Basic Information | |
---|---|
Family ID | F027308 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 195 |
Average Sequence Length | 37 residues |
Representative Sequence | MAPRRPALFPDQYALALVTAIVLLGSIALVLWAVFG |
Number of Associated Samples | 124 |
Number of Associated Scaffolds | 195 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 51.79 % |
% of genes near scaffold ends (potentially truncated) | 10.26 % |
% of genes from short scaffolds (< 2000 bps) | 92.82 % |
Associated GOLD sequencing projects | 120 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.60 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (69.231 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (24.103 % of family members) |
Environment Ontology (ENVO) | Unclassified (25.641 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.667 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.62% β-sheet: 0.00% Coil/Unstructured: 59.38% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.60 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 195 Family Scaffolds |
---|---|---|
PF02771 | Acyl-CoA_dh_N | 61.54 |
PF03741 | TerC | 5.64 |
PF00248 | Aldo_ket_red | 1.54 |
PF03466 | LysR_substrate | 1.54 |
PF00795 | CN_hydrolase | 1.03 |
PF07883 | Cupin_2 | 0.51 |
PF07690 | MFS_1 | 0.51 |
PF04545 | Sigma70_r4 | 0.51 |
PF02737 | 3HCDH_N | 0.51 |
PF05977 | MFS_3 | 0.51 |
COG ID | Name | Functional Category | % Frequency in 195 Family Scaffolds |
---|---|---|---|
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 61.54 |
COG0861 | Tellurite resistance membrane protein TerC | Inorganic ion transport and metabolism [P] | 5.64 |
COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.51 |
COG0287 | Prephenate dehydrogenase | Amino acid transport and metabolism [E] | 0.51 |
COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.51 |
COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.51 |
COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 0.51 |
COG1748 | Saccharopine dehydrogenase, NADP-dependent | Amino acid transport and metabolism [E] | 0.51 |
COG2084 | 3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase | Lipid transport and metabolism [I] | 0.51 |
COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.51 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 69.23 % |
Unclassified | root | N/A | 30.77 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2119805009|FNTS007_GKN1E7E02ILO8S | Not Available | 500 | Open in IMG/M |
3300000033|ICChiseqgaiiDRAFT_c2098337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 576 | Open in IMG/M |
3300001205|C688J13580_1043642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 594 | Open in IMG/M |
3300001686|C688J18823_10083070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2222 | Open in IMG/M |
3300001990|JGI24737J22298_10063392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1110 | Open in IMG/M |
3300004081|Ga0063454_101338672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 602 | Open in IMG/M |
3300005093|Ga0062594_101702733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 659 | Open in IMG/M |
3300005564|Ga0070664_101409626 | Not Available | 659 | Open in IMG/M |
3300005578|Ga0068854_101851554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 554 | Open in IMG/M |
3300005616|Ga0068852_102405950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 547 | Open in IMG/M |
3300005844|Ga0068862_100229164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1685 | Open in IMG/M |
3300006031|Ga0066651_10319972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 832 | Open in IMG/M |
3300006038|Ga0075365_10714132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 708 | Open in IMG/M |
3300006169|Ga0082029_1320080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 634 | Open in IMG/M |
3300006169|Ga0082029_1333616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 2414 | Open in IMG/M |
3300006755|Ga0079222_12586996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 510 | Open in IMG/M |
3300006844|Ga0075428_102264526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 560 | Open in IMG/M |
3300006853|Ga0075420_100394663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1197 | Open in IMG/M |
3300006854|Ga0075425_102901428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 526 | Open in IMG/M |
3300006854|Ga0075425_102914316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 525 | Open in IMG/M |
3300006881|Ga0068865_100698548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 866 | Open in IMG/M |
3300006969|Ga0075419_10854852 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 654 | Open in IMG/M |
3300007004|Ga0079218_11691365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 700 | Open in IMG/M |
3300007004|Ga0079218_12210424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 639 | Open in IMG/M |
3300007790|Ga0105679_10494013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 1461 | Open in IMG/M |
3300007790|Ga0105679_10576603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1088 | Open in IMG/M |
3300009094|Ga0111539_11267490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 856 | Open in IMG/M |
3300009094|Ga0111539_11719014 | Not Available | 728 | Open in IMG/M |
3300009094|Ga0111539_12086637 | Not Available | 658 | Open in IMG/M |
3300009100|Ga0075418_12083073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 618 | Open in IMG/M |
3300009147|Ga0114129_10962616 | Not Available | 1077 | Open in IMG/M |
3300009147|Ga0114129_11159707 | Not Available | 964 | Open in IMG/M |
