 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F026746 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 197 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MSKSVILSLLAQGNTGDEILSILDTIVESIEQENIDSCAEVFAA |
| Number of Associated Samples | 141 |
| Number of Associated Scaffolds | 197 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 1.02 % |
| % of genes near scaffold ends (potentially truncated) | 28.43 % |
| % of genes from short scaffolds (< 2000 bps) | 76.65 % |
| Associated GOLD sequencing projects | 126 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (56.345 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (16.751 % of family members) |
| Environment Ontology (ENVO) | Unclassified (43.655 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (50.761 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.39% β-sheet: 0.00% Coil/Unstructured: 48.61% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 197 Family Scaffolds |
|---|---|---|
| PF04965 | GPW_gp25 | 5.58 |
| PF04851 | ResIII | 1.52 |
| PF13392 | HNH_3 | 1.52 |
| PF14240 | YHYH | 1.02 |
| PF01541 | GIY-YIG | 0.51 |
| PF16724 | T4-gp15_tss | 0.51 |
| PF16075 | DUF4815 | 0.51 |
| PF00856 | SET | 0.51 |
| PF02945 | Endonuclease_7 | 0.51 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 56.35 % |
| All Organisms | root | All Organisms | 43.65 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 16.75% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 10.15% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 8.12% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 7.61% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.58% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 5.58% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 5.58% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.57% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 4.57% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 3.05% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 3.05% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.05% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.54% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 1.52% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.52% |
| Marine | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine | 1.52% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.02% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 1.02% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.02% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 1.02% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.02% |
| Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 1.02% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 1.02% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.51% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.51% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.51% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.51% |
| Freshwater, Surface Ice | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice | 0.51% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.51% |
| Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment | 0.51% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.51% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.51% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.51% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.51% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 0.51% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 0.51% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.51% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2149837002 | Marine microbial communities from the Baltic Sea | Environmental | Open in IMG/M |
| 3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
| 3300001419 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline water (15 m) | Environmental | Open in IMG/M |
| 3300002132 | Marine microbial communities from the Baltic Sea, analyzing arctic terrigenous carbon compounds - M2t6BS2 (105f) | Environmental | Open in IMG/M |
| 3300002139 | M3t2BS2 (117f) | Environmental | Open in IMG/M |
| 3300002144 | Marine microbial communities from the Baltic Sea, analyzing arctic terrigenous carbon compounds - M2t2BS2 (113f) | Environmental | Open in IMG/M |
| 3300002447 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300003490 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003497 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN | Environmental | Open in IMG/M |
| 3300004793 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300005828 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.182_BBI | Environmental | Open in IMG/M |
| 3300005833 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK | Environmental | Open in IMG/M |
| 3300005940 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 | Environmental | Open in IMG/M |
| 3300005943 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14 | Environmental | Open in IMG/M |
| 3300005955 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_23-Sept-14 | Environmental | Open in IMG/M |
| 3300005990 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T3_30-Apr-14 | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
| 3300007560 | Estuarine microbial communities from the Columbia River estuary - metaG 1560A-02 | Environmental | Open in IMG/M |
| 3300007561 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-3 | Environmental | Open in IMG/M |
| 3300007593 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-3 | Environmental | Open in IMG/M |
| 3300007706 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-3 | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
| 3300008950 | Estuarine microbial communities from the Columbia River estuary - metaG 1552A-02 | Environmental | Open in IMG/M |
| 3300008999 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 | Environmental | Open in IMG/M |
| 3300009039 | Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cm | Environmental | Open in IMG/M |
| 3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009450 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 4m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009451 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 8m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300011995 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 880 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012666 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2 | Environmental | Open in IMG/M |
| 3300012770 | Freshwater microbial communities from Lake Simoncouche, Canada - S_140625_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013014 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaG | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017971 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_2 metaG | Environmental | Open in IMG/M |
| 3300018610 | Metatranscriptome of marine microbial communities from Baltic Sea - LD35M_ls2 | Environmental | Open in IMG/M |
| 3300018682 | Metatranscriptome of marine microbial communities from Baltic Sea - GS680_0p1 | Environmental | Open in IMG/M |
| 3300018775 | Metatranscriptome of marine microbial communities from Baltic Sea - GS679_0p8 | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300021091 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40m | Environmental | Open in IMG/M |
| 3300021323 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R9.63AS (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021425 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284 | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022353 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R8.37A (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300024531 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026931 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_23-Sept-14 (SPAdes) | Environmental | Open in IMG/M |
| 3300027129 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8h | Environmental | Open in IMG/M |
| 3300027144 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_0h | Environmental | Open in IMG/M |
| 3300027193 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 (SPAdes) | Environmental | Open in IMG/M |
| 3300027205 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027242 | Estuarine microbial communities from the Columbia River estuary - metaG 1554B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027256 | Estuarine microbial communities from the Columbia River estuary - metaG 1560A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027337 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8d | Environmental | Open in IMG/M |
| 3300027486 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_8d | Environmental | Open in IMG/M |
| 3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027728 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027836 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027940 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T3_25-Nov-14 (SPAdes) | Environmental | Open in IMG/M |
| 3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027977 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12m | Environmental | Open in IMG/M |
| 3300028191 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_06_06_50m | Environmental | Open in IMG/M |
| 3300028553 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_16m | Environmental | Open in IMG/M |
| 3300028569 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8m | Environmental | Open in IMG/M |
| 3300028581 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_17m | Environmental | Open in IMG/M |
| 3300029268 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_19m | Environmental | Open in IMG/M |
| 3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
| 3300029933 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727_2 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Baltic_Sea_00463180 | 2149837002 | Marine | VALSLLAQGNNGDEILTILDTLVADIEQEGINSCAEVFEV |
| JGI12421J11937_100260206 | 3300000756 | Freshwater And Sediment | MSLSVALNLLAQGNNGDEILTILNTLVADIEQEGINSCAEVFEV* |
| JGI11705J14877_100221483 | 3300001419 | Saline Water And Sediment | MPKNLILSLLAQGNTGDEILSILDVIVSDIEQENINLCAEVFES* |
| M2t6BS2_13741122 | 3300002132 | Marine | MSLSVALSLLAQGNNGDEILTILDTLVSDIEQEGINSCAEVFEV* |
| M3t2BS2_16355872 | 3300002139 | Marine | FFVIMSKSVILSLLAQGNSGTEILTILDTLVADIEQENIDDVAEYYAAL* |
| M2t2BS2_108957611 | 3300002144 | Marine | MSLSVALSLLAQGNNGDEILTILDTLVADIEQEGINSCAEVFEV* |
| JGI24768J34885_101080291 | 3300002447 | Freshwater And Sediment | KSVILSLLAQGNTGTEILGILDTLIADIEQENIDDVAEYYAAL* |
| B570J40625_1007537693 | 3300002835 | Freshwater | MSKQVILSMLAQGNTGDEILSILDVIVSDIEQEGIDSCAEVFAN*STLTVHS* |
| B570J40625_1009365133 | 3300002835 | Freshwater | MSKQVILSMLAQGNTGDEILSILDVIVSDIEQEGIDSCAEVFAN*STLT |
| JGI25908J49247_101260201 | 3300003277 | Freshwater Lake | MSKSVILSLLDQGNTATEILTILDMLVESIVDENIDNCAEVFAI* |
| JGI25909J50240_10219994 | 3300003393 | Freshwater Lake | MSKSVILSLLXQGNTATEILTILDMLVESIVDENIDNCAEVFAI* |
| JGI25926J51410_10294451 | 3300003490 | Freshwater Lake | MSKSVILSLLAQGNTATEILTILDMLVESIVEENIDNCAEVYNTQY* |
| JGI25926J51410_10703672 | 3300003490 | Freshwater Lake | MSLSIALSLLAQGNNGAEILTILDTLVSDIEQEGINSCAEVFEV* |
| JGI25925J51416_100448144 | 3300003497 | Freshwater Lake | LSFFIMSKSVIISLLAQGNTATEILTILDMLVESIVEENIDNCAEVFAI* |
| Ga0007760_113808251 | 3300004793 | Freshwater Lake | MSLSIALSLLAQGNNGAEILTILDTLVSDIEQEGINSCAEVF |
| Ga0074648_10147757 | 3300005512 | Saline Water And Sediment | MPKNVILSLLAQGNTGDEILSILDVIVSDIEQENINLCAEVFES* |
| Ga0070374_104233252 | 3300005517 | Freshwater Lake | IMSKSVILSLLAQGNTATEILTILDMLVESIVEENIDSCAEVFAI* |
| Ga0070374_104330271 | 3300005517 | Freshwater Lake | MSKSVIISLLAQGNTATEILTILNMLVESIVEENIDSCAEVFAI* |
| Ga0068876_1002524111 | 3300005527 | Freshwater Lake | MSKTVILSMLAQGNTGDEILSILDVIVSDIEQEGIDSCAEVFAVN*VQYS* |
| Ga0049083_101215831 | 3300005580 | Freshwater Lentic | MSKSVIISLLAQGNTATEILTILDMLVESIVEENID |
| Ga0049083_102886553 | 3300005580 | Freshwater Lentic | MSKSVILSLLVQGNTAAEILTILDMLVESIVEENIDSCAEVFAI* |
| Ga0049081_100397262 | 3300005581 | Freshwater Lentic | MSKSVILSLLAQGNTGTEILSILDTLVADIEQENIDDVAEYYAAL* |
| Ga0049081_102148441 | 3300005581 | Freshwater Lentic | MSKSVILSLLAQGNTGTEILGILDTLIADIEQENIDDVAEYYAAL* |
| Ga0049080_100161892 | 3300005582 | Freshwater Lentic | MSLSVALSLLAQGNNGDQILQILDTLVADIEQEGINSCAEVFEV* |
| Ga0049080_100265223 | 3300005582 | Freshwater Lentic | MSKSVILSLLAQGNSGTEILTILDTLVADIEQENIDDVAEYYAAL* |
| Ga0049085_101448522 | 3300005583 | Freshwater Lentic | FVIMSKSVIISLLAQGNTATEILTILDMLVESIVEENIDSCAEVFAI* |
| Ga0049085_101479272 | 3300005583 | Freshwater Lentic | MSKSVILSLLAQGNTATEILTILDMLVESIVEENINDVAGYYAAL* |
| Ga0049085_102289101 | 3300005583 | Freshwater Lentic | MSKSVILSLLAQGNTATEILTILDMLVESIVEENIDNCAEVF |
| Ga0049082_100976003 | 3300005584 | Freshwater Lentic | MSKSVIISLLAQGNTATEILTILDMLVESIVEENIDNC |
| Ga0049082_101135473 | 3300005584 | Freshwater Lentic | MSKSVILSLLAQGNTATEILTILDMLVESIVEENIDNCAE |
| Ga0049082_102454422 | 3300005584 | Freshwater Lentic | MSKSVILSLLAQGNTATEILTILDMLVESIVEENIDNCAEVFA |
| Ga0079957_13545062 | 3300005805 | Lake | MSKNVILSLLAQGNTGDEILNILDVIVADIEQENINSCAEVFEV* |
| Ga0074475_105728245 | 3300005828 | Sediment (Intertidal) | MSKQVILSMLAQGNTGDELLSILDVIVSDIEQEGIDNCAEVFAN*STLTVHS* |
| Ga0074472_106206131 | 3300005833 | Sediment (Intertidal) | MSKQVILSMLAQGNTGDELLSILDVIVSDIEQEGIDNCAEVFAN*STLTV |
| Ga0073913_100030073 | 3300005940 | Sand | MSKSVVLSLLAQGNTGSEILTILDSIVADIEQENIDDVAAYFAAL* |
| Ga0073913_100302682 | 3300005940 | Sand | MSKSVILSLLAQGNTATEILTILDMLVESIVEENIDNCAEVFAI* |
| Ga0073926_100068582 | 3300005943 | Sand | MSKSVILSLLAQGNTGDEILSILDNIVEHIEQENINSCAEVFAA* |
| Ga0073926_100072952 | 3300005943 | Sand | MSKSVIISLLAQGNTATEILTILDMLVESIVEENIDNCAEVFAI* |
| Ga0073926_100575943 | 3300005943 | Sand | MSKSVVLSLLAQGNTGNEILTILDSIVADIEQENIDDVAAYFAAL* |
| Ga0073922_10206921 | 3300005955 | Sand | MSKSVVLSLLARGNTGNEILTILDNIVSDIEQENIDDVA |
| Ga0073921_10204143 | 3300005990 | Sand | MSKSVVLSLLARGNTGNEILTILDNIVSDIEQENIDDVAAYFAAL* |
| Ga0075471_1000740310 | 3300006641 | Aqueous | MSKSVILSLLSKGSTGNEILSILDVIVADIEQENIDSCAEVFAN* |
| Ga0099851_13000652 | 3300007538 | Aqueous | MSKTVILSMLAQGNTGDEILSILDVIVSDIEQEGIDSCAEVFAN* |
| Ga0099849_10417814 | 3300007539 | Aqueous | LVIMSKDVILSLLSKGSTGAEILQILDVIVEDIEQENINSCAEVFAAA* |
| Ga0099848_12514131 | 3300007541 | Aqueous | MSKSIAFSLLAQGNTGAEILEILDVIVADIEQENIDIVAEVFAV* |
| Ga0099846_10490623 | 3300007542 | Aqueous | MSKDVILSLLSKGNTGAEILQILDVIVEDIEQENINSCAEVFAAA* |
| Ga0102861_10173212 | 3300007544 | Estuarine | MSKSVVLSLLARGNTGNEILTILDSIVADIEQENIDDVAAYFAAL* |
| Ga0102913_10945951 | 3300007560 | Estuarine | MSKQVIFSMLAQGNTGDEILSILDVIVSDIEQEGIDSCAE |
| Ga0102914_10524382 | 3300007561 | Estuarine | MSKQVIFSMLAQGNTGDEILSILDVIVSDIEQEGIDSCAEVFAVN* |
| Ga0102918_10021887 | 3300007593 | Estuarine | MSKQVILSMLSQGNTGDELLSILDVIVADIEEEGINSCAEVFAVN* |
| Ga0102899_10415294 | 3300007706 | Estuarine | MSKQVILSMLSQGNTGDELLSILDVIVADIEEEGINSCAEVFA |
| Ga0108970_101308551 | 3300008055 | Estuary | MSKSVILSLLAQGNTATEILTILDMLVESIVEENIDNCAEV |
| Ga0108970_113405441 | 3300008055 | Estuary | MSKSVILSLLARGNTGNEILTILDNIVADIEQENIDDVAAYFAAL* |
| Ga0114344_11072992 | 3300008111 | Freshwater, Plankton | MSKTVILSMLAQGNTGDEILSILDVIVSDIEQEGIDSCAEVFAVN* |
| Ga0102891_12442271 | 3300008950 | Estuarine | YTVHITLDYIMSKQVIFSMLAQGNTGDEILSILDVIVSDIEQEGIDSCAEVFAN* |
| Ga0102816_10494533 | 3300008999 | Estuarine | MSKSVVLSLLARGNTGNEILTILDNIFSAIEQVNIDDVAAYFAAL* |
| Ga0105152_103382691 | 3300009039 | Lake Sediment | MSKSVILSLLAQGNTATEILTILDMLVESIVEENIDSCAEVFAI* |
| Ga0102830_10363993 | 3300009059 | Estuarine | MSKSVIISLLAQGNTATEILTILDMLVESIVEENIDSCAEVFAI* |
| Ga0105103_102790761 | 3300009085 | Freshwater Sediment | MSKQVILSMLAQGNTGDEILSILDVIVSDIEQEGIDSCAEVFAN* |
| Ga0105103_104467953 | 3300009085 | Freshwater Sediment | MSLSVALSLLAQGNNGDEILNILDTLVADIEQEGINSCAEV |
| Ga0114980_101175143 | 3300009152 | Freshwater Lake | MSKSVILSLLAQGNTGAEILSILDSIVADIEQENIDDVAAYFAAL* |
| Ga0114980_104610893 | 3300009152 | Freshwater Lake | MSKSVILSLLAQGNTGSEILTILDNIVADIEQENIDDAAAYFAAL* |
| Ga0114980_106924073 | 3300009152 | Freshwater Lake | MSKSLILSLLAQGNTGSEILTILDNIVADIEQENIDDAAAYFAAL* |
| Ga0114980_107557901 | 3300009152 | Freshwater Lake | MSKSLILSLLAQGNTGSEILTILDSIVADIEQENIDDAAAYFAAL* |
| Ga0114978_1000113811 | 3300009159 | Freshwater Lake | MSKSVILSLLAQGNTGTEILTILDMLVESIVEENINDVAEYYAAL* |
| Ga0114978_100445223 | 3300009159 | Freshwater Lake | MSKSVILSLLAQGDTATEILTILDMLVESIVEENIDNCAEVFAI* |
| Ga0114981_101612992 | 3300009160 | Freshwater Lake | MSKSVILSLLAQGNTGSEILTILDSIVADIEQENIDDVAAYFAAL* |
| Ga0105102_102393921 | 3300009165 | Freshwater Sediment | MSLFIALNLLAQGNNGDEILQILDILVADIEQEGINSCAEVFEV* |
| Ga0105102_102944893 | 3300009165 | Freshwater Sediment | MSLSVALSLLAQGNNGDEILNILDTLVSDIEQEGINSCAEVFEV* |
| Ga0105097_108885471 | 3300009169 | Freshwater Sediment | MSKSVMLTLLAQGNNGTEILTILDTLVADIEQDGINSCAEVFEV* |
| Ga0114979_102147563 | 3300009180 | Freshwater Lake | MSKSVILSLLAQGDTATEILTILDMLVESIVEENIDSCAEVFAI* |
| Ga0114974_100956061 | 3300009183 | Freshwater Lake | MSKSVILSLLAQGNTATEILTILDMLVESIVDENIDNCAEVFAI* |
| Ga0114974_104040201 | 3300009183 | Freshwater Lake | MSKSVILSLLARGNTGNEILTILDNIVSDIEQENIDDVAAYFAAL* |
| Ga0114974_106467161 | 3300009183 | Freshwater Lake | MSKSVILSLLAQGNTGAEILSILDTIVEHIEQEHIEQENIDSCAEVFAA* |
| Ga0127391_10663332 | 3300009450 | Meromictic Pond | MTLSNVLSLLAQGSNGNEILAILDVLVANIEQEGINSCAEVFEA* |
| Ga0127402_11032152 | 3300009451 | Meromictic Pond | MTLSTVLSLLAQGSNGNEILAILGVLVAGIEQEGINSCAEVFEA* |
| Ga0129348_10389143 | 3300010296 | Freshwater To Marine Saline Gradient | MSKDVILSLLSKGSTGAEILQILDVIVEDIEQENINSCAEVFAAA* |
| Ga0129345_13336822 | 3300010297 | Freshwater To Marine Saline Gradient | MSKDVILSLLSKGSTGAEILQILDVIVEDIEQENINSC |
| Ga0129333_100014638 | 3300010354 | Freshwater To Marine Saline Gradient | MSKTVILSMLAQGNTGDEILSILDVIVSDIEQDGIDSCAEVFAN* |
| Ga0129333_107767642 | 3300010354 | Freshwater To Marine Saline Gradient | MLAQGNTGDEILSILDVIVSDIEQEGIDSCAEVFVVN* |
| Ga0129333_112036182 | 3300010354 | Freshwater To Marine Saline Gradient | MSKQVILSMLAQGNTGDEILSILDVIVSDIEQEGIDSCAEVFAVN* |
| Ga0129336_103463402 | 3300010370 | Freshwater To Marine Saline Gradient | MSKTVILSMLAQGNTGDELLSILDVIVSDIEQDGIDSCAEVFAN* |
| Ga0153800_10001743 | 3300011995 | Freshwater | MSKSVILSLLAQGNTGTEILGILDTLVADIEQENIDDVAEYYAAL* |
| Ga0157498_10704471 | 3300012666 | Freshwater, Surface Ice | MSKSVILSLLAQGNTGTEILGILDTLIADIEQENIDDVAEYYAA |
| Ga0138291_11006043 | 3300012770 | Freshwater Lake | MSKSLILSLLAQGNTGSEILTILDSIVADIEQENIDDVAAYFAAL* |
| Ga0164295_101990943 | 3300013014 | Freshwater | MSKSVILSLLAQGNNGAEILDILDTLVADIEQENNNDFAEYYATL* |
| Ga0177922_103374253 | 3300013372 | Freshwater | MSKSVILSLLAQGNTGTEILGILNTLIADIEQENIDDVAEYYAAL* |
| Ga0177922_104120721 | 3300013372 | Freshwater | NYFFFFIMSLSIALSLLAQGNNGAEILTILDTLVSDIEQEGINSCAEVFEV* |
| Ga0181362_10894523 | 3300017723 | Freshwater Lake | MSKSVILSLLAQGNTATEILTILDMLVESIVEENI |
| Ga0181358_10028509 | 3300017774 | Freshwater Lake | LAQGNNGAEILTILDTLVSDIEQEGINSCAEVFEV |
| Ga0181358_10139441 | 3300017774 | Freshwater Lake | KGESKSVILSLLAQGNTATEILTILDMLVESIVEENIDSCAEVFAI |
| Ga0181349_10267456 | 3300017778 | Freshwater Lake | SFVIMSKSVIISLLAQGNTATEILTILDMLVESIVEENIDSCAEVFAI |
| Ga0181346_11863841 | 3300017780 | Freshwater Lake | MSKSVIISLLAQGNTATEILTILDMLVESIVEENIDSGAEVFAIX |
| Ga0181348_11236711 | 3300017784 | Freshwater Lake | MSKSVILSLLAQGNTGDEILSILDNIVEHIEQENINSCAEVFAA |
| Ga0181348_11433723 | 3300017784 | Freshwater Lake | MSKSVILSLLAQGNTATEILTILDMLVESIVEENIDSCA |
| Ga0180438_1000084342 | 3300017971 | Hypersaline Lake Sediment | MTRSVALSLLAQGNTGAQILEILDTLVADLEQEGINDCAEVFEV |
| Ga0188884_10072182 | 3300018610 | Freshwater Lake | MSLSIALSLLAQGNTGNEILNILDVLVSDIEQEGINSCAEVFEV |
| Ga0188884_10105141 | 3300018610 | Freshwater Lake | MSLSVALSLLAQGNNGDEILTILDTLVADIEQEGINSCA |
| Ga0188851_10110631 | 3300018682 | Freshwater Lake | MSLSVALSLLAQGNNGDEILTILDTLVADIEQEGINSCAEVFEV |
| Ga0188848_10313871 | 3300018775 | Freshwater Lake | SVALSLLAQGNNGDEILTILDTLVSDIEQEGINSCAEVFEV |
| Ga0181359_10000543 | 3300019784 | Freshwater Lake | MSKSVILSLLAQGNTATEILTILDMLVESIIEENIDSCAEVYNTQY |
| Ga0181359_10153574 | 3300019784 | Freshwater Lake | MSLSIALSLLAQGNNGAEILTILDTLVSDIEQEGINSCAEVFEV |
| Ga0181359_10943101 | 3300019784 | Freshwater Lake | MSKSVILSLLDQGNTATEILTILDMLVESIVDENIDNCAEVFAI |
| Ga0181359_12106961 | 3300019784 | Freshwater Lake | MSKSVILSLLAQGNTATEILTILDMLVESIVEENIDNCAEVFAI |
| Ga0207193_100047941 | 3300020048 | Freshwater Lake Sediment | MSKSVILSLLAQGNNGNEILSILDSIVADIEQEGIDSCAEVFDAA |
| Ga0211736_1005140415 | 3300020151 | Freshwater | MSKQVILSMLAQGNTGDEILSILDVIVSDIEQEGIDSCAEVFAN |
| Ga0211734_102700583 | 3300020159 | Freshwater | MSKSIALSLLAQGNTGNDILSILDIIVSDIEQAGIDSCAEVFAA |
| Ga0211734_108832152 | 3300020159 | Freshwater | MSKQVILSMLAQGNTGDEILQILDVIVSDIEQEGIDSCAEVFAN |
| Ga0211726_108720612 | 3300020161 | Freshwater | MSKQVILSMLAQGNTGDEILSILDVIVSDIEQEGIDSCAEIFAN |
| Ga0211735_1075153962 | 3300020162 | Freshwater | MTLSVALSLLAQGNNGDEILTILNTLVSDIEQEGINSCAEVFEV |
| Ga0211729_110293931 | 3300020172 | Freshwater | MSKSVILSLLAQGNTGTEILTILDSIVESIVQENIDSCAEVFAV |
| Ga0194133_100613938 | 3300021091 | Freshwater Lake | MSKSVILSLLAQGNTGDEILSILDVIVSDIEQEGIDSCAEVFAN |
| Ga0210295_10915746 | 3300021323 | Estuarine | MSKQVILSMLSQGNTGDELLSILDVIVADIEEEGINSCAEVFAVN |
| Ga0210295_11525525 | 3300021323 | Estuarine | MSKQVILSMLAQGNTGDELLSILDVIVSDIEQEGIDNCAEVFANXSTLTVHS |
| Ga0213866_100001657 | 3300021425 | Seawater | MSLSIALSLLAQGNNGNEILDILDTLVVDIEQEGINSCAEVFEV |
| Ga0213866_100842612 | 3300021425 | Seawater | MTLSTVLSLLAQGSNGNEILAILDVLVADIEQEGINSCAEVFEV |
| Ga0222715_104540511 | 3300021960 | Estuarine Water | MSKSVVLSLLAQGNTGSEILTILDSIVADIEQENIDDVATYFAAL |
| Ga0222714_102772273 | 3300021961 | Estuarine Water | LSLLAQGNTATEILTILDMLVESIVEENIDSCAEVFAI |
| Ga0222714_103239992 | 3300021961 | Estuarine Water | MSKSVILSLLAQGNTGTEILGILNTLIADIEQENIDDVAEYYAAL |
| Ga0222713_104232212 | 3300021962 | Estuarine Water | MSKSVILSLLAQGNTGTEILGILDTLIADIEQENIDDVAEYYAAL |
| Ga0222713_105027582 | 3300021962 | Estuarine Water | MSKDVILSLLSKGNTGTEILQILDVIVEDIVQENIDSCAEVFAAA |
| Ga0222713_108136392 | 3300021962 | Estuarine Water | ILSLFAQGNTATEILTILDMLVESIVEENIDSCAEVFAI |
| Ga0196905_10507662 | 3300022198 | Aqueous | MSKDVILSLLSKGNTGAEILQILDVIVEDIEQENINSCAEVFAAA |
| