036|Ga0126305_10852417All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium621Open in IMG/M
3300010037|Ga0126304_10849315All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales620Open in IMG/M
3300010038|Ga0126315_10847647Not Available605Open in IMG/M
3300010038|Ga0126315_11144746Not Available527Open in IMG/M
3300010039|Ga0126309_10044579All Organisms → cellular organisms → Bacteria2092Open in IMG/M
3300010039|Ga0126309_10059310All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1859Open in IMG/M
3300010039|Ga0126309_10072994All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1704Open in IMG/M
3300010039|Ga0126309_10091352All Organisms → cellular organisms → Bacteria1550Open in IMG/M
3300010039|Ga0126309_10118735All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1385Open in IMG/M
3300010039|Ga0126309_10240876All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1020Open in IMG/M
3300010039|Ga0126309_10314459All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales910Open in IMG/M
3300010039|Ga0126309_10663548Not Available665Open in IMG/M
3300010040|Ga0126308_10153994All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1453Open in IMG/M
3300010040|Ga0126308_10292821Not Available1068Open in IMG/M
3300010040|Ga0126308_10511917All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales812Open in IMG/M
3300010041|Ga0126312_10203548All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1383Open in IMG/M
3300010042|Ga0126314_10168359All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1534Open in IMG/M
3300010042|Ga0126314_10602812All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium801Open in IMG/M
3300010042|Ga0126314_10622622All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium788Open in IMG/M
3300010044|Ga0126310_10290728All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium1121Open in IMG/M
3300010044|Ga0126310_10572738All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales837Open in IMG/M
3300010045|Ga0126311_10283814All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1240Open in IMG/M
3300010045|Ga0126311_10400048Not Available1057Open in IMG/M
3300010045|Ga0126311_11166759Not Available636Open in IMG/M
3300010045|Ga0126311_11349782Not Available594Open in IMG/M
3300010166|Ga0126306_10542028Not Available923Open in IMG/M
3300010166|Ga0126306_11081138Not Available656Open in IMG/M
3300010375|Ga0105239_12485064All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium604Open in IMG/M
3300010400|Ga0134122_11202003Not Available759Open in IMG/M
3300012043|Ga0136631_10033197All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1896Open in IMG/M
3300012091|Ga0136625_1084440Not Available1119Open in IMG/M
3300012092|Ga0136621_1066306Not Available1478Open in IMG/M
3300012186|Ga0136620_10125355All Organisms → cellular organisms → Bacteria1170Open in IMG/M
3300012358|Ga0137368_10531201All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei754Open in IMG/M
3300012403|Ga0134049_1186131All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium600Open in IMG/M
3300012407|Ga0134050_1394986Not Available625Open in IMG/M
3300012469|Ga0150984_116219878All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 5G121004Open in IMG/M
3300012530|Ga0136635_10159079All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales751Open in IMG/M
3300012680|Ga0136612_10016381All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3686Open in IMG/M
3300012911|Ga0157301_10265389Not Available611Open in IMG/M
3300012915|Ga0157302_10187350All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium732Open in IMG/M
3300012939|Ga0162650_100009712All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1229Open in IMG/M
3300012960|Ga0164301_11312997Not Available587Open in IMG/M
3300012977|Ga0134087_10756043Not Available521Open in IMG/M
3300012985|Ga0164308_10083672Not Available2190Open in IMG/M
3300012985|Ga0164308_11074688Not Available719Open in IMG/M
3300012986|Ga0164304_10295976Not Available1107Open in IMG/M
3300013011|Ga0169967_1018383All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1485Open in IMG/M
3300013011|Ga0169967_1026668All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1135Open in IMG/M
3300013012|Ga0169965_1073754Not Available677Open in IMG/M
3300013013|Ga0169969_1029852All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium1343Open in IMG/M
3300013024|Ga0170682_1015587All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1786Open in IMG/M
3300013024|Ga0170682_1026739All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1209Open in IMG/M
3300013027|Ga0170683_10204194All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei508Open in IMG/M
3300013102|Ga0157371_10608247Not Available813Open in IMG/M
3300013831|Ga0120126_1000815All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium1382Open in IMG/M
3300014326|Ga0157380_10546743All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1135Open in IMG/M
3300017695|Ga0180121_10133314All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales904Open in IMG/M
3300017695|Ga0180121_10164365Not Available816Open in IMG/M
3300017787|Ga0183260_10065358All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2675Open in IMG/M
3300017789|Ga0136617_10201309Not Available1678Open in IMG/M
3300018051|Ga0184620_10087204Not Available944Open in IMG/M
3300018422|Ga0190265_10093029All Organisms → cellular organisms → Bacteria2800Open in IMG/M
3300018422|Ga0190265_10606949All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1213Open in IMG/M
3300018422|Ga0190265_10741428All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1104Open in IMG/M
3300018422|Ga0190265_10743174All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1103Open in IMG/M
3300018422|Ga0190265_11489269All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium790Open in IMG/M
3300018422|Ga0190265_11503504All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium787Open in IMG/M
3300018422|Ga0190265_13824090Not Available502Open in IMG/M
3300018429|Ga0190272_10349084All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1177Open in IMG/M
3300018429|Ga0190272_10499979All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1032Open in IMG/M
3300018432|Ga0190275_10075277All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2910Open in IMG/M
3300018432|Ga0190275_10212575All Organisms → cellular organisms → Bacteria1838Open in IMG/M
3300018432|Ga0190275_10811483Not Available1000Open in IMG/M
3300018432|Ga0190275_11969753Not Available663Open in IMG/M
3300018432|Ga0190275_12419096Not Available603Open in IMG/M
3300018432|Ga0190275_13631298Not Available500Open in IMG/M
3300018465|Ga0190269_11710011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium531Open in IMG/M
3300018466|Ga0190268_11630875All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium570Open in IMG/M
3300018469|Ga0190270_10008602All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales5623Open in IMG/M
3300018469|Ga0190270_10293627Not Available1443Open in IMG/M
3300018469|Ga0190270_12146818Not Available618Open in IMG/M
3300018469|Ga0190270_12210709Not Available610Open in IMG/M
3300018469|Ga0190270_12735763All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium556Open in IMG/M
3300018476|Ga0190274_11825904Not Available703Open in IMG/M
3300018481|Ga0190271_12386187All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei633Open in IMG/M
3300018920|Ga0190273_10403810All Organisms → cellular organisms → Bacteria962Open in IMG/M
3300018920|Ga0190273_10893798Not Available718Open in IMG/M
3300019356|Ga0173481_10203122All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei861Open in IMG/M
3300019377|Ga0190264_10808625All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales715Open in IMG/M
3300019377|Ga0190264_11006592All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium667Open in IMG/M
3300019377|Ga0190264_11928709Not Available538Open in IMG/M
3300020181|Ga0196958_10054549All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1244Open in IMG/M
3300021445|Ga0182009_10142165All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium1134Open in IMG/M
3300022756|Ga0222622_10389792All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales979Open in IMG/M
3300025901|Ga0207688_10104281All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1640Open in IMG/M
3300025919|Ga0207657_11267033Not Available558Open in IMG/M
3300025926|Ga0207659_11723626Not Available533Open in IMG/M
3300025927|Ga0207687_10606360All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales923Open in IMG/M
3300025981|Ga0207640_11680096Not Available573Open in IMG/M
3300026041|Ga0207639_11966354All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium546Open in IMG/M
3300026142|Ga0207698_12397932All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales539Open in IMG/M
3300027907|Ga0207428_10839529All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales651Open in IMG/M
3300028589|Ga0247818_10969195All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales600Open in IMG/M
3300028718|Ga0307307_10109694All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales846Open in IMG/M
3300028755|Ga0307316_10169961Not Available781Open in IMG/M
3300028810|Ga0307294_10385321All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium524Open in IMG/M
3300028824|Ga0307310_10385776All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium693Open in IMG/M
3300028875|Ga0307289_10295860All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales666Open in IMG/M
3300028880|Ga0307300_10345815All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium512Open in IMG/M
3300028881|Ga0307277_10185431All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium909Open in IMG/M
3300030006|Ga0299907_10542335All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria913Open in IMG/M
3300030336|Ga0247826_10289637All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1168Open in IMG/M
3300030336|Ga0247826_10890861All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales702Open in IMG/M
3300030336|Ga0247826_11010943Not Available661Open in IMG/M
3300030336|Ga0247826_11310189All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium583Open in IMG/M
3300031164|Ga0307502_10104492Not Available592Open in IMG/M
3300031184|Ga0307499_10087566All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium833Open in IMG/M
3300031229|Ga0299913_10125504All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2522Open in IMG/M
3300031229|Ga0299913_10350003All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1465Open in IMG/M
3300031229|Ga0299913_10702330Not Available989Open in IMG/M
3300031229|Ga0299913_10957429All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales824Open in IMG/M
3300031450|Ga0272433_10049523All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3169Open in IMG/M
3300031731|Ga0307405_11027297All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales705Open in IMG/M
3300031740|Ga0307468_100057296All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2079Open in IMG/M
3300031740|Ga0307468_101128404All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei701Open in IMG/M
3300031823|Ga0307478_10810231All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria784Open in IMG/M
3300031824|Ga0307413_10773006All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059805Open in IMG/M
3300031824|Ga0307413_10840535All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales775Open in IMG/M
3300031903|Ga0307407_10295164Not Available1128Open in IMG/M
3300031911|Ga0307412_11018358Not Available733Open in IMG/M
3300031938|Ga0308175_100586369All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1198Open in IMG/M
3300031938|Ga0308175_101746309All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria697Open in IMG/M
3300031938|Ga0308175_101887102All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium669Open in IMG/M
3300031995|Ga0307409_100381700All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1340Open in IMG/M
3300032004|Ga0307414_10868688All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales826Open in IMG/M
3300032005|Ga0307411_12316323Not Available505Open in IMG/M
3300032013|Ga0310906_10790237All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium670Open in IMG/M
3300032080|Ga0326721_10390557All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales803Open in IMG/M
3300034003|Ga0334922_041548All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium638Open in IMG/M
3300034006|Ga0334934_000655Not Available7667Open in IMG/M
3300034251|Ga0334947_059025Not Available782Open in IMG/M
3300034268|Ga0372943_0225409Not Available1170Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil24.10%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil22.05%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere7.18%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand5.13%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.62%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere4.10%
RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Rock3.59%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.08%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil2.05%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.54%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.54%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.54%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.54%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil1.54%
Termite NestEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest1.03%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.03%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.03%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.03%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.51%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.51%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.51%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.51%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.51%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.51%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.51%
Sub-Biocrust SoilEnvironmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil0.51%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.51%
BiocrustEnvironmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust0.51%
Hypolithic BiocrustEnvironmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust0.51%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil0.51%
RockEnvironmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock0.51%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.51%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.51%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.51%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.51%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.51%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.51%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.51%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.51%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.51%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.51%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.51%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2119805009Soil microbial communities from sample at FACE Site NTS_007 Nevada Test SiteEnvironmentalOpen in IMG/M
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300001205Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300001990Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3Host-AssociatedOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006038Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5Host-AssociatedOpen in IMG/M
3300006169Termite nest microbial communities from Madurai, IndiaEnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300007790Microbial communities of desert soil contaminated with blood from dead anthrax infected zebra in Etosha National Park, Namibia. Combined Assembly of 14 sequencing projectsEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300012043Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ601 (22.06)EnvironmentalOpen in IMG/M
3300012091Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ483 (23.06)EnvironmentalOpen in IMG/M
3300012092Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ445A (23.06)EnvironmentalOpen in IMG/M
3300012186Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ416 (21.06)EnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012403Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012407Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012530Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ85 (21.06)EnvironmentalOpen in IMG/M
3300012680Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ224A (23.06)EnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012939Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013011Gypsum crust endolithic microbial communities from the Atacama Desert, Chile - KM37EnvironmentalOpen in IMG/M
3300013012Gypsum rock endolithic microbial communities from the Atacama Desert, Chile - Cordon de LilaEnvironmentalOpen in IMG/M
3300013013Gypsum rock endolithic microbial communities from the Atacama Desert, Chile - MonturaquiEnvironmentalOpen in IMG/M
3300013024Gypsum crust hypoendolithic microbial communities from the Atacama Desert, Chile - KM37, HEEnvironmentalOpen in IMG/M
3300013027Gypsum rock hypoendolithic microbial communities from the Atacama Desert, Chile - MonturaquiEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013831Permafrost microbial communities from Nunavut, Canada - A21_5cm_6MEnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300017695Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ540 (21.06) (version 2)EnvironmentalOpen in IMG/M
3300017787Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2)EnvironmentalOpen in IMG/M
3300017789Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06)EnvironmentalOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300020181Soil microbial communities from Anza Borrego desert, Southern California, United States - S1+v_10EnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028589Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1EnvironmentalOpen in IMG/M
3300028718Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028810Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300028880Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300031164Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 16_SEnvironmentalOpen in IMG/M
3300031184Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_SEnvironmentalOpen in IMG/M
3300031229Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38EnvironmentalOpen in IMG/M
3300031450Rock endolithic microbial communities from Victoria Land, Antarctica - University Valley sudEnvironmentalOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300031903Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1Host-AssociatedOpen in IMG/M
3300031911Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1Host-AssociatedOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032004Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3Host-AssociatedOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032080Soil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016EnvironmentalOpen in IMG/M
3300034003Biocrust microbial communities from Mojave Desert, California, United States - 18HMCEnvironmentalOpen in IMG/M
3300034006Biocrust microbial communities from Mojave Desert, California, United States - 30SMCEnvironmentalOpen in IMG/M
3300034251Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 43SMSEnvironmentalOpen in IMG/M
3300034268Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FNTS007_040901002119805009SoilMAPRRPVLYASQYALALVTAIVALGSIGVVIWLLVR
ICChiseqgaiiDRAFT_209833723300000033SoilMAPRRPALFPQQYGLALVTAILLLGGLAAVLWFVLG*
C688J13580_104364223300001205SoilMAPRRPALFPQQYGLALVTAILLLGGLAVVLWLVLA*
C688J18823_1008307023300001686SoilMAPRRPVLFEGQYALALVTGLLLVGSIALVAWAVFG*
JGI24737J22298_1006339223300001990Corn RhizospherePGRPVLFPDQYALALVTALVLIASIGLVLWAIFG*
Ga0063454_10133867223300004081SoilMRRTMAPRRPLLFTEQYALALVTAIVVVASIAFVIWVVFVSH*
Ga0062594_10170273323300005093SoilRRRTMAPGRPALFPDQYALALVTGLVLLASVGLVLWAVFG*
Ga0070664_10140962623300005564Corn RhizosphereMAPGRPALFPDQYALALVTGLVLLASVGLVLWAVFG*
Ga0068854_10185155423300005578Corn RhizosphereMWRRVRRRTMAPRRPVLFPQQYGLALVTALLLLGGLAVVLWLVLG*
Ga0068852_10240595023300005616Corn RhizosphereLRRRTMAPGRPALFPDQYALALVTGLVLLASIALALWAVFG*
Ga0068862_10022916433300005844Switchgrass RhizosphereMAPGRPALFPDQYALALVTVLVLLASVGLVLWAVFG*
Ga0066651_1031997213300006031SoilMAPSRPAVFPDQWALVVFTAVVLVGSIVLVVWAVFG*
Ga0075365_1071413223300006038Populus EndosphereMAPRRPALFPQQYGLALVTAILLVGGLAVVLWLALG*
Ga0082029_132008023300006169Termite NestRTMAPRRPVLFPDQYALALVTAIVLIASIALVLWAFFG*
Ga0082029_133361613300006169Termite NestMWRRFRRRTMAPRRPVLFPDQYALALVTAIVLIASVALVLWAFFG*
Ga0079222_1258699613300006755Agricultural SoilMAPSRPALFPDQWALAIFTAVVLVGSIALVIWAVWG*
Ga0075428_10226452623300006844Populus RhizosphereMAPRRPALFPDQYALALVTAIVLIGSIALVLWAVFG*
Ga0075420_10039466343300006853Populus RhizosphereMAPRRPVLFPDQYALALVTAIVLIASIALVLWAFFG*
Ga0075425_10290142813300006854Populus RhizosphereRRLRRRTMAPSRPALFPDQWALAVFTGIVLVGSIALVVWAVFG*
Ga0075425_10291431623300006854Populus RhizosphereMAPRRPALFPQQYGLALVTAILLLGGLAVVLWFVLG*
Ga0068865_10069854823300006881Miscanthus RhizosphereMWRRVRRRTMAPRRPALFPQQYGLALVTALLLLGGLAVVLWLVLG*
Ga0075419_1085485223300006969Populus RhizosphereMAPRRPVLFPDQYALAIVTALVLIGSIALVLWAFFG*
Ga0079218_1169136523300007004Agricultural SoilMAPRRPVLFPDQWALALVTGIVLVASVVLVAWAFFG*
Ga0079218_1221042423300007004Agricultural SoilMAPRRPALFPDQYALALVTAIVLIASVALVLWAVFG*
Ga0105679_1049401343300007790SoilMLRRILRRSMAPRRPLLYEKQYGLALVTAIVVVGSIAVVVLALLT*
Ga0105679_1057660323300007790SoilMAPTRPVLFPDQWPLAIFTAVLLVGSIALVIWAVFG*
Ga0111539_1126749023300009094Populus RhizosphereMAPGRPVLFPDQYALALVTALVLIASIGLVLWAIFG*
Ga0111539_1171901413300009094Populus RhizosphereMAPSRPALFPDQYALALVTAIVLIVSIVLVLWAFFG*
Ga0111539_1208663723300009094Populus RhizosphereMAPGRPVLFPDQYALAIVTALVLIASIALVLWAFFG*
Ga0075418_1208307313300009100Populus RhizosphereMAPSRPALFPDQYALALLTAIVLIVSIVLVLWAFFG*
Ga0114129_1096261623300009147Populus RhizosphereMAPSRPALFPDQYALALVTAIVLIVSIVVVLWAFFG*
Ga0114129_1115970723300009147Populus RhizosphereMAPRRPALFPDQYALALVTGLLLLGSVALVIWAVFG*
Ga0111538_1076855713300009156Populus RhizosphereMAPGRPVLFPDQYALAIVTALVLIASIALVLWAFF
Ga0075423_1242675013300009162Populus RhizosphereRRTMAPGRPVLFPDQYALALVTALVLIASIGLVLWAISG*
Ga0105248_1074057623300009177Switchgrass RhizosphereMAPRRPVLFPQQYGLALVTALLLLGGLAVVLWLVLG*
Ga0105238_1123572023300009551Corn RhizosphereMAPRRPALFPQQYGLALVTAILLLGGLAVVLWVALG*
Ga0126307_1027828423300009789Serpentine SoilMAPRRPVLFEGQYALALVTAIVLVGSIAFVAWVVLG*
Ga0126307_1028356143300009789Serpentine SoilMAPSRPVLFPDQYALALVTAIVLIVSIALVLWAFFG*
Ga0126307_1031011423300009789Serpentine SoilMAPRRPILFPDQWALALVTGIVLVASIALVLWAFFG*
Ga0126307_1034529123300009789Serpentine SoilMAPRRPALFPGQYALALVTGLLLLASVALAIWAVFG*
Ga0126307_1044894323300009789Serpentine SoilMAPRRPALFPDQYALAIVTALVLIGSIALVLWAFFG*
Ga0126307_1082072523300009789Serpentine SoilMAPGRPALFQDQYALALVTAIVLIASIALVLWAFFG*
Ga0126307_1084406523300009789Serpentine SoilMAPRRPTLLPGQYALALVTALLLLASIGLVIWAVFG*
Ga0126307_1165875423300009789Serpentine SoilMAPRRPVLFPDQWALALVTGLVLVASIALVLWAFFG*
Ga0126307_1171028423300009789Serpentine SoilMAPRRPLLFPRQYALAVVTALLLLVGLTLVLWAYFG*
Ga0126313_1004164723300009840Serpentine SoilMAPGRPAIFPDQYALAIVTALVLIGSIALVLWAILG*
Ga0126313_1014332023300009840Serpentine SoilMAPRRPVLFPDQYPLAIVTAVVLIASIALVLWAFFG*
Ga0126313_1035689813300009840Serpentine SoilMAPRRPALFPQQYGLAMVTALLLLGGLAVVLWLVLG*
Ga0126313_1087593313300009840Serpentine SoilMAPRRPILFPDQWALALVTGMVLVASIALVLWAFFG*
Ga0126313_1098573623300009840Serpentine SoilMAPRRPVLFEGQYALALVTAIVLLGSIALVAWAVLG*
Ga0126313_1135055823300009840Serpentine SoilMAPRRPVLFEGQYALALVTVLLLVGSIAFVAWVVLG*
Ga0126313_1153309713300009840Serpentine SoilMAPRRPVLFEGQYALALVTGLLLVGSIALVAWVVFG
Ga0126305_1085241713300010036Serpentine SoilMAPRRPALFPQQYGLALVTALLLLGGLAVVLWVVLG*
Ga0126304_1084931523300010037Serpentine SoilMAPRRPILFPDQYALAIVTALVLIASIALVLWAIVG*
Ga0126315_1084764723300010038Serpentine SoilMAPSRPALFPDQYALAIVTAIVLVGSIALVVWAVWGS*
Ga0126315_1114474613300010038Serpentine SoilMAPRRPVLFEGQYALALVTAIVLGGSIAFVAWVVFG*
Ga0126309_1004457923300010039Serpentine SoilMAPRRPVLFEGQYALALVTALVLAGSIALVAWVLLG*
Ga0126309_1005931043300010039Serpentine SoilMAPRRPLLYADQVPLAVVTAVVLVGSIALVVWAVFG*
Ga0126309_1007299423300010039Serpentine SoilMAPRRPLLYEDQWALGLVTAIVLLGSIAFVAWLFLG*
Ga0126309_1009135223300010039Serpentine SoilMAPRRPLLFPGQYALALVTGIVLLGSIALVAWVVFG*
Ga0126309_1011873523300010039Serpentine SoilMAPRRPILFPDQWALALVTGLVLVASIALVLWAFFG*
Ga0126309_1024087623300010039Serpentine SoilMAPRRPLLYADQVPLAVVTGVVLVASIALVAWAVFG*
Ga0126309_1031445923300010039Serpentine SoilMAPRRPVLFPDQYALAIVTAVVLIASIAFVLWAFFG*
Ga0126309_1066354823300010039Serpentine SoilMAPRRPVLFEGQYALALVTAIVVVGSIALVAWAVLS*
Ga0126308_1015399423300010040Serpentine SoilMAPRRPVLFEGQYALALVTGLLLIGSMALVAWAVFG*
Ga0126308_1029282123300010040Serpentine SoilMAPGRPALFPDQYALAIVTGLVLIGSIALVLWAFFG*
Ga0126308_1051191723300010040Serpentine SoilMAPRRPVLYEDQWPLAIVTALVLVGSIALVVWAVFG*
Ga0126312_1020354833300010041Serpentine SoilMAPRRPVLFEGQYALALVTGLLLVGSIALVAWAVLG*
Ga0126314_1016835923300010042Serpentine SoilMAPRRPVLFEGQYALALVTGLLLVGSIALVAWVVFG*
Ga0126314_1060281223300010042Serpentine SoilMAPRRPVLFEGQYALALVTALLLIGSIALVAWAVFG*
Ga0126314_1062262223300010042Serpentine SoilMAPRRPVLFPDQWALALVTGIVLVASIALVLWAFFG*
Ga0126310_1029072823300010044Serpentine SoilMAPRRPALFPQQYGLAMVTALVLLGGLAVVLWVVLG*
Ga0126310_1057273823300010044Serpentine SoilMAPSRPALFPDQYALAIVTAIVLIGSIALVVWAVWGS*
Ga0126311_1028381423300010045Serpentine SoilMAPSRPALFPDQYALALVTAIVLIVSIALVLWAFFG*
Ga0126311_1040004823300010045Serpentine SoilMAPRRPALFPQQYGLAMVTALLLLGGLAVVLWVVLG*
Ga0126311_1116675923300010045Serpentine SoilMAPRRPLLFPGQYALALVTAIFLLGSIALVAWVVLG*
Ga0126311_1134978223300010045Serpentine SoilMAPRRPVLFEGQYALALVTGGLLIGSIALVAWAVFG*
Ga0126306_1054202833300010166Serpentine SoilMAPRRPLLFRGQYALALVTGLLLMGSVVLVIWAVFG*
Ga0126306_1108113823300010166Serpentine SoilMAPRRPILYADQWPLALVTAIVLIGSIALVVWAVFG*
Ga0105239_1248506423300010375Corn RhizosphereMAPRRPALFPQQYGLALVTALLLLGGLAVVLWLVLG*