3300009156|Ga0111538_10768557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1220 | Open in IMG/M |
3300009162|Ga0075423_12426750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 572 | Open in IMG/M |
3300009177|Ga0105248_10740576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1109 | Open in IMG/M |
3300009551|Ga0105238_11235720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 772 | Open in IMG/M |
3300009789|Ga0126307_10278284 | Not Available | 1346 | Open in IMG/M |
3300009789|Ga0126307_10283561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1333 | Open in IMG/M |
3300009789|Ga0126307_10310114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1269 | Open in IMG/M |
3300009789|Ga0126307_10345291 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
3300009789|Ga0126307_10448943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1040 | Open in IMG/M |
3300009789|Ga0126307_10820725 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 751 | Open in IMG/M |
3300009789|Ga0126307_10844065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 739 | Open in IMG/M |
3300009789|Ga0126307_11658754 | Not Available | 519 | Open in IMG/M |
3300009789|Ga0126307_11710284 | Not Available | 511 | Open in IMG/M |
3300009840|Ga0126313_10041647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3202 | Open in IMG/M |
3300009840|Ga0126313_10143320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1797 | Open in IMG/M |
3300009840|Ga0126313_10356898 | Not Available | 1153 | Open in IMG/M |
3300009840|Ga0126313_10875933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 732 | Open in IMG/M |
3300009840|Ga0126313_10985736 | Not Available | 690 | Open in IMG/M |
3300009840|Ga0126313_11350558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 590 | Open in IMG/M |
3300009840|Ga0126313_11533097 | Not Available | 554 | Open in IMG/M |
3300010036|Ga0126305_10852417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 621 | Open in IMG/M |
3300010037|Ga0126304_10849315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 620 | Open in IMG/M |
3300010038|Ga0126315_10847647 | Not Available | 605 | Open in IMG/M |
3300010038|Ga0126315_11144746 | Not Available | 527 | Open in IMG/M |
3300010039|Ga0126309_10044579 | All Organisms → cellular organisms → Bacteria | 2092 | Open in IMG/M |
3300010039|Ga0126309_10059310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1859 | Open in IMG/M |
3300010039|Ga0126309_10072994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1704 | Open in IMG/M |
3300010039|Ga0126309_10091352 | All Organisms → cellular organisms → Bacteria | 1550 | Open in IMG/M |
3300010039|Ga0126309_10118735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1385 | Open in IMG/M |
3300010039|Ga0126309_10240876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1020 | Open in IMG/M |
3300010039|Ga0126309_10314459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 910 | Open in IMG/M |
3300010039|Ga0126309_10663548 | Not Available | 665 | Open in IMG/M |
3300010040|Ga0126308_10153994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1453 | Open in IMG/M |
3300010040|Ga0126308_10292821 | Not Available | 1068 | Open in IMG/M |
3300010040|Ga0126308_10511917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 812 | Open in IMG/M |
3300010041|Ga0126312_10203548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1383 | Open in IMG/M |
3300010042|Ga0126314_10168359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1534 | Open in IMG/M |
3300010042|Ga0126314_10602812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 801 | Open in IMG/M |
3300010042|Ga0126314_10622622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 788 | Open in IMG/M |
3300010044|Ga0126310_10290728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1121 | Open in IMG/M |
3300010044|Ga0126310_10572738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 837 | Open in IMG/M |
3300010045|Ga0126311_10283814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1240 | Open in IMG/M |
3300010045|Ga0126311_10400048 | Not Available | 1057 | Open in IMG/M |
3300010045|Ga0126311_11166759 | Not Available | 636 | Open in IMG/M |
3300010045|Ga0126311_11349782 | Not Available | 594 | Open in IMG/M |
3300010166|Ga0126306_10542028 | Not Available | 923 | Open in IMG/M |
3300010166|Ga0126306_11081138 | Not Available | 656 | Open in IMG/M |
3300010375|Ga0105239_12485064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 604 | Open in IMG/M |
3300010400|Ga0134122_11202003 | Not Available | 759 | Open in IMG/M |
3300012043|Ga0136631_10033197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1896 | Open in IMG/M |
3300012091|Ga0136625_1084440 | Not Available | 1119 | Open in IMG/M |
3300012092|Ga0136621_1066306 | Not Available | 1478 | Open in IMG/M |
3300012186|Ga0136620_10125355 | All Organisms → cellular organisms → Bacteria | 1170 | Open in IMG/M |
3300012358|Ga0137368_10531201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 754 | Open in IMG/M |
3300012403|Ga0134049_1186131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 600 | Open in IMG/M |
3300012407|Ga0134050_1394986 | Not Available | 625 | Open in IMG/M |
3300012469|Ga0150984_116219878 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 5G12 | 1004 | Open in IMG/M |
3300012530|Ga0136635_10159079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 751 | Open in IMG/M |
3300012680|Ga0136612_10016381 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3686 | Open in IMG/M |
3300012911|Ga0157301_10265389 | Not Available | 611 | Open in IMG/M |
3300012915|Ga0157302_10187350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 732 | Open in IMG/M |
3300012939|Ga0162650_100009712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1229 | Open in IMG/M |
3300012960|Ga0164301_11312997 | Not Available | 587 | Open in IMG/M |
3300012977|Ga0134087_10756043 | Not Available | 521 | Open in IMG/M |
3300012985|Ga0164308_10083672 | Not Available | 2190 | Open in IMG/M |
3300012985|Ga0164308_11074688 | Not Available | 719 | Open in IMG/M |
3300012986|Ga0164304_10295976 | Not Available | 1107 | Open in IMG/M |
3300013011|Ga0169967_1018383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1485 | Open in IMG/M |
3300013011|Ga0169967_1026668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1135 | Open in IMG/M |
3300013012|Ga0169965_1073754 | Not Available | 677 | Open in IMG/M |
3300013013|Ga0169969_1029852 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 1343 | Open in IMG/M |
3300013024|Ga0170682_1015587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1786 | Open in IMG/M |
3300013024|Ga0170682_1026739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1209 | Open in IMG/M |
3300013027|Ga0170683_10204194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 508 | Open in IMG/M |
3300013102|Ga0157371_10608247 | Not Available | 813 | Open in IMG/M |
3300013831|Ga0120126_1000815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium | 1382 | Open in IMG/M |
3300014326|Ga0157380_10546743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1135 | Open in IMG/M |
3300017695|Ga0180121_10133314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 904 | Open in IMG/M |
3300017695|Ga0180121_10164365 | Not Available | 816 | Open in IMG/M |
3300017787|Ga0183260_10065358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2675 | Open in IMG/M |
3300017789|Ga0136617_10201309 | Not Available | 1678 | Open in IMG/M |
3300018051|Ga0184620_10087204 | Not Available | 944 | Open in IMG/M |
3300018422|Ga0190265_10093029 | All Organisms → cellular organisms → Bacteria | 2800 | Open in IMG/M |
3300018422|Ga0190265_10606949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1213 | Open in IMG/M |
3300018422|Ga0190265_10741428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1104 | Open in IMG/M |
3300018422|Ga0190265_10743174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1103 | Open in IMG/M |
3300018422|Ga0190265_11489269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 790 | Open in IMG/M |
3300018422|Ga0190265_11503504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 787 | Open in IMG/M |
3300018422|Ga0190265_13824090 | Not Available | 502 | Open in IMG/M |
3300018429|Ga0190272_10349084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1177 | Open in IMG/M |
3300018429|Ga0190272_10499979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1032 | Open in IMG/M |
3300018432|Ga0190275_10075277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2910 | Open in IMG/M |
3300018432|Ga0190275_10212575 | All Organisms → cellular organisms → Bacteria | 1838 | Open in IMG/M |
3300018432|Ga0190275_10811483 | Not Available | 1000 | Open in IMG/M |
3300018432|Ga0190275_11969753 | Not Available | 663 | Open in IMG/M |
3300018432|Ga0190275_12419096 | Not Available | 603 | Open in IMG/M |
3300018432|Ga0190275_13631298 | Not Available | 500 | Open in IMG/M |
3300018465|Ga0190269_11710011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 531 | Open in IMG/M |
3300018466|Ga0190268_11630875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 570 | Open in IMG/M |
3300018469|Ga0190270_10008602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 5623 | Open in IMG/M |
3300018469|Ga0190270_10293627 | Not Available | 1443 | Open in IMG/M |
3300018469|Ga0190270_12146818 | Not Available | 618 | Open in IMG/M |
3300018469|Ga0190270_12210709 | Not Available | 610 | Open in IMG/M |
3300018469|Ga0190270_12735763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 556 | Open in IMG/M |
3300018476|Ga0190274_11825904 | Not Available | 703 | Open in IMG/M |
3300018481|Ga0190271_12386187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 633 | Open in IMG/M |
3300018920|Ga0190273_10403810 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
3300018920|Ga0190273_10893798 | Not Available | 718 | Open in IMG/M |
3300019356|Ga0173481_10203122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 861 | Open in IMG/M |
3300019377|Ga0190264_10808625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 715 | Open in IMG/M |
3300019377|Ga0190264_11006592 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 667 | Open in IMG/M |
3300019377|Ga0190264_11928709 | Not Available | 538 | Open in IMG/M |
3300020181|Ga0196958_10054549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1244 | Open in IMG/M |
3300021445|Ga0182009_10142165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 1134 | Open in IMG/M |
3300022756|Ga0222622_10389792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 979 | Open in IMG/M |
3300025901|Ga0207688_10104281 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1640 | Open in IMG/M |
3300025919|Ga0207657_11267033 | Not Available | 558 | Open in IMG/M |
3300025926|Ga0207659_11723626 | Not Available | 533 | Open in IMG/M |
3300025927|Ga0207687_10606360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 923 | Open in IMG/M |
3300025981|Ga0207640_11680096 | Not Available | 573 | Open in IMG/M |
3300026041|Ga0207639_11966354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 546 | Open in IMG/M |
3300026142|Ga0207698_12397932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 539 | Open in IMG/M |
3300027907|Ga0207428_10839529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 651 | Open in IMG/M |
3300028589|Ga0247818_10969195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 600 | Open in IMG/M |
3300028718|Ga0307307_10109694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 846 | Open in IMG/M |
3300028755|Ga0307316_10169961 | Not Available | 781 | Open in IMG/M |
3300028810|Ga0307294_10385321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 524 | Open in IMG/M |
3300028824|Ga0307310_10385776 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 693 | Open in IMG/M |
3300028875|Ga0307289_10295860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 666 | Open in IMG/M |
3300028880|Ga0307300_10345815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 512 | Open in IMG/M |
3300028881|Ga0307277_10185431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 909 | Open in IMG/M |
3300030006|Ga0299907_10542335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 913 | Open in IMG/M |
3300030336|Ga0247826_10289637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1168 | Open in IMG/M |
3300030336|Ga0247826_10890861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 702 | Open in IMG/M |
3300030336|Ga0247826_11010943 | Not Available | 661 | Open in IMG/M |
3300030336|Ga0247826_11310189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 583 | Open in IMG/M |
3300031164|Ga0307502_10104492 | Not Available | 592 | Open in IMG/M |
3300031184|Ga0307499_10087566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 833 | Open in IMG/M |
3300031229|Ga0299913_10125504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2522 | Open in IMG/M |
3300031229|Ga0299913_10350003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1465 | Open in IMG/M |
3300031229|Ga0299913_10702330 | Not Available | 989 | Open in IMG/M |
3300031229|Ga0299913_10957429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 824 | Open in IMG/M |
3300031450|Ga0272433_10049523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3169 | Open in IMG/M |
3300031731|Ga0307405_11027297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 705 | Open in IMG/M |
3300031740|Ga0307468_100057296 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2079 | Open in IMG/M |
3300031740|Ga0307468_101128404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 701 | Open in IMG/M |
3300031823|Ga0307478_10810231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 784 | Open in IMG/M |
3300031824|Ga0307413_10773006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 805 | Open in IMG/M |
3300031824|Ga0307413_10840535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 775 | Open in IMG/M |
3300031903|Ga0307407_10295164 | Not Available | 1128 | Open in IMG/M |
3300031911|Ga0307412_11018358 | Not Available | 733 | Open in IMG/M |
3300031938|Ga0308175_100586369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1198 | Open in IMG/M |
3300031938|Ga0308175_101746309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 697 | Open in IMG/M |
3300031938|Ga0308175_101887102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 669 | Open in IMG/M |
3300031995|Ga0307409_100381700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1340 | Open in IMG/M |
3300032004|Ga0307414_10868688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 826 | Open in IMG/M |
3300032005|Ga0307411_12316323 | Not Available | 505 | Open in IMG/M |
3300032013|Ga0310906_10790237 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 670 | Open in IMG/M |
3300032080|Ga0326721_10390557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 803 | Open in IMG/M |
3300034003|Ga0334922_041548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 638 | Open in IMG/M |
3300034006|Ga0334934_000655 | Not Available | 7667 | Open in IMG/M |
3300034251|Ga0334947_059025 | Not Available | 782 | Open in IMG/M |
3300034268|Ga0372943_0225409 | Not Available | 1170 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 24.10% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 22.05% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.18% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 5.13% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.62% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 4.10% |
Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Rock | 3.59% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.08% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 2.05% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.54% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.54% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.54% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.54% |
Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 1.54% |
Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 1.03% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.03% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.03% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.03% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.51% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.51% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.51% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.51% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.51% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.51% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.51% |
Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 0.51% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.51% |
Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust | 0.51% |
Hypolithic Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust | 0.51% |
Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.51% |
Rock | Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock | 0.51% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.51% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.51% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.51% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.51% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.51% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.51% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.51% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.51% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.51% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.51% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.51% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2119805009 | Soil microbial communities from sample at FACE Site NTS_007 Nevada Test Site | Environmental | Open in IMG/M |
3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300001205 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Host-Associated | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300007790 | Microbial communities of desert soil contaminated with blood from dead anthrax infected zebra in Etosha National Park, Namibia. Combined Assembly of 14 sequencing projects | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300012043 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ601 (22.06) | Environmental | Open in IMG/M |
3300012091 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ483 (23.06) | Environmental | Open in IMG/M |
3300012092 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ445A (23.06) | Environmental | Open in IMG/M |
3300012186 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ416 (21.06) | Environmental | Open in IMG/M |
3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
3300012403 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012407 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012530 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ85 (21.06) | Environmental | Open in IMG/M |
3300012680 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ224A (23.06) | Environmental | Open in IMG/M |
3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
3300012939 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015 | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300013011 | Gypsum crust endolithic microbial communities from the Atacama Desert, Chile - KM37 | Environmental | Open in IMG/M |
3300013012 | Gypsum rock endolithic microbial communities from the Atacama Desert, Chile - Cordon de Lila | Environmental | Open in IMG/M |
3300013013 | Gypsum rock endolithic microbial communities from the Atacama Desert, Chile - Monturaqui | Environmental | Open in IMG/M |
3300013024 | Gypsum crust hypoendolithic microbial communities from the Atacama Desert, Chile - KM37, HE | Environmental | Open in IMG/M |
3300013027 | Gypsum rock hypoendolithic microbial communities from the Atacama Desert, Chile - Monturaqui | Environmental | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013831 | Permafrost microbial communities from Nunavut, Canada - A21_5cm_6M | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300017695 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ540 (21.06) (version 2) | Environmental | Open in IMG/M |
3300017787 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2) | Environmental | Open in IMG/M |
3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
3300020181 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1+v_10 | Environmental | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
3300031164 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 16_S | Environmental | Open in IMG/M |
3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
3300031450 | Rock endolithic microbial communities from Victoria Land, Antarctica - University Valley sud | Environmental | Open in IMG/M |
3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
3300032080 | Soil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016 | Environmental | Open in IMG/M |
3300034003 | Biocrust microbial communities from Mojave Desert, California, United States - 18HMC | Environmental | Open in IMG/M |
3300034006 | Biocrust microbial communities from Mojave Desert, California, United States - 30SMC | Environmental | Open in IMG/M |
3300034251 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 43SMS | Environmental | Open in IMG/M |
3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FNTS007_04090100 | 2119805009 | Soil | MAPRRPVLYASQYALALVTAIVALGSIGVVIWLLVR |
ICChiseqgaiiDRAFT_20983372 | 3300000033 | Soil | MAPRRPALFPQQYGLALVTAILLLGGLAAVLWFVLG* |
C688J13580_10436422 | 3300001205 | Soil | MAPRRPALFPQQYGLALVTAILLLGGLAVVLWLVLA* |
C688J18823_100830702 | 3300001686 | Soil | MAPRRPVLFEGQYALALVTGLLLVGSIALVAWAVFG* |
JGI24737J22298_100633922 | 3300001990 | Corn Rhizosphere | PGRPVLFPDQYALALVTALVLIASIGLVLWAIFG* |
Ga0063454_1013386722 | 3300004081 | Soil | MRRTMAPRRPLLFTEQYALALVTAIVVVASIAFVIWVVFVSH* |
Ga0062594_1017027332 | 3300005093 | Soil | RRRTMAPGRPALFPDQYALALVTGLVLLASVGLVLWAVFG* |
Ga0070664_1014096262 | 3300005564 | Corn Rhizosphere | MAPGRPALFPDQYALALVTGLVLLASVGLVLWAVFG* |
Ga0068854_1018515542 | 3300005578 | Corn Rhizosphere | MWRRVRRRTMAPRRPVLFPQQYGLALVTALLLLGGLAVVLWLVLG* |
Ga0068852_1024059502 | 3300005616 | Corn Rhizosphere | LRRRTMAPGRPALFPDQYALALVTGLVLLASIALALWAVFG* |
Ga0068862_1002291643 | 3300005844 | Switchgrass Rhizosphere | MAPGRPALFPDQYALALVTVLVLLASVGLVLWAVFG* |
Ga0066651_103199721 | 3300006031 | Soil | MAPSRPAVFPDQWALVVFTAVVLVGSIVLVVWAVFG* |
Ga0075365_107141322 | 3300006038 | Populus Endosphere | MAPRRPALFPQQYGLALVTAILLVGGLAVVLWLALG* |
Ga0082029_13200802 | 3300006169 | Termite Nest | RTMAPRRPVLFPDQYALALVTAIVLIASIALVLWAFFG* |
Ga0082029_13336161 | 3300006169 | Termite Nest | MWRRFRRRTMAPRRPVLFPDQYALALVTAIVLIASVALVLWAFFG* |
Ga0079222_125869961 | 3300006755 | Agricultural Soil | MAPSRPALFPDQWALAIFTAVVLVGSIALVIWAVWG* |
Ga0075428_1022645262 | 3300006844 | Populus Rhizosphere | MAPRRPALFPDQYALALVTAIVLIGSIALVLWAVFG* |
Ga0075420_1003946634 | 3300006853 | Populus Rhizosphere | MAPRRPVLFPDQYALALVTAIVLIASIALVLWAFFG* |
Ga0075425_1029014281 | 3300006854 | Populus Rhizosphere | RRLRRRTMAPSRPALFPDQWALAVFTGIVLVGSIALVVWAVFG* |
Ga0075425_1029143162 | 3300006854 | Populus Rhizosphere | MAPRRPALFPQQYGLALVTAILLLGGLAVVLWFVLG* |
Ga0068865_1006985482 | 3300006881 | Miscanthus Rhizosphere | MWRRVRRRTMAPRRPALFPQQYGLALVTALLLLGGLAVVLWLVLG* |
Ga0075419_108548522 | 3300006969 | Populus Rhizosphere | MAPRRPVLFPDQYALAIVTALVLIGSIALVLWAFFG* |
Ga0079218_116913652 | 3300007004 | Agricultural Soil | MAPRRPVLFPDQWALALVTGIVLVASVVLVAWAFFG* |
Ga0079218_122104242 | 3300007004 | Agricultural Soil | MAPRRPALFPDQYALALVTAIVLIASVALVLWAVFG* |
Ga0105679_104940134 | 3300007790 | Soil | MLRRILRRSMAPRRPLLYEKQYGLALVTAIVVVGSIAVVVLALLT* |
Ga0105679_105766032 | 3300007790 | Soil | MAPTRPVLFPDQWPLAIFTAVLLVGSIALVIWAVFG* |
Ga0111539_112674902 | 3300009094 | Populus Rhizosphere | MAPGRPVLFPDQYALALVTALVLIASIGLVLWAIFG* |
Ga0111539_117190141 | 3300009094 | Populus Rhizosphere | MAPSRPALFPDQYALALVTAIVLIVSIVLVLWAFFG* |
Ga0111539_120866372 | 3300009094 | Populus Rhizosphere | MAPGRPVLFPDQYALAIVTALVLIASIALVLWAFFG* |
Ga0075418_120830731 | 3300009100 | Populus Rhizosphere | MAPSRPALFPDQYALALLTAIVLIVSIVLVLWAFFG* |
Ga0114129_109626162 | 3300009147 | Populus Rhizosphere | MAPSRPALFPDQYALALVTAIVLIVSIVVVLWAFFG* |
Ga0114129_111597072 | 3300009147 | Populus Rhizosphere | MAPRRPALFPDQYALALVTGLLLLGSVALVIWAVFG* |
Ga0111538_107685571 | 3300009156 | Populus Rhizosphere | MAPGRPVLFPDQYALAIVTALVLIASIALVLWAFF |
Ga0075423_124267501 | 3300009162 | Populus Rhizosphere | RRTMAPGRPVLFPDQYALALVTALVLIASIGLVLWAISG* |
Ga0105248_107405762 | 3300009177 | Switchgrass Rhizosphere | MAPRRPVLFPQQYGLALVTALLLLGGLAVVLWLVLG* |
Ga0105238_112357202 | 3300009551 | Corn Rhizosphere | MAPRRPALFPQQYGLALVTAILLLGGLAVVLWVALG* |
Ga0126307_102782842 | 3300009789 | Serpentine Soil | MAPRRPVLFEGQYALALVTAIVLVGSIAFVAWVVLG* |
Ga0126307_102835614 | 3300009789 | Serpentine Soil | MAPSRPVLFPDQYALALVTAIVLIVSIALVLWAFFG* |
Ga0126307_103101142 | 3300009789 | Serpentine Soil | MAPRRPILFPDQWALALVTGIVLVASIALVLWAFFG* |
Ga0126307_103452912 | 3300009789 | Serpentine Soil | MAPRRPALFPGQYALALVTGLLLLASVALAIWAVFG* |
Ga0126307_104489432 | 3300009789 | Serpentine Soil | MAPRRPALFPDQYALAIVTALVLIGSIALVLWAFFG* |
Ga0126307_108207252 | 3300009789 | Serpentine Soil | MAPGRPALFQDQYALALVTAIVLIASIALVLWAFFG* |
Ga0126307_108440652 | 3300009789 | Serpentine Soil | MAPRRPTLLPGQYALALVTALLLLASIGLVIWAVFG* |
Ga0126307_116587542 | 3300009789 | Serpentine Soil | MAPRRPVLFPDQWALALVTGLVLVASIALVLWAFFG* |
Ga0126307_117102842 | 3300009789 | Serpentine Soil | MAPRRPLLFPRQYALAVVTALLLLVGLTLVLWAYFG* |
Ga0126313_100416472 | 3300009840 | Serpentine Soil | MAPGRPAIFPDQYALAIVTALVLIGSIALVLWAILG* |
Ga0126313_101433202 | 3300009840 | Serpentine Soil | MAPRRPVLFPDQYPLAIVTAVVLIASIALVLWAFFG* |
Ga0126313_103568981 | 3300009840 | Serpentine Soil | MAPRRPALFPQQYGLAMVTALLLLGGLAVVLWLVLG* |
Ga0126313_108759331 | 3300009840 | Serpentine Soil | MAPRRPILFPDQWALALVTGMVLVASIALVLWAFFG* |
Ga0126313_109857362 | 3300009840 | Serpentine Soil | MAPRRPVLFEGQYALALVTAIVLLGSIALVAWAVLG* |
Ga0126313_113505582 | 3300009840 | Serpentine Soil | MAPRRPVLFEGQYALALVTVLLLVGSIAFVAWVVLG* |
Ga0126313_115330971 | 3300009840 | Serpentine Soil | MAPRRPVLFEGQYALALVTGLLLVGSIALVAWVVFG |
Ga0126305_108524171 | 3300010036 | Serpentine Soil | MAPRRPALFPQQYGLALVTALLLLGGLAVVLWVVLG* |
Ga0126304_108493152 | 3300010037 | Serpentine Soil | MAPRRPILFPDQYALAIVTALVLIASIALVLWAIVG* |
Ga0126315_108476472 | 3300010038 | Serpentine Soil | MAPSRPALFPDQYALAIVTAIVLVGSIALVVWAVWGS* |
Ga0126315_111447461 | 3300010038 | Serpentine Soil | MAPRRPVLFEGQYALALVTAIVLGGSIAFVAWVVFG* |
Ga0126309_100445792 | 3300010039 | Serpentine Soil | MAPRRPVLFEGQYALALVTALVLAGSIALVAWVLLG* |
Ga0126309_100593104 | 3300010039 | Serpentine Soil | MAPRRPLLYADQVPLAVVTAVVLVGSIALVVWAVFG* |
Ga0126309_100729942 | 3300010039 | Serpentine Soil | MAPRRPLLYEDQWALGLVTAIVLLGSIAFVAWLFLG* |
Ga0126309_100913522 | 3300010039 | Serpentine Soil | MAPRRPLLFPGQYALALVTGIVLLGSIALVAWVVFG* |
Ga0126309_101187352 | 3300010039 | Serpentine Soil | MAPRRPILFPDQWALALVTGLVLVASIALVLWAFFG* |
Ga0126309_102408762 | 3300010039 | Serpentine Soil | MAPRRPLLYADQVPLAVVTGVVLVASIALVAWAVFG* |
Ga0126309_103144592 | 3300010039 | Serpentine Soil | MAPRRPVLFPDQYALAIVTAVVLIASIAFVLWAFFG* |
Ga0126309_106635482 | 3300010039 | Serpentine Soil | MAPRRPVLFEGQYALALVTAIVVVGSIALVAWAVLS* |
Ga0126308_101539942 | 3300010040 | Serpentine Soil | MAPRRPVLFEGQYALALVTGLLLIGSMALVAWAVFG* |
Ga0126308_102928212 | 3300010040 | Serpentine Soil | MAPGRPALFPDQYALAIVTGLVLIGSIALVLWAFFG* |
Ga0126308_105119172 | 3300010040 | Serpentine Soil | MAPRRPVLYEDQWPLAIVTALVLVGSIALVVWAVFG* |
Ga0126312_102035483 | 3300010041 | Serpentine Soil | MAPRRPVLFEGQYALALVTGLLLVGSIALVAWAVLG* |
Ga0126314_101683592 | 3300010042 | Serpentine Soil | MAPRRPVLFEGQYALALVTGLLLVGSIALVAWVVFG* |
Ga0126314_106028122 | 3300010042 | Serpentine Soil | MAPRRPVLFEGQYALALVTALLLIGSIALVAWAVFG* |
Ga0126314_106226222 | 3300010042 | Serpentine Soil | MAPRRPVLFPDQWALALVTGIVLVASIALVLWAFFG* |
Ga0126310_102907282 | 3300010044 | Serpentine Soil | MAPRRPALFPQQYGLAMVTALVLLGGLAVVLWVVLG* |
Ga0126310_105727382 | 3300010044 | Serpentine Soil | MAPSRPALFPDQYALAIVTAIVLIGSIALVVWAVWGS* |
Ga0126311_102838142 | 3300010045 | Serpentine Soil | MAPSRPALFPDQYALALVTAIVLIVSIALVLWAFFG* |
Ga0126311_104000482 | 3300010045 | Serpentine Soil | MAPRRPALFPQQYGLAMVTALLLLGGLAVVLWVVLG* |
Ga0126311_111667592 | 3300010045 | Serpentine Soil | MAPRRPLLFPGQYALALVTAIFLLGSIALVAWVVLG* |
Ga0126311_113497822 | 3300010045 | Serpentine Soil | MAPRRPVLFEGQYALALVTGGLLIGSIALVAWAVFG* |
Ga0126306_105420283 | 3300010166 | Serpentine Soil | MAPRRPLLFRGQYALALVTGLLLMGSVVLVIWAVFG* |
Ga0126306_110811382 | 3300010166 | Serpentine Soil | MAPRRPILYADQWPLALVTAIVLIGSIALVVWAVFG* |
Ga0105239_124850642 | 3300010375 | Corn Rhizosphere | MAPRRPALFPQQYGLALVTALLLLGGLAVVLWLVLG* |
Ga0134122_112020032 | 3300010400 | Terrestrial Soil | RTMAPRRPALFPKQYGLALVTAILLLGGLAVVLWLVLV* |
Ga0136631_100331971 | 3300012043 | Polar Desert Sand | MWRRFRRRSMAPRRPILFPDQWTLAIVTALVLLGSIAFVAWVLLA* |
Ga0136625_10844402 | 3300012091 | Polar Desert Sand | MAPRRPVLFEDQWALALVTALVLVGSIAFVAWIFL* |
Ga0136621_10663063 | 3300012092 | Polar Desert Sand | MAPRRPILFPDQWTLAIVTALVLLGSIAFVAWVLLA* |
Ga0136620_101253553 | 3300012186 | Polar Desert Sand | MAPRRPVLFEGQYSLALVTGLVLVGSVAFVLWIVLG* |
Ga0137368_105312013 | 3300012358 | Vadose Zone Soil | MWRRVRRKTFAPRRPVLFTEQWPLAIVTAVFLIGGIAAIVVALTR* |
Ga0134049_11861312 | 3300012403 | Grasslands Soil | RRPALFEEQYALALLTAIVLVGSIVAVVLVVAHS* |
Ga0134050_13949861 | 3300012407 | Grasslands Soil | LRRRTMAPRRPVLFEGQYALALVTGLVLVGSIALVAWVVFG* |
Ga0150984_1162198783 | 3300012469 | Avena Fatua Rhizosphere | MAPRRPILYEDQWALALVTAIVLVGSIALVVWAVFG* |
Ga0136635_101590792 | 3300012530 | Polar Desert Sand | MAPRRPVLFEGQYALALVTALVLLGSVAVVLWIVL* |
Ga0136612_100163813 | 3300012680 | Polar Desert Sand | MAPRRPVLFEGQYGLALVTALVLVGSVALALWIVLG* |
Ga0157301_102653892 | 3300012911 | Soil | MAPRRPALFPQQYGLALVTAILLLGGLAVVVWFVLG* |
Ga0157302_101873502 | 3300012915 | Soil | MAPRRPALFPQQYALALVTAILLLGGLAVVLWVALG* |
Ga0162650_1000097122 | 3300012939 | Soil | MAPRRPVLFPDQYALAIVTVLVLIGSIALVLWAIFG* |
Ga0164301_113129971 | 3300012960 | Soil | MAPSRPALFPDQWALAIFTAIVLVGSIGLVIWAVFG* |
Ga0134087_107560432 | 3300012977 | Grasslands Soil | MAPRRPVLFEGQYALALVTGLVLIGSIALVVWVVFG* |
Ga0164308_100836724 | 3300012985 | Soil | MAPRRPLLFPGQYALALVTAILLLAGIAIALWVVLG* |
Ga0164308_110746882 | 3300012985 | Soil | MAPRRPLLFPGQYALALVTAILLLAGLAIALWAVLG* |
Ga0164304_102959761 | 3300012986 | Soil | MAPRRPLLFPGQYALALVTAILLLAGLAIVLWALLG* |
Ga0169967_10183833 | 3300013011 | Rock | MAPRRPVLFESQYSLGLVTVLVLLGSIALVGYVLVAN* |
Ga0169967_10266683 | 3300013011 | Rock | MAPRRPVLFEGQYALALVTALVLVGSIALVVYVAAVR* |
Ga0169965_10737542 | 3300013012 | Rock | MAPRRPVLFEGQYGLALVTGLVLLGSIALVVAVVVLS* |
Ga0169969_10298523 | 3300013013 | Rock | MAPRRPVLFEGQVGLALVTGLVLLGSIALAVAVVVLS* |
Ga0170682_10155872 | 3300013024 | Rock | MAPRRPVLFEGQYALALVTALVLLGSIALVVYVAAVR* |
Ga0170682_10267392 | 3300013024 | Rock | MAPRRPVLFESQYSLGLVTVLVLLGSMALVVYVLMAN* |
Ga0170683_102041942 | 3300013027 | Rock | RRLRRRTMAPRRPVLFEGQYGLALVTGLVLLGSIALAVAVVVLS* |
Ga0157371_106082472 | 3300013102 | Corn Rhizosphere | MAPRRPALFPQQYGLALVTALLLLGGLAVVLWFVLG* |
Ga0120126_10008153 | 3300013831 | Permafrost | MAPRRPLLYADQWPLALVTAIVVVASIALVLWAVFGDHQ* |
Ga0157380_105467432 | 3300014326 | Switchgrass Rhizosphere | MAPRRPALFPQQYGLALVTAILLLGGLAVVLWLVLG* |
Ga0180121_101333142 | 3300017695 | Polar Desert Sand | MAPRRPVLFEGQYALALVTALVLLGSIAVVLWIVV |
Ga0180121_101643652 | 3300017695 | Polar Desert Sand | MAPRRPVLFPEQYVLAAVTMIVLIASIVVFFVVLSYR |
Ga0183260_100653582 | 3300017787 | Polar Desert Sand | MAPRRPLLFPDQWALALVTGLVLVGSIALVLWVAFS |
Ga0136617_102013094 | 3300017789 | Polar Desert Sand | MAPRRPVLFEGQYALALVTALVLLGSVAVVLWIAL |
Ga0184620_100872042 | 3300018051 | Groundwater Sediment | MAPRRPALFPQQYGLALVTAILLLGGLAVVLWLVLG |
Ga0190265_100930292 | 3300018422 | Soil | MAPRRPLLFEGQYALALVTAIVLVGSIAFVAWVYFA |
Ga0190265_106069494 | 3300018422 | Soil | MAPRRPILYEDQWALAFVTAVVLVGSIALVAWAVLG |
Ga0190265_107414283 | 3300018422 | Soil | MAPRRPLLYADQVPLAIITGVVLMASIGLVVWVVFSG |
Ga0190265_107431742 | 3300018422 | Soil | MAPRRPILYGDQWPLALVTAIVLVASIALVIWAVFG |
Ga0190265_114892692 | 3300018422 | Soil | MAPRRPLLFPGQYALALVTVIVLVGSVAFVVWAFFA |
Ga0190265_115035042 | 3300018422 | Soil | MAPRRPILFPDQYALAIVTVLVLVASVALVLWAFFG |
Ga0190265_138240902 | 3300018422 | Soil | MAPGRPALFPDQWALALVTGVILLGSIALVAWAAFG |
Ga0190272_103490843 | 3300018429 | Soil | MAPGRPALFPDQWALALVTGLILLGSIALVAWVAFG |
Ga0190272_104999793 | 3300018429 | Soil | MAPRRPILFPDQRALALVTGLVLVASIALVLWAFFA |
Ga0190275_100752774 | 3300018432 | Soil | MAPRRPLLFSGQYALAAVTVILLVGSIAFVAWAVFG |
Ga0190275_102125752 | 3300018432 | Soil | MAPRRPVLFEGQYALALVTAIVLVGSIAFVAWMVFG |
Ga0190275_108114832 | 3300018432 | Soil | MAPRRPILFPDQWALALVTGLVLVGSIALVAWAVFG |
Ga0190275_119697532 | 3300018432 | Soil | APRRPVLFPDQYALALVTALVLIGSIALVLWAFFG |
Ga0190275_124190962 | 3300018432 | Soil | MAPRRPILFPDQWALALVTGLVLVASIVLVLWAFFS |
Ga0190275_136312982 | 3300018432 | Soil | MAPRRPLLFEGQYALALVTAIVLVGSLALVAWVVFG |
Ga0190269_117100111 | 3300018465 | Soil | RRLRRRTMAPSRPALFPDQYALAVVTTIVLIVSIVVVLWAFFG |
Ga0190268_116308752 | 3300018466 | Soil | RRRTMAPRRPVLFPDQYALAIVTALVLIGSIALVLWAFFG |
Ga0190270_100086028 | 3300018469 | Soil | MAPRRPALFPGQYALALVTGLLLLGSVALVIWAVFG |
Ga0190270_102936273 | 3300018469 | Soil | MAPRRPALFPGQYALALVTAILLLGGLAIVLWAYLG |
Ga0190270_121468182 | 3300018469 | Soil | MAPRRPVLFEGQYALALVTAIVLVGSIALVFWVVLG |
Ga0190270_122107092 | 3300018469 | Soil | MAPRRPLLFEGQYALALVTAIVLVGSIGFVVWVFLG |
Ga0190270_127357632 | 3300018469 | Soil | MAPRRPVLFDGQYALALVTAIVLVGSLALVAWVVFG |
Ga0190274_118259041 | 3300018476 | Soil | MAPRRPVLFEGQYALALVTAVVLVGSLALVAWVVLG |
Ga0190271_123861872 | 3300018481 | Soil | MWRRVRRRTMAPRRPVLFPGQYALALVTAILLLGSVALVLWAVLG |
Ga0190273_104038101 | 3300018920 | Soil | MAPRRPLLFSGQYALAAVTAILLVGSIAFVAWAVFG |
Ga0190273_108937982 | 3300018920 | Soil | MAPRRPVLFEQQYTLALVTAIVLVGSIGFAVWALLQ |
Ga0173481_102031222 | 3300019356 | Soil | MWRRVRRRTMAPRRPALFPQQYGLALVTAILLLGGLAAVLWFVLG |
Ga0190264_108086252 | 3300019377 | Soil | MAPRRPVLFPDQYALAIVTVLVLIGSIALVLWAIFG |
Ga0190264_110065922 | 3300019377 | Soil | MAPRRPLLYEGQYGLAVVTAVVLLASVYLAIRAVL |
Ga0190264_119287092 | 3300019377 | Soil | MAPRRPLLFPGQYALALASAIVLVGSIALVAWVVLG |
Ga0196958_100545491 | 3300020181 | Soil | MAPGRPALFPDQFALAIVTALVLIGSIVLVLWAFLG |
Ga0182009_101421652 | 3300021445 | Soil | MAPRRPALFPQQYALALVTAILLLGGLAVVLWVALG |
Ga0222622_103897923 | 3300022756 | Groundwater Sediment | MWRRVRRRTMAPRRPALFPQQYGLALVTAILLLGGLAVVLWLVLG |
Ga0207688_101042814 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MAPGRPALFPDQYALALVTGLVLLASVGLVLWAVFG |
Ga0207657_112670332 | 3300025919 | Corn Rhizosphere | MAPRRPALFPQQYGLALVTAILLLGGLAAVLWFVLG |
Ga0207659_117236262 | 3300025926 | Miscanthus Rhizosphere | MAPGRPALFPDQYALALVTVLVLLASVGLVLWAVFG |
Ga0207687_106063602 | 3300025927 | Miscanthus Rhizosphere | MAPRRPVLFPDQYALALVTALVLIASIGLVLWAIFG |
Ga0207640_116800961 | 3300025981 | Corn Rhizosphere | MAPRRPVLFEGQYALALVTGLVLVGSIALVVWVVFG |
Ga0207639_119663542 | 3300026041 | Corn Rhizosphere | MAPRRPALFPQQYGLALVTAILLLGGLAVVLWVALG |
Ga0207698_123979322 | 3300026142 | Corn Rhizosphere | MAPRRPVLFPDQYALAIVTALVLIASIALVVWAFFG |
Ga0207428_108395292 | 3300027907 | Populus Rhizosphere | MAPRRPVLFPDQYALALVTVVVLLASIALVLWAVFG |
Ga0247818_109691952 | 3300028589 | Soil | MAPSRPALFPDQYALALVTAIVLIVSIVLVLWAFFG |
Ga0307307_101096942 | 3300028718 | Soil | MAPRRPLLYPGQYALALVTAILLLAGVAIALWIVLG |
Ga0307316_101699612 | 3300028755 | Soil | MAPSRPAVFPDQWALVIVTAIVLIASIALVLWAFFG |
Ga0307294_103853212 | 3300028810 | Soil | MAPRRPALFPQQYGLALVTAILLLGGLAVVLWVVLG |
Ga0307310_103857762 | 3300028824 | Soil | MAPRRPVLFEGQYALALVTAILMICSIAFVAWVVFR |
Ga0307289_102958601 | 3300028875 | Soil | RRRTMAPRRPALFPQQYGLALVTALLLLGGLAVVLWLVLG |
Ga0307300_103458152 | 3300028880 | Soil | MAPRRPALFPQQYGLALVTALLLFAGLAVVLWLVLG |
Ga0307277_101854312 | 3300028881 | Soil | MAPSRPALFPDQWPLAIVTAVFVVGSIALVVWAVFG |
Ga0299907_105423353 | 3300030006 | Soil | MAPRRPLLFASQYALALVTAILLLGSVALVLWAAFG |
Ga0247826_102896372 | 3300030336 | Soil | MAPSRPALFPDQYALAIVTAIVLIVSIVLVLWAFFG |
Ga0247826_108908611 | 3300030336 | Soil | MWRRVRRRTMAPRRPVLFPGQYALALLTAILLVGSVALVLWAVLG |
Ga0247826_110109432 | 3300030336 | Soil | MRWKRRTMAPRRPILFVEQYALALVTAVVLIGSAAFALWVVFH |
Ga0247826_113101891 | 3300030336 | Soil | APSRPALFPDQYALALVTAIVLIVSIVLVLWAFFG |
Ga0307502_101044922 | 3300031164 | Soil | MAPRRPVLFEGQYALALVTALVMVGSIAFVAWVVFG |
Ga0307499_100875662 | 3300031184 | Soil | MAPRRPLLFPGQYALALVTGIVLVGSIALAIWAIFG |
Ga0299913_101255044 | 3300031229 | Soil | MAPRRPLLFASQYALALVTAILLLGSVALVLWATFG |
Ga0299913_103500032 | 3300031229 | Soil | MAPRRPVLFPDQYALAIVTALVLVASIALVLWAFLG |
Ga0299913_107023301 | 3300031229 | Soil | RLRRRTMAPSRPAVFPDQWALLIVTALVLIVSIALTLWAIFG |
Ga0299913_109574293 | 3300031229 | Soil | MAPSRPAVFPDQWALLIVTALVLIVSIALTLWAIFG |
Ga0272433_100495232 | 3300031450 | Rock | MAPRRPILFEQQYGLALLTAILLVAGVGAILWLLVSA |
Ga0307405_110272972 | 3300031731 | Rhizosphere | MAPRRPALFPDQYALALVTGIVLIGSIALVLWAVLG |
Ga0307468_1000572963 | 3300031740 | Hardwood Forest Soil | MAPRRPALFPQQYGLALVTAILLLGGLAVVLWFVLG |
Ga0307468_1011284042 | 3300031740 | Hardwood Forest Soil | MWPRVRRRTMAPRRPLLFPRQYALALLTGVLLVGSIALAIWAIFG |
Ga0307478_108102312 | 3300031823 | Hardwood Forest Soil | MGPRRPPLQPHQYGLALVTAIVLVGSIVAVALITLR |
Ga0307413_107730062 | 3300031824 | Rhizosphere | MAPRRPVLFPDQYALALVTAIVLIASIALVLWAFFG |
Ga0307413_108405352 | 3300031824 | Rhizosphere | MAPGRPALFPDQYALAIVTGLVLIGSIALVLWAFFG |
Ga0307407_102951642 | 3300031903 | Rhizosphere | MAPRRPVLFPDQYALAIVTGLVLIGSIVLVLWAIFG |
Ga0307412_110183582 | 3300031911 | Rhizosphere | MAPGRPALFPDQYALAIVTGLVLIGSIALVFWAIFG |
Ga0308175_1005863692 | 3300031938 | Soil | MAPRRPVLFPDQYALAIVTALVLIASIALVLWAFFG |
Ga0308175_1017463091 | 3300031938 | Soil | MAPSRPALFPDQWALAIFTAVVLVASIALVIWAVWG |
Ga0308175_1018871022 | 3300031938 | Soil | MAPRRPALFPQQYGLALVTAILLLGGLALVLWLVLG |
Ga0307409_1003817002 | 3300031995 | Rhizosphere | MAPRRPVLFPDQYALAIVTAVVLIASIALVLWAFFG |
Ga0307414_108686881 | 3300032004 | Rhizosphere | MAPRRPALFPDQYALALVTGIVLIGSIALVLWAVFG |
Ga0307411_123163232 | 3300032005 | Rhizosphere | MAPRRPALFPDQYALALVTAIVLLGSIALVLWAVFG |
Ga0310906_107902372 | 3300032013 | Soil | MAPRRPALFPQQYGLALVTAILLLGGLVLVLWLALG |
Ga0326721_103905571 | 3300032080 | Soil | MAPGRPALFPDQYGLAIVTGLVLLASIALVIWAVFG |
Ga0334922_041548_500_610 | 3300034003 | Hypolithic Biocrust | MAPRRPVLYEDQWALALVTAIVLLGSIGLVLWAVFG |
Ga0334934_000655_5574_5687 | 3300034006 | Biocrust | MAPRRPVLFEGQYALALVTVLVLLGSIALVAWVVLGN |
Ga0334947_059025_226_336 | 3300034251 | Sub-Biocrust Soil | MAPRRPVLFEGQYALALVTAIVLVGSIAFVAWVYFA |
Ga0372943_0225409_827_937 | 3300034268 | Soil | MAPRRPVLYPDQWPLAIFTAIVLVGGIALVVWTIFG |
⦗Top⦘ |