Metagenome Family F026952

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F026952
Family Type	Metagenome
Number of Sequences	196
Average Sequence Length	38 residues
Representative Sequence	MPETSAYYHLAYTIALGIYAAYALSLYLRRKRVRAK
Number of Associated Samples	151
Number of Associated Scaffolds	196

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	68.88 %
% of genes near scaffold ends (potentially truncated)	11.73 %
% of genes from short scaffolds (< 2000 bps)	75.51 %
Associated GOLD sequencing projects	143
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.52

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (91.837 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (25.000 % of family members)
Environment Ontology (ENVO)	Unclassified (42.347 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (39.286 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 51.56% β-sheet: 0.00% Coil/Unstructured: 48.44%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.52
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.52
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 196 Family Scaffolds
PF01578	Cytochrom_C_asm	42.35
PF03379	CcmB	6.63
PF00590	TP_methylase	6.12
PF02602	HEM4	2.55
PF00005	ABC_tran	2.55
PF03900	Porphobil_deamC	1.53
PF16177	ACAS_N	1.53
PF01379	Porphobil_deam	1.02
PF01804	Penicil_amidase	0.51
PF01040	UbiA	0.51
PF13197	DUF4013	0.51
PF08264	Anticodon_1	0.51
PF12625	Arabinose_bd	0.51
PF14019	DUF4235	0.51

COG ID	Name	Functional Category	% Frequency in 196 Family Scaffolds
COG2386	ABC-type transport system involved in cytochrome c biogenesis, permease component	Posttranslational modification, protein turnover, chaperones [O]	6.63
COG0181	Porphobilinogen deaminase	Coenzyme transport and metabolism [H]	2.55
COG1587	Uroporphyrinogen-III synthase	Coenzyme transport and metabolism [H]	2.55
COG2366	Acyl-homoserine lactone (AHL) acylase PvdQ	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.51

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	91.84 %
Unclassified	root	N/A	8.16 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	91.84 %
Unclassified	root	N/A	8.16 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	91.84 %
Unclassified	root	N/A	8.16 %

Name	Rank	Taxonomy	Distribution
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	44.90 %
Unclassified	root	N/A	8.16 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.51 %

Name	Rank	Taxonomy	Distribution
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	44.90 %
Unclassified	root	N/A	8.16 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.51 %

Name	Rank	Taxonomy	Distribution
Gemmatimonadetes	class	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes	23.98 %
Unclassified	root	N/A	8.16 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.51 %

Name	Rank	Taxonomy	Distribution
Gemmatimonadales	order	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales	23.98 %
Unclassified	root	N/A	8.16 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.51 %

Name	Rank	Taxonomy	Distribution
Gemmatimonadaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae	23.98 %
Unclassified	root	N/A	8.16 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.51 %

Name	Rank	Taxonomy	Distribution
unclassified Gemmatimonadaceae	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae	15.82 %
Unclassified	root	N/A	8.16 %
Gemmatirosa	genus	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa	4.59 %
Gemmatimonas	genus	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas	0.51 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.51 %

Name	Rank	Taxonomy	Distribution
Gemmatimonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	15.82 %
Unclassified	root	N/A	8.16 %
Gemmatirosa kalamazoonesis	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	4.59 %
Gemmatimonas aurantiaca	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca	0.51 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.51 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2088090004\|P1_DRAFT_NODE_17048_len_2356_cov_12_833192	All Organisms → cellular organisms → Bacteria	2406	Open in IMG/M
2124908032\|Perma_A_C_ConsensusfromContig113576	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	1205	Open in IMG/M
2140918007\|ConsensusfromContig29532	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	1050	Open in IMG/M
2140918007\|ConsensusfromContig53486	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	638	Open in IMG/M
3300000878\|AL9A1W_1028302	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca	4565	Open in IMG/M
3300000887\|AL16A1W_10030693	All Organisms → cellular organisms → Bacteria	1907	Open in IMG/M
3300000956\|JGI10216J12902_103449007	All Organisms → cellular organisms → Bacteria	500	Open in IMG/M
3300001305\|C688J14111_10255566	All Organisms → cellular organisms → Bacteria	550	Open in IMG/M
3300001537\|A2065W1_11302282	All Organisms → cellular organisms → Bacteria	536	Open in IMG/M
3300001565\|A35518A_1071168	All Organisms → cellular organisms → Bacteria	1770	Open in IMG/M
3300001664\|P5cmW16_1037790	All Organisms → cellular organisms → Bacteria	879	Open in IMG/M
3300002907\|JGI25613J43889_10013662	All Organisms → cellular organisms → Bacteria	2260	Open in IMG/M
3300004114\|Ga0062593_100620274	All Organisms → cellular organisms → Bacteria	1036	Open in IMG/M
3300004114\|Ga0062593_101170162	All Organisms → cellular organisms → Bacteria	804	Open in IMG/M
3300005328\|Ga0070676_10233699	All Organisms → cellular organisms → Bacteria	1219	Open in IMG/M
3300005337\|Ga0070682_100446298	All Organisms → cellular organisms → Bacteria	989	Open in IMG/M
3300005344\|Ga0070661_101578602	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	554	Open in IMG/M
3300005345\|Ga0070692_10062592	All Organisms → cellular organisms → Bacteria	1964	Open in IMG/M
3300005364\|Ga0070673_100982500	All Organisms → cellular organisms → Bacteria	785	Open in IMG/M
3300005406\|Ga0070703_10489867	All Organisms → cellular organisms → Bacteria	551	Open in IMG/M
3300005440\|Ga0070705_101209491	All Organisms → cellular organisms → Bacteria	623	Open in IMG/M
3300005441\|Ga0070700_101162446	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	643	Open in IMG/M
3300005458\|Ga0070681_10970806	All Organisms → cellular organisms → Bacteria	769	Open in IMG/M
3300005467\|Ga0070706_100255461	All Organisms → cellular organisms → Bacteria	1636	Open in IMG/M
3300005530\|Ga0070679_100171017	All Organisms → cellular organisms → Bacteria	2146	Open in IMG/M
3300005564\|Ga0070664_100288055	All Organisms → cellular organisms → Bacteria	1482	Open in IMG/M
3300005575\|Ga0066702_10290079	Not Available	998	Open in IMG/M
3300005575\|Ga0066702_10290102	All Organisms → cellular organisms → Bacteria	998	Open in IMG/M
3300005598\|Ga0066706_10147615	All Organisms → cellular organisms → Bacteria	1765	Open in IMG/M
3300005718\|Ga0068866_10018621	All Organisms → cellular organisms → Bacteria	3144	Open in IMG/M
3300005873\|Ga0075287_1004952	All Organisms → cellular organisms → Bacteria	1581	Open in IMG/M
3300005886\|Ga0075286_1067680	All Organisms → cellular organisms → Bacteria	520	Open in IMG/M
3300006031\|Ga0066651_10027513	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	2515	Open in IMG/M
3300006175\|Ga0070712_100694050	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	867	Open in IMG/M
3300006791\|Ga0066653_10613818	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	553	Open in IMG/M
3300006800\|Ga0066660_10234582	All Organisms → cellular organisms → Bacteria	1424	Open in IMG/M
3300006894\|Ga0079215_10006904	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	3281	Open in IMG/M
3300007819\|Ga0104322_145604	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	4584	Open in IMG/M
3300007820\|Ga0104324_105926	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	1100	Open in IMG/M
3300007820\|Ga0104324_120209	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	1530	Open in IMG/M
3300007821\|Ga0104323_125340	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	1977	Open in IMG/M
3300009012\|Ga0066710_101499722	All Organisms → cellular organisms → Bacteria	1040	Open in IMG/M
3300009012\|Ga0066710_102589799	All Organisms → cellular organisms → Bacteria	730	Open in IMG/M
3300009038\|Ga0099829_10253519	All Organisms → cellular organisms → Bacteria	1435	Open in IMG/M
3300009090\|Ga0099827_10049104	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae	3163	Open in IMG/M
3300009098\|Ga0105245_10382174	All Organisms → cellular organisms → Bacteria	1402	Open in IMG/M
3300009137\|Ga0066709_100870661	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	1311	Open in IMG/M
3300009137\|Ga0066709_101635376	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	919	Open in IMG/M
3300009143\|Ga0099792_10021205	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	2899	Open in IMG/M
3300009143\|Ga0099792_10142069	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	1313	Open in IMG/M
3300009143\|Ga0099792_10505871	All Organisms → cellular organisms → Bacteria	757	Open in IMG/M
3300009143\|Ga0099792_10528856	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	742	Open in IMG/M
3300010403\|Ga0134123_10046508	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	3245	Open in IMG/M
3300011227\|Ga0137475_103385	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	943	Open in IMG/M
3300011414\|Ga0137442_1041062	All Organisms → cellular organisms → Bacteria	907	Open in IMG/M
3300011987\|Ga0120164_1001537	All Organisms → cellular organisms → Bacteria	7015	Open in IMG/M
3300011987\|Ga0120164_1051279	All Organisms → cellular organisms → Bacteria	598	Open in IMG/M
3300011991\|Ga0120153_1003465	All Organisms → cellular organisms → Bacteria	5636	Open in IMG/M
3300011992\|Ga0120146_1014789	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1551	Open in IMG/M
3300011992\|Ga0120146_1051462	All Organisms → cellular organisms → Bacteria	684	Open in IMG/M
3300011998\|Ga0120114_1006883	All Organisms → cellular organisms → Bacteria	2740	Open in IMG/M
3300011999\|Ga0120148_1000103	All Organisms → cellular organisms → Bacteria	36664	Open in IMG/M
3300011999\|Ga0120148_1025088	Not Available	1311	Open in IMG/M
3300012004\|Ga0120134_1011572	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	1349	Open in IMG/M
3300012010\|Ga0120118_1063274	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	919	Open in IMG/M
3300012019\|Ga0120139_1000594	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	11722	Open in IMG/M
3300012043\|Ga0136631_10007309	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	3803	Open in IMG/M
3300012198\|Ga0137364_10005314	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	6871	Open in IMG/M
3300012198\|Ga0137364_10246138	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	1320	Open in IMG/M
3300012200\|Ga0137382_10019937	All Organisms → cellular organisms → Bacteria	3826	Open in IMG/M
3300012202\|Ga0137363_10042155	All Organisms → cellular organisms → Bacteria	3221	Open in IMG/M
3300012203\|Ga0137399_10113046	All Organisms → cellular organisms → Bacteria	2121	Open in IMG/M
3300012203\|Ga0137399_10203894	All Organisms → cellular organisms → Bacteria	1606	Open in IMG/M
3300012205\|Ga0137362_11152387	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	658	Open in IMG/M
3300012205\|Ga0137362_11732404	All Organisms → cellular organisms → Bacteria	512	Open in IMG/M
3300012206\|Ga0137380_10114067	All Organisms → cellular organisms → Bacteria	2468	Open in IMG/M
3300012206\|Ga0137380_10769095	All Organisms → cellular organisms → Bacteria	833	Open in IMG/M
3300012207\|Ga0137381_10207879	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	1697	Open in IMG/M
3300012208\|Ga0137376_10195517	All Organisms → cellular organisms → Bacteria	1749	Open in IMG/M
3300012208\|Ga0137376_10428120	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	1149	Open in IMG/M
3300012209\|Ga0137379_10844118	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	820	Open in IMG/M
3300012211\|Ga0137377_10050483	All Organisms → cellular organisms → Bacteria	3842	Open in IMG/M
3300012211\|Ga0137377_11198620	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	689	Open in IMG/M
3300012211\|Ga0137377_11293183	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	659	Open in IMG/M
3300012285\|Ga0137370_10995139	All Organisms → cellular organisms → Bacteria	516	Open in IMG/M
3300012356\|Ga0137371_10074231	All Organisms → cellular organisms → Bacteria	2635	Open in IMG/M
3300012357\|Ga0137384_11329379	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	566	Open in IMG/M
3300012530\|Ga0136635_10029974	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1615	Open in IMG/M
3300012530\|Ga0136635_10128445	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	825	Open in IMG/M
3300012685\|Ga0137397_10489471	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	916	Open in IMG/M
3300012918\|Ga0137396_10808553	All Organisms → cellular organisms → Bacteria	689	Open in IMG/M
3300012927\|Ga0137416_10321249	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1289	Open in IMG/M
3300012951\|Ga0164300_10488412	All Organisms → cellular organisms → Bacteria	701	Open in IMG/M
3300012958\|Ga0164299_11341935	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	549	Open in IMG/M
3300012961\|Ga0164302_11802612	All Organisms → cellular organisms → Bacteria	517	Open in IMG/M
3300013296\|Ga0157374_11813738	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	635	Open in IMG/M
3300013297\|Ga0157378_10026888	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae	5074	Open in IMG/M
3300013297\|Ga0157378_10781600	All Organisms → cellular organisms → Bacteria	979	Open in IMG/M
3300013297\|Ga0157378_12579455	All Organisms → cellular organisms → Bacteria	560	Open in IMG/M
3300013503\|Ga0120127_10000190	All Organisms → cellular organisms → Bacteria	14558	Open in IMG/M
3300013764\|Ga0120111_1027445	Not Available	1546	Open in IMG/M
3300013772\|Ga0120158_10109480	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1633	Open in IMG/M