Ga0134122_1120200323300010400Terrestrial SoilRTMAPRRPALFPKQYGLALVTAILLLGGLAVVLWLVLV*
Ga0136631_1003319713300012043Polar Desert SandMWRRFRRRSMAPRRPILFPDQWTLAIVTALVLLGSIAFVAWVLLA*
Ga0136625_108444023300012091Polar Desert SandMAPRRPVLFEDQWALALVTALVLVGSIAFVAWIFL*
Ga0136621_106630633300012092Polar Desert SandMAPRRPILFPDQWTLAIVTALVLLGSIAFVAWVLLA*
Ga0136620_1012535533300012186Polar Desert SandMAPRRPVLFEGQYSLALVTGLVLVGSVAFVLWIVLG*
Ga0137368_1053120133300012358Vadose Zone SoilMWRRVRRKTFAPRRPVLFTEQWPLAIVTAVFLIGGIAAIVVALTR*
Ga0134049_118613123300012403Grasslands SoilRRPALFEEQYALALLTAIVLVGSIVAVVLVVAHS*
Ga0134050_139498613300012407Grasslands SoilLRRRTMAPRRPVLFEGQYALALVTGLVLVGSIALVAWVVFG*
Ga0150984_11621987833300012469Avena Fatua RhizosphereMAPRRPILYEDQWALALVTAIVLVGSIALVVWAVFG*
Ga0136635_1015907923300012530Polar Desert SandMAPRRPVLFEGQYALALVTALVLLGSVAVVLWIVL*
Ga0136612_1001638133300012680Polar Desert SandMAPRRPVLFEGQYGLALVTALVLVGSVALALWIVLG*
Ga0157301_1026538923300012911SoilMAPRRPALFPQQYGLALVTAILLLGGLAVVVWFVLG*
Ga0157302_1018735023300012915SoilMAPRRPALFPQQYALALVTAILLLGGLAVVLWVALG*
Ga0162650_10000971223300012939SoilMAPRRPVLFPDQYALAIVTVLVLIGSIALVLWAIFG*
Ga0164301_1131299713300012960SoilMAPSRPALFPDQWALAIFTAIVLVGSIGLVIWAVFG*
Ga0134087_1075604323300012977Grasslands SoilMAPRRPVLFEGQYALALVTGLVLIGSIALVVWVVFG*
Ga0164308_1008367243300012985SoilMAPRRPLLFPGQYALALVTAILLLAGIAIALWVVLG*
Ga0164308_1107468823300012985SoilMAPRRPLLFPGQYALALVTAILLLAGLAIALWAVLG*
Ga0164304_1029597613300012986SoilMAPRRPLLFPGQYALALVTAILLLAGLAIVLWALLG*
Ga0169967_101838333300013011RockMAPRRPVLFESQYSLGLVTVLVLLGSIALVGYVLVAN*
Ga0169967_102666833300013011RockMAPRRPVLFEGQYALALVTALVLVGSIALVVYVAAVR*
Ga0169965_107375423300013012RockMAPRRPVLFEGQYGLALVTGLVLLGSIALVVAVVVLS*
Ga0169969_102985233300013013RockMAPRRPVLFEGQVGLALVTGLVLLGSIALAVAVVVLS*
Ga0170682_101558723300013024RockMAPRRPVLFEGQYALALVTALVLLGSIALVVYVAAVR*
Ga0170682_102673923300013024RockMAPRRPVLFESQYSLGLVTVLVLLGSMALVVYVLMAN*
Ga0170683_1020419423300013027RockRRLRRRTMAPRRPVLFEGQYGLALVTGLVLLGSIALAVAVVVLS*
Ga0157371_1060824723300013102Corn RhizosphereMAPRRPALFPQQYGLALVTALLLLGGLAVVLWFVLG*
Ga0120126_100081533300013831PermafrostMAPRRPLLYADQWPLALVTAIVVVASIALVLWAVFGDHQ*
Ga0157380_1054674323300014326Switchgrass RhizosphereMAPRRPALFPQQYGLALVTAILLLGGLAVVLWLVLG*
Ga0180121_1013331423300017695Polar Desert SandMAPRRPVLFEGQYALALVTALVLLGSIAVVLWIVV
Ga0180121_1016436523300017695Polar Desert SandMAPRRPVLFPEQYVLAAVTMIVLIASIVVFFVVLSYR
Ga0183260_1006535823300017787Polar Desert SandMAPRRPLLFPDQWALALVTGLVLVGSIALVLWVAFS
Ga0136617_1020130943300017789Polar Desert SandMAPRRPVLFEGQYALALVTALVLLGSVAVVLWIAL
Ga0184620_1008720423300018051Groundwater SedimentMAPRRPALFPQQYGLALVTAILLLGGLAVVLWLVLG
Ga0190265_1009302923300018422SoilMAPRRPLLFEGQYALALVTAIVLVGSIAFVAWVYFA
Ga0190265_1060694943300018422SoilMAPRRPILYEDQWALAFVTAVVLVGSIALVAWAVLG
Ga0190265_1074142833300018422SoilMAPRRPLLYADQVPLAIITGVVLMASIGLVVWVVFSG
Ga0190265_1074317423300018422SoilMAPRRPILYGDQWPLALVTAIVLVASIALVIWAVFG
Ga0190265_1148926923300018422SoilMAPRRPLLFPGQYALALVTVIVLVGSVAFVVWAFFA
Ga0190265_1150350423300018422SoilMAPRRPILFPDQYALAIVTVLVLVASVALVLWAFFG
Ga0190265_1382409023300018422SoilMAPGRPALFPDQWALALVTGVILLGSIALVAWAAFG
Ga0190272_1034908433300018429SoilMAPGRPALFPDQWALALVTGLILLGSIALVAWVAFG
Ga0190272_1049997933300018429SoilMAPRRPILFPDQRALALVTGLVLVASIALVLWAFFA
Ga0190275_1007527743300018432SoilMAPRRPLLFSGQYALAAVTVILLVGSIAFVAWAVFG
Ga0190275_1021257523300018432SoilMAPRRPVLFEGQYALALVTAIVLVGSIAFVAWMVFG
Ga0190275_1081148323300018432SoilMAPRRPILFPDQWALALVTGLVLVGSIALVAWAVFG
Ga0190275_1196975323300018432SoilAPRRPVLFPDQYALALVTALVLIGSIALVLWAFFG
Ga0190275_1241909623300018432SoilMAPRRPILFPDQWALALVTGLVLVASIVLVLWAFFS
Ga0190275_1363129823300018432SoilMAPRRPLLFEGQYALALVTAIVLVGSLALVAWVVFG
Ga0190269_1171001113300018465SoilRRLRRRTMAPSRPALFPDQYALAVVTTIVLIVSIVVVLWAFFG
Ga0190268_1163087523300018466SoilRRRTMAPRRPVLFPDQYALAIVTALVLIGSIALVLWAFFG
Ga0190270_1000860283300018469SoilMAPRRPALFPGQYALALVTGLLLLGSVALVIWAVFG
Ga0190270_1029362733300018469SoilMAPRRPALFPGQYALALVTAILLLGGLAIVLWAYLG
Ga0190270_1214681823300018469SoilMAPRRPVLFEGQYALALVTAIVLVGSIALVFWVVLG
Ga0190270_1221070923300018469SoilMAPRRPLLFEGQYALALVTAIVLVGSIGFVVWVFLG
Ga0190270_1273576323300018469SoilMAPRRPVLFDGQYALALVTAIVLVGSLALVAWVVFG
Ga0190274_1182590413300018476SoilMAPRRPVLFEGQYALALVTAVVLVGSLALVAWVVLG
Ga0190271_1238618723300018481SoilMWRRVRRRTMAPRRPVLFPGQYALALVTAILLLGSVALVLWAVLG
Ga0190273_1040381013300018920SoilMAPRRPLLFSGQYALAAVTAILLVGSIAFVAWAVFG
Ga0190273_1089379823300018920SoilMAPRRPVLFEQQYTLALVTAIVLVGSIGFAVWALLQ
Ga0173481_1020312223300019356SoilMWRRVRRRTMAPRRPALFPQQYGLALVTAILLLGGLAAVLWFVLG
Ga0190264_1080862523300019377SoilMAPRRPVLFPDQYALAIVTVLVLIGSIALVLWAIFG
Ga0190264_1100659223300019377SoilMAPRRPLLYEGQYGLAVVTAVVLLASVYLAIRAVL
Ga0190264_1192870923300019377SoilMAPRRPLLFPGQYALALASAIVLVGSIALVAWVVLG
Ga0196958_1005454913300020181SoilMAPGRPALFPDQFALAIVTALVLIGSIVLVLWAFLG
Ga0182009_1014216523300021445SoilMAPRRPALFPQQYALALVTAILLLGGLAVVLWVALG
Ga0222622_1038979233300022756Groundwater SedimentMWRRVRRRTMAPRRPALFPQQYGLALVTAILLLGGLAVVLWLVLG
Ga0207688_1010428143300025901Corn, Switchgrass And Miscanthus RhizosphereMAPGRPALFPDQYALALVTGLVLLASVGLVLWAVFG
Ga0207657_1126703323300025919Corn RhizosphereMAPRRPALFPQQYGLALVTAILLLGGLAAVLWFVLG
Ga0207659_1172362623300025926Miscanthus RhizosphereMAPGRPALFPDQYALALVTVLVLLASVGLVLWAVFG
Ga0207687_1060636023300025927Miscanthus RhizosphereMAPRRPVLFPDQYALALVTALVLIASIGLVLWAIFG
Ga0207640_1168009613300025981Corn RhizosphereMAPRRPVLFEGQYALALVTGLVLVGSIALVVWVVFG
Ga0207639_1196635423300026041Corn RhizosphereMAPRRPALFPQQYGLALVTAILLLGGLAVVLWVALG
Ga0207698_1239793223300026142Corn RhizosphereMAPRRPVLFPDQYALAIVTALVLIASIALVVWAFFG
Ga0207428_1083952923300027907Populus RhizosphereMAPRRPVLFPDQYALALVTVVVLLASIALVLWAVFG
Ga0247818_1096919523300028589SoilMAPSRPALFPDQYALALVTAIVLIVSIVLVLWAFFG
Ga0307307_1010969423300028718SoilMAPRRPLLYPGQYALALVTAILLLAGVAIALWIVLG
Ga0307316_1016996123300028755SoilMAPSRPAVFPDQWALVIVTAIVLIASIALVLWAFFG
Ga0307294_1038532123300028810SoilMAPRRPALFPQQYGLALVTAILLLGGLAVVLWVVLG
Ga0307310_1038577623300028824SoilMAPRRPVLFEGQYALALVTAILMICSIAFVAWVVFR
Ga0307289_1029586013300028875SoilRRRTMAPRRPALFPQQYGLALVTALLLLGGLAVVLWLVLG
Ga0307300_1034581523300028880SoilMAPRRPALFPQQYGLALVTALLLFAGLAVVLWLVLG
Ga0307277_1018543123300028881SoilMAPSRPALFPDQWPLAIVTAVFVVGSIALVVWAVFG
Ga0299907_1054233533300030006SoilMAPRRPLLFASQYALALVTAILLLGSVALVLWAAFG
Ga0247826_1028963723300030336SoilMAPSRPALFPDQYALAIVTAIVLIVSIVLVLWAFFG
Ga0247826_1089086113300030336SoilMWRRVRRRTMAPRRPVLFPGQYALALLTAILLVGSVALVLWAVLG
Ga0247826_1101094323300030336SoilMRWKRRTMAPRRPILFVEQYALALVTAVVLIGSAAFALWVVFH
Ga0247826_1131018913300030336SoilAPSRPALFPDQYALALVTAIVLIVSIVLVLWAFFG
Ga0307502_1010449223300031164SoilMAPRRPVLFEGQYALALVTALVMVGSIAFVAWVVFG
Ga0307499_1008756623300031184SoilMAPRRPLLFPGQYALALVTGIVLVGSIALAIWAIFG
Ga0299913_1012550443300031229SoilMAPRRPLLFASQYALALVTAILLLGSVALVLWATFG
Ga0299913_1035000323300031229SoilMAPRRPVLFPDQYALAIVTALVLVASIALVLWAFLG
Ga0299913_1070233013300031229SoilRLRRRTMAPSRPAVFPDQWALLIVTALVLIVSIALTLWAIFG
Ga0299913_1095742933300031229SoilMAPSRPAVFPDQWALLIVTALVLIVSIALTLWAIFG
Ga0272433_1004952323300031450RockMAPRRPILFEQQYGLALLTAILLVAGVGAILWLLVSA
Ga0307405_1102729723300031731RhizosphereMAPRRPALFPDQYALALVTGIVLIGSIALVLWAVLG
Ga0307468_10005729633300031740Hardwood Forest SoilMAPRRPALFPQQYGLALVTAILLLGGLAVVLWFVLG
Ga0307468_10112840423300031740Hardwood Forest SoilMWPRVRRRTMAPRRPLLFPRQYALALLTGVLLVGSIALAIWAIFG
Ga0307478_1081023123300031823Hardwood Forest SoilMGPRRPPLQPHQYGLALVTAIVLVGSIVAVALITLR
Ga0307413_1077300623300031824RhizosphereMAPRRPVLFPDQYALALVTAIVLIASIALVLWAFFG
Ga0307413_1084053523300031824RhizosphereMAPGRPALFPDQYALAIVTGLVLIGSIALVLWAFFG
Ga0307407_1029516423300031903RhizosphereMAPRRPVLFPDQYALAIVTGLVLIGSIVLVLWAIFG
Ga0307412_1101835823300031911RhizosphereMAPGRPALFPDQYALAIVTGLVLIGSIALVFWAIFG
Ga0308175_10058636923300031938SoilMAPRRPVLFPDQYALAIVTALVLIASIALVLWAFFG
Ga0308175_10174630913300031938SoilMAPSRPALFPDQWALAIFTAVVLVASIALVIWAVWG
Ga0308175_10188710223300031938SoilMAPRRPALFPQQYGLALVTAILLLGGLALVLWLVLG
Ga0307409_10038170023300031995RhizosphereMAPRRPVLFPDQYALAIVTAVVLIASIALVLWAFFG
Ga0307414_1086868813300032004RhizosphereMAPRRPALFPDQYALALVTGIVLIGSIALVLWAVFG
Ga0307411_1231632323300032005RhizosphereMAPRRPALFPDQYALALVTAIVLLGSIALVLWAVFG
Ga0310906_1079023723300032013SoilMAPRRPALFPQQYGLALVTAILLLGGLVLVLWLALG
Ga0326721_1039055713300032080SoilMAPGRPALFPDQYGLAIVTGLVLLASIALVIWAVFG
Ga0334922_041548_500_6103300034003Hypolithic BiocrustMAPRRPVLYEDQWALALVTAIVLLGSIGLVLWAVFG
Ga0334934_000655_5574_56873300034006BiocrustMAPRRPVLFEGQYALALVTVLVLLGSIALVAWVVLGN
Ga0334947_059025_226_3363300034251Sub-Biocrust SoilMAPRRPVLFEGQYALALVTAIVLVGSIAFVAWVYFA
Ga0372943_0225409_827_9373300034268SoilMAPRRPVLYPDQWPLAIFTAIVLVGGIALVVWTIFG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.