3300014052\|Ga0120109_1122871	All Organisms → cellular organisms → Bacteria	604	Open in IMG/M
3300014058\|Ga0120149_1170539	Not Available	604	Open in IMG/M
3300015076\|Ga0167656_1013899	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	965	Open in IMG/M
3300015192\|Ga0167646_1001644	All Organisms → cellular organisms → Bacteria	7962	Open in IMG/M
3300015195\|Ga0167658_1066068	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	851	Open in IMG/M
3300015209\|Ga0167629_1024730	All Organisms → cellular organisms → Bacteria	2167	Open in IMG/M
3300015371\|Ga0132258_10528904	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	2952	Open in IMG/M
3300015371\|Ga0132258_12978188	Not Available	1175	Open in IMG/M
3300017789\|Ga0136617_10042356	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	4041	Open in IMG/M
3300018027\|Ga0184605_10317459	Not Available	705	Open in IMG/M
3300018027\|Ga0184605_10366634	All Organisms → cellular organisms → Bacteria	650	Open in IMG/M
3300018053\|Ga0184626_10098624	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	1238	Open in IMG/M
3300018061\|Ga0184619_10182128	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	964	Open in IMG/M
3300018066\|Ga0184617_1034504	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	1218	Open in IMG/M
3300018071\|Ga0184618_10222220	Not Available	794	Open in IMG/M
3300018422\|Ga0190265_10002082	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae	13329	Open in IMG/M
3300018429\|Ga0190272_10259409	Not Available	1312	Open in IMG/M
3300018429\|Ga0190272_10295232	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1251	Open in IMG/M
3300018429\|Ga0190272_10301088	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1242	Open in IMG/M
3300018429\|Ga0190272_11677145	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	656	Open in IMG/M
3300018432\|Ga0190275_10045058	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae	3650	Open in IMG/M
3300018432\|Ga0190275_11508462	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	750	Open in IMG/M
3300019865\|Ga0193748_1001500	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1538	Open in IMG/M
3300019869\|Ga0193705_1047599	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	891	Open in IMG/M
3300019870\|Ga0193746_1033210	All Organisms → cellular organisms → Bacteria	522	Open in IMG/M
3300019887\|Ga0193729_1011911	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	3902	Open in IMG/M
3300019887\|Ga0193729_1012389	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	3824	Open in IMG/M
3300019887\|Ga0193729_1070956	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1374	Open in IMG/M
3300019888\|Ga0193751_1006956	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae	6202	Open in IMG/M
3300019890\|Ga0193728_1289939	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	629	Open in IMG/M
3300020002\|Ga0193730_1020295	All Organisms → cellular organisms → Bacteria	1915	Open in IMG/M
3300020002\|Ga0193730_1128666	All Organisms → cellular organisms → Bacteria	688	Open in IMG/M
3300020006\|Ga0193735_1011210	All Organisms → cellular organisms → Bacteria	2823	Open in IMG/M
3300020010\|Ga0193749_1019659	Not Available	1322	Open in IMG/M
3300020012\|Ga0193732_1050780	Not Available	706	Open in IMG/M
3300020022\|Ga0193733_1013349	All Organisms → cellular organisms → Bacteria	2312	Open in IMG/M
3300020022\|Ga0193733_1027589	All Organisms → cellular organisms → Bacteria	1605	Open in IMG/M
3300020059\|Ga0193745_1007645	All Organisms → cellular organisms → Bacteria	2312	Open in IMG/M
3300020059\|Ga0193745_1091607	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	654	Open in IMG/M
3300021339\|Ga0193706_1075179	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	925	Open in IMG/M
3300021339\|Ga0193706_1138503	All Organisms → cellular organisms → Bacteria	663	Open in IMG/M
3300021363\|Ga0193699_10005786	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	4449	Open in IMG/M
3300021363\|Ga0193699_10053797	All Organisms → cellular organisms → Bacteria	1562	Open in IMG/M
3300021363\|Ga0193699_10204675	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	819	Open in IMG/M
3300021363\|Ga0193699_10245827	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	745	Open in IMG/M
3300021411\|Ga0193709_1011354	All Organisms → cellular organisms → Bacteria	2209	Open in IMG/M
3300021413\|Ga0193750_1020033	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	1606	Open in IMG/M
3300025544\|Ga0208078_1128234	All Organisms → cellular organisms → Bacteria	503	Open in IMG/M
3300025899\|Ga0207642_10059609	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1766	Open in IMG/M
3300025899\|Ga0207642_10441812	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	786	Open in IMG/M
3300025903\|Ga0207680_11372037	Not Available	502	Open in IMG/M
3300025906\|Ga0207699_10403603	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	974	Open in IMG/M
3300025906\|Ga0207699_10812629	All Organisms → cellular organisms → Bacteria	688	Open in IMG/M
3300025907\|Ga0207645_10380453	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	947	Open in IMG/M
3300025912\|Ga0207707_10003819	All Organisms → cellular organisms → Bacteria	13344	Open in IMG/M
3300025918\|Ga0207662_10032735	All Organisms → cellular organisms → Bacteria	3028	Open in IMG/M
3300025923\|Ga0207681_10514361	Not Available	982	Open in IMG/M
3300025933\|Ga0207706_10069942	All Organisms → cellular organisms → Bacteria	3087	Open in IMG/M
3300025942\|Ga0207689_11715732	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	520	Open in IMG/M
3300025944\|Ga0207661_10212526	All Organisms → cellular organisms → Bacteria	1706	Open in IMG/M
3300025944\|Ga0207661_10379535	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	1279	Open in IMG/M
3300026075\|Ga0207708_10045317	All Organisms → cellular organisms → Bacteria	3351	Open in IMG/M
3300026089\|Ga0207648_10296211	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1450	Open in IMG/M
3300026300\|Ga0209027_1023048	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	2358	Open in IMG/M
3300026320\|Ga0209131_1016635	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	4478	Open in IMG/M
3300027378\|Ga0209981_1036748	All Organisms → cellular organisms → Bacteria	727	Open in IMG/M
3300027565\|Ga0209219_1018666	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1684	Open in IMG/M
3300027587\|Ga0209220_1157895	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	585	Open in IMG/M
3300027591\|Ga0209733_1103574	All Organisms → cellular organisms → Bacteria	716	Open in IMG/M
3300027645\|Ga0209117_1086844	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	869	Open in IMG/M
3300027846\|Ga0209180_10665388	All Organisms → cellular organisms → Bacteria → Proteobacteria	569	Open in IMG/M
3300027882\|Ga0209590_10206404	All Organisms → cellular organisms → Bacteria	1243	Open in IMG/M
3300027886\|Ga0209486_10626188	All Organisms → cellular organisms → Bacteria	685	Open in IMG/M
3300027903\|Ga0209488_10269259	All Organisms → cellular organisms → Bacteria	1275	Open in IMG/M
3300027903\|Ga0209488_10886201	All Organisms → cellular organisms → Bacteria	626	Open in IMG/M
3300028715\|Ga0307313_10187635	All Organisms → cellular organisms → Bacteria	641	Open in IMG/M
3300028768\|Ga0307280_10050575	All Organisms → cellular organisms → Bacteria	1298	Open in IMG/M
3300028784\|Ga0307282_10664739	Not Available	505	Open in IMG/M
3300028810\|Ga0307294_10425156	All Organisms → cellular organisms → Bacteria	503	Open in IMG/M
3300028814\|Ga0307302_10153612	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	1116	Open in IMG/M
3300028824\|Ga0307310_10010133	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae	3589	Open in IMG/M
3300028824\|Ga0307310_10087264	All Organisms → cellular organisms → Bacteria	1367	Open in IMG/M
3300028828\|Ga0307312_10201227	Not Available	1279	Open in IMG/M
3300028828\|Ga0307312_10899647	All Organisms → cellular organisms → Bacteria	586	Open in IMG/M
3300028881\|Ga0307277_10237310	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	803	Open in IMG/M
3300028884\|Ga0307308_10120880	Not Available	1250	Open in IMG/M
3300031538\|Ga0310888_10464431	All Organisms → cellular organisms → Bacteria	752	Open in IMG/M
3300031740\|Ga0307468_101423148	All Organisms → cellular organisms → Bacteria	638	Open in IMG/M
3300031740\|Ga0307468_102115850	All Organisms → cellular organisms → Bacteria	542	Open in IMG/M
3300032180\|Ga0307471_100462958	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	1410	Open in IMG/M
3300032205\|Ga0307472_100384502	All Organisms → cellular organisms → Bacteria	1167	Open in IMG/M
3300034125\|Ga0370484_0001624	Not Available	4086	Open in IMG/M
3300034268\|Ga0372943_0439403	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	846	Open in IMG/M
3300034268\|Ga0372943_1180397	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	512	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	89.29%
Host-Associated	Host-Associated	10.71%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	83.67%
Plants	Host-Associated → Plants	10.71%
Aquatic	Environmental → Aquatic	5.61%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	83.67%
Rhizosphere	Host-Associated → Plants → Rhizosphere	6.63%
Rhizoplane	Host-Associated → Plants → Rhizoplane	4.08%
Sediment	Environmental → Aquatic → Sediment	3.57%
Freshwater	Environmental → Aquatic → Freshwater	2.04%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	71.43%
Loam	Environmental → Terrestrial → Soil → Loam	10.71%
Soil	Host-Associated → Plants → Rhizosphere → Soil	4.08%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	3.57%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	3.06%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	2.55%
Ice	Environmental → Aquatic → Freshwater → Ice	2.04%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	1.53%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.02%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	45.41%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	13.27%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	8.16%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	7.14%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	4.08%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	3.57%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	3.06%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	3.06%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	2.55%
Unclassified	Environmental → Aquatic → Freshwater → Ice → Unclassified	2.04%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	2.04%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	2.04%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	1.53%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.02%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.51%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.51%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	25.00%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	16.84%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost	10.71%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	4.59%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	3.57%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	3.57%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	3.06%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	3.06%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	2.55%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	2.55%
Polar Desert Sand	Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand	2.04%
Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil	2.04%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	2.04%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	2.04%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.04%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	1.53%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	1.53%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	1.02%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.02%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.02%
Rice Paddy Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil	1.02%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.02%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	1.02%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	0.51%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.51%
Permafrost Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Permafrost Soil	0.51%
Arctic Peat Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil	0.51%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.51%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	0.51%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.51%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.51%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	0.51%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.51%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2088090004	Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P1	Environmental	Open in IMG/M
2124908032	Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Perma_all	Environmental	Open in IMG/M
2140918007	Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_all	Environmental	Open in IMG/M
3300000878	Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-5 cm-9A)- 1 week illumina	Environmental	Open in IMG/M
3300000887	Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-65cm-16A)- 1 week illumina	Environmental	Open in IMG/M
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental	Open in IMG/M
3300001305	Grasslands soil microbial communities from Hopland, California, USA	Environmental	Open in IMG/M
3300001537	Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-65 cm-11A)- 1 week illumina	Environmental	Open in IMG/M
3300001565	Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A35-5cm-18A)- 1 week illumina new	Environmental	Open in IMG/M
3300001664	Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - 5cm_reassembled	Environmental	Open in IMG/M
3300002907	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm	Environmental	Open in IMG/M
3300004114	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5	Environmental	Open in IMG/M
3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Host-Associated	Open in IMG/M
3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Environmental	Open in IMG/M
3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Host-Associated	Open in IMG/M
3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Environmental	Open in IMG/M
3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Host-Associated	Open in IMG/M
3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Environmental	Open in IMG/M
3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Environmental	Open in IMG/M
3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Environmental	Open in IMG/M
3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Environmental	Open in IMG/M
3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Environmental	Open in IMG/M
3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Environmental	Open in IMG/M
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated	Open in IMG/M
3300005575	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151	Environmental	Open in IMG/M
3300005598	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155	Environmental	Open in IMG/M
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated	Open in IMG/M
3300005873	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301	Environmental	Open in IMG/M
3300005886	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205	Environmental	Open in IMG/M
3300006031	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100	Environmental	Open in IMG/M
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental	Open in IMG/M
3300006791	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102	Environmental	Open in IMG/M
3300006800	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109	Environmental	Open in IMG/M
3300006894	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control	Environmental	Open in IMG/M
3300007819	Permafrost core soil microbial communities from Svalbard, Norway - sample 2-1-2 Soapdenovo	Environmental	Open in IMG/M
3300007820	Permafrost core soil microbial communities from Svalbard, Norway - sample 2-12-2 Soapdenovo	Environmental	Open in IMG/M
3300007821	Permafrost core soil microbial communities from Svalbard, Norway - sample 2-10-2 Soapdenovo	Environmental	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009143	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300011227	Arctic soil microbial communities form glacier forefield, Midre Lovenbreen, Svalbard, Norway (Sample 10 - S13.1.50.a - transect 1, age 50 years, surface depth).	Environmental	Open in IMG/M
3300011414	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT266_2	Environmental	Open in IMG/M
3300011987	Permafrost microbial communities from Nunavut, Canada - A20_80cm_0M	Environmental	Open in IMG/M
3300011991	Permafrost microbial communities from Nunavut, Canada - A34_65cm_12M	Environmental	Open in IMG/M
3300011992	Permafrost microbial communities from Nunavut, Canada - A23_65cm_12M	Environmental	Open in IMG/M
3300011998	Permafrost microbial communities from Nunavut, Canada - A30_35cm_6M	Environmental	Open in IMG/M
3300011999	Permafrost microbial communities from Nunavut, Canada - A28_65cm_6M	Environmental	Open in IMG/M
3300012004	Permafrost microbial communities from Nunavut, Canada - A30_5cm_6M	Environmental	Open in IMG/M
3300012010	Permafrost microbial communities from Nunavut, Canada - A7_35cm_12M	Environmental	Open in IMG/M
3300012019	Permafrost microbial communities from Nunavut, Canada - A7_5cm_12M	Environmental	Open in IMG/M
3300012043	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ601 (22.06)	Environmental	Open in IMG/M
3300012198	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG	Environmental	Open in IMG/M
3300012200	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG	Environmental	Open in IMG/M
3300012202	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG	Environmental	Open in IMG/M
3300012203	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG	Environmental	Open in IMG/M
3300012205	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG	Environmental	Open in IMG/M
3300012206	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG	Environmental	Open in IMG/M
3300012207	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG	Environmental	Open in IMG/M
3300012208	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG	Environmental	Open in IMG/M
3300012209	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG	Environmental	Open in IMG/M
3300012211	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG	Environmental	Open in IMG/M
3300012285	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG	Environmental	Open in IMG/M
3300012356	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG	Environmental	Open in IMG/M
3300012357	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG	Environmental	Open in IMG/M
3300012530	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ85 (21.06)	Environmental	Open in IMG/M
3300012685	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG	Environmental	Open in IMG/M
3300012918	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG	Environmental	Open in IMG/M
3300012927	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012951	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG	Environmental	Open in IMG/M
3300012958	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG	Environmental	Open in IMG/M
3300012961	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG	Environmental	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300013503	Permafrost microbial communities from Nunavut, Canada - A23_5cm_12M	Environmental	Open in IMG/M
3300013764	Permafrost microbial communities from Nunavut, Canada - A28_35cm_6M	Environmental	Open in IMG/M
3300013772	Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M	Environmental	Open in IMG/M
3300014052	Permafrost microbial communities from Nunavut, Canada - A23_35cm_12M	Environmental	Open in IMG/M
3300014058	Permafrost microbial communities from Nunavut, Canada - A3_65cm_0.25M	Environmental	Open in IMG/M
3300015076	Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6a, vegetation/snow interface)	Environmental	Open in IMG/M
3300015192	Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-2a, rock/snow interface)	Environmental	Open in IMG/M
3300015195	Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6c, vegetation/snow interface)	Environmental	Open in IMG/M
3300015209	Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G3B, Proglacial river margin, by glacier terminus)	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300017789	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06)	Environmental	Open in IMG/M
3300018027	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex	Environmental	Open in IMG/M
3300018053	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1	Environmental	Open in IMG/M
3300018061	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1	Environmental	Open in IMG/M
3300018066	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1	Environmental	Open in IMG/M
3300018071	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1	Environmental	Open in IMG/M
3300018422	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T	Environmental	Open in IMG/M
3300018429	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T	Environmental	Open in IMG/M
3300018432	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T	Environmental	Open in IMG/M
3300019865	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s1	Environmental	Open in IMG/M
3300019869	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2	Environmental	Open in IMG/M
3300019870	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m1	Environmental	Open in IMG/M
3300019887	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2	Environmental	Open in IMG/M
3300019888	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2	Environmental	Open in IMG/M
3300019890	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1	Environmental	Open in IMG/M
3300020002	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1	Environmental	Open in IMG/M
3300020006	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2	Environmental	Open in IMG/M
3300020010	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s2	Environmental	Open in IMG/M
3300020012	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s1	Environmental	Open in IMG/M
3300020022	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2	Environmental	Open in IMG/M
3300020059	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2	Environmental	Open in IMG/M
3300021339	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c1	Environmental	Open in IMG/M
3300021363	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2	Environmental	Open in IMG/M
3300021411	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3c2	Environmental	Open in IMG/M
3300021413	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c1	Environmental	Open in IMG/M
3300025544	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 deep-072012 (SPAdes)	Environmental	Open in IMG/M
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026300	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes)	Environmental	Open in IMG/M
3300026320	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)	Environmental	Open in IMG/M
3300027378	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes)	Host-Associated	Open in IMG/M
3300027565	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes)	Environmental	Open in IMG/M
3300027587	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes)	Environmental	Open in IMG/M
3300027591	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes)	Environmental	Open in IMG/M
3300027645	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes)	Environmental	Open in IMG/M
3300027846	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027882	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027886	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)	Environmental	Open in IMG/M
3300027903	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)	Environmental	Open in IMG/M
3300028715	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203	Environmental	Open in IMG/M
3300028768	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119	Environmental	Open in IMG/M
3300028784	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121	Environmental	Open in IMG/M
3300028810	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151	Environmental	Open in IMG/M
3300028814	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183	Environmental	Open in IMG/M
3300028824	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197	Environmental	Open in IMG/M
3300028828	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202	Environmental	Open in IMG/M
3300028881	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116	Environmental	Open in IMG/M
3300028884	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195	Environmental	Open in IMG/M
3300031538	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1	Environmental	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M
3300034125	Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15	Environmental	Open in IMG/M
3300034268	Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
P1_DRAFT_00666310	2088090004	Soil	MPDTSAYYHLAYTIALGIYAAYALSLYLRRKRVRAK
Perma_A_C_02335440	2124908032	Soil	MPETSSYYHIAYTVALGIYTAYALSLYVRHKRLRVR
A_all_C_01708020	2140918007	Soil	MPETSAYFHAAYTIALGIYAAYALSIYLRRKRVRAK
A_all_C_01523840	2140918007	Soil	MPETFSYYHVAYTVALGIYAGYAISLYVRRKRLRVG
AL9A1W_10283024	3300000878	Permafrost	MPETSSYYHVAYTIALGIYAAYAVSLYVRRKRLRVR*
AL16A1W_100306932	3300000887	Permafrost	MPETSSFYHVAYTVALSIYTAYALSLYFRRKRLRAR*
JGI10216J12902_1034490072	3300000956	Soil	MPETSSYYHVAYTVALTIYAAYGVSLYLRRKRLRRK*
C688J14111_102555662	3300001305	Soil	MPDTSAYYHLAYTIALSIYTLYAISLFVRRRRVRSK*
A2065W1_113022822	3300001537	Permafrost	MPPETSTYYHVAYTIALGIYTAYAVSLYLRHKRLRVR*
A35518A_10711683	3300001565	Permafrost	MPETSAYSHIAYTVALGIYAAYALSLYVRRKRLRAN*
P5cmW16_10377902	3300001664	Permafrost	RMPETSSYYHVAYTVALGIYAVYAISLYLRRKRLRVR*
JGI25613J43889_100136622	3300002907	Grasslands Soil	MRLPQEGNTMPDTSAYYHLAYTIALGIYAAYGLSLYLRRKRVRAK*
Ga0062593_1006202742	3300004114	Soil	MQRSQSRRTMPETSSYYHVAYTVALSIYALYGISLYLRRKRLRGK*
Ga0062593_1011701622	3300004114	Soil	MHPSRLRRMPETSSYYHIAYTVALTIYAVYGVSLYLRRKRLRRK*
Ga0070676_102336992	3300005328	Miscanthus Rhizosphere	MLSQQAASMPETSAYYHTAYAIALGIYTLYAITLYVRKKRLRQSR*
Ga0070682_1004462982	3300005337	Corn Rhizosphere	MQPLRETTPMPETSAYFHVAYTVALGIYAAYALSLYVRRKRVRAK*
Ga0070661_1015786022	3300005344	Corn Rhizosphere	MLSQQAASMPETSAYYHTAYAIALGIYTVYAITLYVRKKRLRQSR*
Ga0070692_100625921	3300005345	Corn, Switchgrass And Miscanthus Rhizosphere	AMLSQQAASMPETSAYYHTAYAIALGIYTLYAITLYVRKKRLRQSR*
Ga0070673_1009825002	3300005364	Switchgrass Rhizosphere	MQPLRETTLMPETSAYFHVAYTVALGIYAAYALSLYVRRKRVRAK*
Ga0070703_104898671	3300005406	Corn, Switchgrass And Miscanthus Rhizosphere	PLRETTLMPETSAYFHVAYTVALGIYAAYALSLYVRRKRVRAK*
Ga0070705_1012094911	3300005440	Corn, Switchgrass And Miscanthus Rhizosphere	LSTTMPDTSTYYHVAYTLALGIYVLYGLSLYVRRRKLRRGQ*
Ga0070700_1011624462	3300005441	Corn, Switchgrass And Miscanthus Rhizosphere	LVLSRTNMPETSSYYHTAYAIALGIYLAYAISLYVRRRRLRERR*
Ga0070681_109708062	3300005458	Corn Rhizosphere	MQLSHARRNMPENASYYHVAYTVALSIYTLYGISLYLRRKRLRGK*
Ga0070706_1002554612	3300005467	Corn, Switchgrass And Miscanthus Rhizosphere	MRLPQERKAMPETSAYYHLAYAIALGIYAAYGLSLYLRRKRVRAK*
Ga0070679_1001710172	3300005530	Corn Rhizosphere	MQLSQTRPNMPETSSYYHVAYTVALSIYALYGISLYLRRKRLRGK*
Ga0070664_1002880552	3300005564	Corn Rhizosphere	MPETSSYYHVAYTVALTIYAAYGVSLYLRRKRLRRKQ*
Ga0066702_102900792	3300005575	Soil	RMPETSSYYHVAYTVALCIYIAYALSLYVRRNNLKRK*
Ga0066702_102901022	3300005575	Soil	MQFFRVLTMPETSFAYHLAYALALGIYAVYGVSLYVRRKALRDRGK*
Ga0066706_101476153	3300005598	Soil	MPETSTYYHLAYTIALTIYAAYALSLYLRRRRVRAKP*
Ga0068866_100186213	3300005718	Miscanthus Rhizosphere	MPETSVYYHVAYTIALGIYIAYAVSLYVRLKRVRGSR*
Ga0075287_10049522	3300005873	Rice Paddy Soil	MPETSSYYHVAYTVALGIYAIYAASLYLRRRRLRAK*
Ga0075286_10676801	3300005886	Rice Paddy Soil	ETSSYYHVAYTVALGIYAIYAASLYLRRRRLRAK*
Ga0066651_100275134	3300006031	Soil	MKMPDTSSYYHVAYTVALGIYAAYALSLYVRSNRVRRK*
Ga0070712_1006940502	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	MPETSTYYHIAYTIALSIYTLYAVSLWMRRKKLRQP*
Ga0066653_106138181	3300006791	Soil	MPDTSSYYHVAYTVALGIYAAYALSLYVRSNRVRRK
Ga0066660_102345822	3300006800	Soil	MPETSAYYHVAYTIALGIYAAYALSLYVRHNKLRGG*
Ga0079215_100069042	3300006894	Agricultural Soil	MPDTSFHYYVAYVAALGIYAVYALSLHLRRKRLRPDR*
Ga0104322_1456045	3300007819	Permafrost Soil	MPETSHYYHVAYTVALGIYAAYALSLYVRRKRSRVR*
Ga0104324_1059262	3300007820	Soil	MPDTSAYYHLAYTIALGIYAAYALSLYLRRKRVRAK*
Ga0104324_1202093	3300007820	Soil	MPETSSYYHVAYTVALGIYAMYAISLYVRRKRLRVR*
Ga0104323_1253403	3300007821	Soil	MPETSSYYHVAYAVALSIYSLYALSLYIRRKRLRVKQ*
Ga0066710_1014997222	3300009012	Grasslands Soil	MPETSTYYHLAYTIALGIYAAYALSVYLRRKGLRAKQ
Ga0066710_1025897992	3300009012	Grasslands Soil	MPDTAAYYHLAYTFALGIYAAYALSLHLRRKRLRVKS
Ga0099829_102535192	3300009038	Vadose Zone Soil	MMPETSAYYHLAYTIALGIYGGYGLSLYLRRKRVRAK*
Ga0099827_100491044	3300009090	Vadose Zone Soil	MPETSAYYHLAYTIALGIYAAYGLSLYLRRKRARAK*
Ga0105245_103821742	3300009098	Miscanthus Rhizosphere	MPETSFYYHVAYTIALGIYAIYGLSLYVRHKRLHRP*
Ga0066709_1008706612	3300009137	Grasslands Soil	MPDTAAYYHLAYTFALGIYAAYALSLHLRRKRLRVKS*
Ga0066709_1016353762	3300009137	Grasslands Soil	MPETSTYYHLAYTIALGIYAAYALSVYLRRKGLRAK
Ga0099792_100212053	3300009143	Vadose Zone Soil	MPETSAYFHVAYTVALGIYAAYALSLYVRRKRVRAK*
Ga0099792_101420692	3300009143	Vadose Zone Soil	MPETSSYYHLAYTIALGIYAAYALSLYVRRRRVRSGR*
Ga0099792_105058712	3300009143	Vadose Zone Soil	MPETSSYYHVAYALALGIYAAYALSLYVRRKRVRAR*
Ga0099792_105288562	3300009143	Vadose Zone Soil	MPDTSAYYHLAYTVGLGIYTVYGLSLYLRRKRVRAK*
Ga0134123_100465084	3300010403	Terrestrial Soil	MPETSFYYHVAYTIALGIYAAYALSLYVRRKRLERGR*
Ga0137475_1033852	3300011227	Glacier Forefield Soil	MPDTSFYYYLAYASALGLYGLYALSLYLRRKRLRGK*
Ga0137442_10410621	3300011414	Soil	QRPSMMPETSAYYHLAYIIALGIYAAYGVSLYLRRRRLRTR*
Ga0120164_10015378	3300011987	Permafrost	MPETSAYFHAAYTIALGIYAAYALSIYLRRKRVRAK*
Ga0120164_10512792	3300011987	Permafrost	MPETSSYYHVAYTVALSIYTAYALSLYFRRKRLRAR*
Ga0120153_10034658	3300011991	Permafrost	MPETSSYYHVAYSVALGIYAAYALSLYLRRKRLRVR*
Ga0120146_10147892	3300011992	Permafrost	MPETSAYYHAAYIVALSIYAAYAISLYLRRKRLRGKQ*
Ga0120146_10514621	3300011992	Permafrost	RSSMPETSSYYHVAYSVALGIYAAYALSLYLRRKRLRAR*
Ga0120114_10068832	3300011998	Permafrost	MPDTSAYYHLAYTIALGLYAAYALSLYLRRKRVRAK*
Ga0120148_100010331	3300011999	Permafrost	MPETSTYYHIAYTVALGIYSAYALSLYFRRKRLRAR*
Ga0120148_10250882	3300011999	Permafrost	MPETSSYYHVAYTVALGIYAVYAISLYVRRKRLRVR*
Ga0120134_10115721	3300012004	Permafrost	MPETSSYYHVAYTVALGIYAVYAISLYLRRKRLRVR*
Ga0120118_10632742	3300012010	Permafrost	MPETSSYYHVAYTVALGIYAAYALSLYVRRKRLRVR*
Ga0120139_100059412	3300012019	Permafrost	MPDTSAYYHLAYTIALGVYAAYALSLYLRRKRVRAK*
Ga0136631_100073092	3300012043	Polar Desert Sand	MPDTSFHYHLAYAAALGIYALYALSLYVRRRRLRSK*
Ga0137364_100053145	3300012198	Vadose Zone Soil	MPETSAYYHLAYALALGVYAVYGLSLYLRRRRLRAK*
Ga0137364_102461383	3300012198	Vadose Zone Soil	MPETSAYYHVAYTIALGIYIAYAVSLYVRLKRVRRSR*
Ga0137382_100199373	3300012200	Vadose Zone Soil	MPDTSAYYHVAYTIALSIYAGYALSLYVRRKRVKRES*
Ga0137363_100421552	3300012202	Vadose Zone Soil	MPDTSAYYHLAYTIALGIYAAYGLSLYLRRKRVRAK*
Ga0137399_101130462	3300012203	Vadose Zone Soil	MPETSSYYHVAYTVALGIYAAYAISLYVRRKRLRVR*
Ga0137399_102038942	3300012203	Vadose Zone Soil	MPDTSAYYHVAYTIALGIYTVYGLSLYLRRQRVRAK*
Ga0137362_111523872	3300012205	Vadose Zone Soil	MPETCAYYHLAYTIALGIYAAYGLSLYLRRKRVRAK*
Ga0137362_117324042	3300012205	Vadose Zone Soil	MPDTSAYYHLAYTVALGIYTVYGLSLYLRRKRVRAK*
Ga0137380_101140673	3300012206	Vadose Zone Soil	MPDTAVYYHLAYTIALGIYAAYALSLHLRRKQLRSKS*
Ga0137380_107690952	3300012206	Vadose Zone Soil	MPETSFYYRVAYTLALGIYAAYAMSLYVRRRKLRGKQ*
Ga0137381_102078793	3300012207	Vadose Zone Soil	MPETSFYYRVAYTLALGIYAAYAMSLYVRRRKLRRKQ*
Ga0137376_101955173	3300012208	Vadose Zone Soil	MPETSSYYHIAYAIALGIYAIYGLSLHIRRKRLRAKR*
Ga0137376_104281201	3300012208	Vadose Zone Soil	MPETSAYYHVAYTIALGIYAAYALSLYVRRRKVRRQQ
Ga0137379_108441182	3300012209	Vadose Zone Soil	MPETSFYYHVAYTLALGIYAAYAMSLYVRRRKLRGKQ*
Ga0137377_100504832	3300012211	Vadose Zone Soil	MPETSAYYHLAYTIALGIYAAYGLSLYLRRKRVRAK*
Ga0137377_111986202	3300012211	Vadose Zone Soil	MAETSFYYHLAYTIALGMYTAYALSLYVRRKRVRAK*
Ga0137377_112931832	3300012211	Vadose Zone Soil	MPDTSAYYHVAYTIALSIYAGYALSLYVRRKRVKREP*
Ga0137370_109951392	3300012285	Vadose Zone Soil	MPETSTYYHLAYTVALGIYTAYALTLYLRRKRLRAT*
Ga0137371_100742313	3300012356	Vadose Zone Soil	MPDTAVYYHLAYTIALGIYAAYALSLHLRRKQLRVKS*
Ga0137384_113293792	3300012357	Vadose Zone Soil	MPETSFYYHVAYTLALGIYAAYAMSLYVRRRKLRRKQ*
Ga0136635_100299743	3300012530	Polar Desert Sand	MPDTSFHYHLAYAAALGIYALYALSLYVRRRRLRGK*
Ga0136635_101284452	3300012530	Polar Desert Sand	MPETSSYYHIAYAAALGIYALYGLSLYTRRKRLRSR*
Ga0137397_104894712	3300012685	Vadose Zone Soil	MPNTSAYYHLAYTIALGIYTVYGLSLYLRRQRVRAK*
Ga0137396_108085532	3300012918	Vadose Zone Soil	MPDTSAYYHLAYTIALGIYTVYGLSLYLRRQRVRAK*
Ga0137416_103212492	3300012927	Vadose Zone Soil	MPDTSAYYHLAYTIALGIYAVYGLSLYLRRQRVRAK*
Ga0164300_104884122	3300012951	Soil	MPETSSYYHIAYTIALSIYALYAVSLYVRRKRVRSR*
Ga0164299_113419352	3300012958	Soil	MPETSAYYHVAYTIALGIYIAYAVSLYLRLKRVRGSS*
Ga0164302_118026122	3300012961	Soil	MPLPPPHRLMPETSSYYHIAYTIALSIYALYAVSLYVRRKRVRSR*
Ga0157374_118137382	3300013296	Miscanthus Rhizosphere	MPETSSYYHVAYTVALSIYALYGISLYLRRKRLRGK*
Ga0157378_100268884	3300013297	Miscanthus Rhizosphere	MPDTSTYYHVAYTLALGIYVLYGLSLYVRRRKLRRGQ*
Ga0157378_107816002	3300013297	Miscanthus Rhizosphere	MPETSAYYHVAYTIALGIYIAYGVSLYVRLKRVRRSR*
Ga0157378_125794551	3300013297	Miscanthus Rhizosphere	TLLVLSRTNMPETSSYYHTAYAIALGIYLAYAISLYVRRRRLRERR*
Ga0120127_1000019016	3300013503	Permafrost	MPETSSYYHVAYTVALSIYSVYALSLYIRRKRLRVKK*
Ga0120111_10274452	3300013764	Permafrost	MPETSSYYHLAYSVALGIYAAYALSLYLRRKRLRVR*
Ga0120158_101094802	3300013772	Permafrost	MPETSSYYHIAYTVALGIYTAYALSLYVRHKRLRVR*
Ga0120109_11228712	3300014052	Permafrost	MPETSSYYHAAYTVALCIYGAYAISLYIRRKRLRVR*
Ga0120149_11705393	3300014058	Permafrost	ETSSYYHVAYSVALGIYAAYALSLYLRRKRLRVR*
Ga0167656_10138992	3300015076	Glacier Forefield Soil	MPETSSYYHLAYTVALGIYAAYAISLYVRRKRLRAR*
Ga0167646_10016449	3300015192	Glacier Forefield Soil	MPETSAYYHLAYTIALGIYVAYGLSLYLRRKRLRAK*
Ga0167658_10660682	3300015195	Glacier Forefield Soil	MQPLLNWTTMPDTSAYYHIAYTIALGIYAAYALSLYLRRKRLGAK*
Ga0167629_10247302	3300015209	Glacier Forefield Soil	MPDNAQYYHAAYAIALVIYAAYALSLARRRGKLRR*
Ga0132258_105289041	3300015371	Arabidopsis Rhizosphere	MPETSAYYHIAYTVALGIYAAYALSLYIRRKKLGRR*
Ga0132258_129781882	3300015371	Arabidopsis Rhizosphere	SMPETSAYYHIAYTVALGIYAAYALSLYIRRKKLGRR*
Ga0136617_100423564	3300017789	Polar Desert Sand	MPDTSFHYHLAYAAALGIYALYALSLYVRRRRLRSK
Ga0184605_103174592	3300018027	Groundwater Sediment	MPETSTYYHIAYTIALAIYAVYGVSLHIRRKRVRAKR
Ga0184605_103666342	3300018027	Groundwater Sediment	MPETSSYYHLAYTIALGIYAVYALSLYVRRKRVKAR
Ga0184626_100986243	3300018053	Groundwater Sediment	MPETSFFYHLAYTLALAIYAAYALSLYVRRKRVRSRQ
Ga0184619_101821282	3300018061	Groundwater Sediment	MPETSSYYHIAYAIALGIYAVYALSLHIRRKRVREMR
Ga0184617_10345042	3300018066	Groundwater Sediment	MPETSFYYHLAYIMAFVIYGGYAVSLYVRRKRLRDVG
Ga0184618_102222202	3300018071	Groundwater Sediment	MPETSSYYHIAYAIALGIYAVYALSLHIRRKRVSEMR
Ga0190265_100020825	3300018422	Soil	MPETSFYYYLAYVAALGIYALYGVSLGVRRNRLRGK
Ga0190272_102594092	3300018429	Soil	MPETSFYYHLAYVMALSIYAAYALSLYLRRKRLKTGR
Ga0190272_102952322	3300018429	Soil	MLSPRGRRLMPDTSFHYHLAYAAALGIYAVYALSLYLRRKRLRSDR
Ga0190272_103010882	3300018429	Soil	MPDTSFHYHLAYAAALGIYALYALSLYLRRKRLRGE
Ga0190272_116771452	3300018429	Soil	MPDTTFHYHLAYAAALGIYALYALSLYLRRKRLGRD
Ga0190275_100450582	3300018432	Soil	MPDTYFHYYLAYAAALGLYAAYGLSLYLRRQRVRRK
Ga0190275_115084622	3300018432	Soil	MPDTAFYYYLAYGSALGIYALYALSLYIRLKRLRDG
Ga0193748_10015003	3300019865	Soil	MQLSQSRRNMPETSSYYHVAYTVALSIYALYGISLYLRRKRLRGK
Ga0193705_10475992	3300019869	Soil	MPETSSYYHIAYAIALGIYAVYGLSLHIRRKRVRAKR
Ga0193746_10332102	3300019870	Soil	MPETSVYYHVAYTVALGIYVLYALSLYVRRNGVRRRQ
Ga0193729_10119113	3300019887	Soil	MQLPQKGNTMPETSGYYHLAYTIALSIYAAYALSLYLRRKRVQAK
Ga0193729_10123895	3300019887	Soil	MPETSSYYHVAYTVALGIYAVYAVSLYVRRKRLRGRL
Ga0193729_10709562	3300019887	Soil	MRLPQERNTMPETSAYYHLAYTIALGIYAAYGLSLYLRRKRVRAK
Ga0193751_10069564	3300019888	Soil	MPETSSYYHVAYTVALGIYAAYAVSLYVRRKRLRVR
Ga0193728_12899392	3300019890	Soil	MRLPQERNTMPETSEYYHLAYTIALGIYAAYGLSLYLRRKRVRAK
Ga0193730_10202951	3300020002	Soil	PLRKGTTMPETSAYYHLAYTFALGIYAAYGLSLYLRRKRLRAK
Ga0193730_11286662	3300020002	Soil	MPETSAYFHAAYTIALGIYVAYALSLYVRLQRVRGK
Ga0193735_10112102	3300020006	Soil	MPETSSYYHVAYTVALGIYAVYAVSLYVRRKRLRIR
Ga0193749_10196592	3300020010	Soil	MPETSEYYHLAYTIALGIYAAYGLSLYLRRKRVRAK
Ga0193732_10507802	3300020012	Soil	MPETSSYYHVAYTVALSIYSLYALSLYIRRKRLRVKK
Ga0193733_10133491	3300020022	Soil	RKGSTMPETSAYYHLAYTFALGIYAAYGLSLYLRRKRLRAK
Ga0193733_10275891	3300020022	Soil	MPETSSYYHIAYAIALGIYAVYGLSLHIRRKRVRAK
Ga0193745_10076453	3300020059	Soil	MPETSSYYHIAYAIALSIYVAYAFSLYIRRRRVRAGK
Ga0193745_10916072	3300020059	Soil	MPETSAYFHVAYTVALGIYAAYALSLYVRRMRVRAK
Ga0193706_10751791	3300021339	Soil	MPETSSYYHIAYTVALSIYALYGISLYLRRKRLRGK
Ga0193706_11385033	3300021339	Soil	LSQSRLIMPETSSYYHIAYTVALSIYALYGISLYLRRKRLRGK
Ga0193699_100057862	3300021363	Soil	MPETSGYFHVAYTVALGIYSAYALSLYVRRKRVRAK
Ga0193699_100537973	3300021363	Soil	MPETSAYYHIAYTVALGIYAAYALSLYLRRKRLRAK
Ga0193699_102046752	3300021363	Soil	MPETSSYYHIAYAIALGIYAVYGLSLYLRRKGVKAGR
Ga0193699_102458272	3300021363	Soil	MPETSSYYHAAYTVALTIYAVYAISLYVRRKRLRVR
Ga0193709_10113542	3300021411	Soil	MPETSAYYHIAYAVALGIYTAYALSLYLRRKRLRAK
Ga0193750_10200332	3300021413	Soil	MPETSSYYHVAYTIALGIYAAYAISLYVRRKRLRAG
Ga0208078_11282342	3300025544	Arctic Peat Soil	MPETSSYFHAAYTIALGIYAAYALSIYLRRKRARGK
Ga0207642_100596092	3300025899	Miscanthus Rhizosphere	MLSQQAASMPETSAYYHTAYAIALGIYTVYAITLYVRKKRLRQSR
Ga0207642_104418122	3300025899	Miscanthus Rhizosphere	MPETSVYYHVAYTIALGIYIAYAVSLYVRLKRVRGSR
Ga0207680_113720372	3300025903	Switchgrass Rhizosphere	MPETSAYYHVAYTIALGIYIAYAVSLYVRLKRVRRSP
Ga0207699_104036032	3300025906	Corn, Switchgrass And Miscanthus Rhizosphere	MPDTSAYYHIAYTIALSIYAGYAFSLYFRRKRVRREP
Ga0207699_108126292	3300025906	Corn, Switchgrass And Miscanthus Rhizosphere	MPETSAYFHIAYTVAVGIYAAYALSLYVRRKRVRAK
Ga0207645_103804532	3300025907	Miscanthus Rhizosphere	MPETSFYYHVAYTIALGIYAIYGLSLYVRHKRLHRP
Ga0207707_1000381917	3300025912	Corn Rhizosphere	MQLSQTRPNMPETSSYYHVAYTVALSIYALYGISLYLRRKRLRGK
Ga0207662_100327353	3300025918	Switchgrass Rhizosphere	MPETSAYYHTAYAIALGIYTLYAITLYVRKKRLRQSR
Ga0207681_105143612	3300025923	Switchgrass Rhizosphere	MPDTSTYYHVAYTLALGIYVLYGLSLYVRRRKLRRGQ
Ga0207706_100699423	3300025933	Corn Rhizosphere	MLSQQAASMPETSAYYHTAYAIALGIYTLYAITLYVRKKRLRQSR
Ga0207689_117157321	3300025942	Miscanthus Rhizosphere	MPETSFYYHLAYGMAFGIYGGYALSLYVRRKRLRDAR
Ga0207661_102125263	3300025944	Corn Rhizosphere	MPETSSYYHVAYTVALTIYAAYGVSLYLRRKRLRRK
Ga0207661_103795351	3300025944	Corn Rhizosphere	MPDNAIYYHVAYSIALGIYLLYGISLFVRRSRLRK
Ga0207708_100453172	3300026075	Corn, Switchgrass And Miscanthus Rhizosphere	VLSRTNMPETSSYYHTAYAIALGIYLAYAISLYVRRRRLRERR
Ga0207648_102962112	3300026089	Miscanthus Rhizosphere	MPETSFYYHLAYGMAFGIYGAYALSLYVRRKRLRDAR
Ga0209027_10230483	3300026300	Grasslands Soil	MPETSAYYHVAYTIALGIYAAYALSLYMRHNKLRGG
Ga0209131_10166355	3300026320	Grasslands Soil	MRLPQEGNTMPDTSAYYHLAYTIALGIYAAYGLSLYLRRKRVRAK
Ga0209981_10367482	3300027378	Arabidopsis Thaliana Rhizosphere	MPETSFYYHLAYIAALGIYGAYALSLYVRRKRLRDAR
Ga0209219_10186663	3300027565	Forest Soil	MPETSAYYHLAYTIALGIYAAYGLSLYLRRKRVRGK
Ga0209220_11578952	3300027587	Forest Soil	MPETSSYYHVAYTVALGIYALYAVSLYVRRKRLRVR
Ga0209733_11035742	3300027591	Forest Soil	MPDTSAFYHLAYTIALGIYAAYGLSLYLRRKRLRAR
Ga0209117_10868441	3300027645	Forest Soil	MPETSSYYHLAYTVALGIYAAYAVSLYVRRKRLTARR
Ga0209180_106653881	3300027846	Vadose Zone Soil	MSETSAYYHLAYTIALGIYGGYGLSLYLRRKRVRAK
Ga0209590_102064042	3300027882	Vadose Zone Soil	MPETSAYYHLAYTIALGIYAAYGLSLYLRRKRARAK
Ga0209486_106261882	3300027886	Agricultural Soil	MPDTSFHYYVAYVAALGIYAVYALSLHLRRKRLRPDR
Ga0209488_102692592	3300027903	Vadose Zone Soil	MPDTSAYYHLAYTVGLGIYTVYGLSLYLRRKRVRAK
Ga0209488_108862012	3300027903	Vadose Zone Soil	MPETSSYYHVAYALALGIYAAYALSLYVRRKRVRAR
Ga0307313_101876352	3300028715	Soil	MPETSAYYHLAYTFALGIYAAYGLSLYLRRKRLRAK
Ga0307280_100505752	3300028768	Soil	MPETSAYFHVAYTVALGIYAAYALSLYVRRKRVLAR
Ga0307282_106647392	3300028784	Soil	MPETSSYYHVAYAIALGIYAIYGLSLYIRRKRVRAKR
Ga0307294_104251561	3300028810	Soil	PQRTTMPETSSYYHVAYTLGLGIYAAYALSLYIRHKRVRSAR
Ga0307302_101536123	3300028814	Soil	MPETSFFYHLAYTLALAIYAAYALSLYVRRKRVRSAQ
Ga0307310_100101332	3300028824	Soil	MPETSSYYHAAYAVALSLYSAYALSLYIRRKRLRVKK
Ga0307310_100872642	3300028824	Soil	MPETSSYYHLAYTIALGIYGVYALSLYIRRNRLRPGR
Ga0307312_102012272	3300028828	Soil	MPETSAYFHVAYTVALGIYAAYALSLYVRRKRVRAR
Ga0307312_108996472	3300028828	Soil	MPETSAYYHLAYTIALGIYAAYALSLYLRRKRVRAK
Ga0307277_102373101	3300028881	Soil	MPETSSYYHIAYVIALGIYAVYGLSLYLRRKGVKA
Ga0307308_101208802	3300028884	Soil	MPETSAYYHLAYTIALGIYAAYALSLYLRRKRVRAT
Ga0310888_104644312	3300031538	Soil	MPETSAYYHVAYTIALGIYIAYAVSLYVRLKRVRGSR
Ga0307468_1014231482	3300031740	Hardwood Forest Soil	MPETSAYFHLAYAVALGIYAAYALSLYVRRKRVRAK
Ga0307468_1021158502	3300031740	Hardwood Forest Soil	MPDTSAYYHVAYTIALGIYVAYAVSLYVRLKRVRGSR
Ga0307471_1004629583	3300032180	Hardwood Forest Soil	MPDTSAYYHVAYTIALGIYAGYALSLYVRRKNLKRGR
Ga0307472_1003845022	3300032205	Hardwood Forest Soil	MPDTSAYYHIAYTIALSIYAGYALSLYVRRKRVKREP
Ga0370484_0001624_3048_3158	3300034125	Untreated Peat Soil	MPETSAYFHAAYTIALGIYAAYALSIYLRRKRVQAK
Ga0372943_0439403_741_845	3300034268	Soil	MPETSSAYHLAYTIALAIYVAYGASLYFRRKGLRA
Ga0372943_1180397_329_439	3300034268	Soil	MPDTSFYYHVAYTIALGIYGLYALSLYIRHRRVHQR

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F026952

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences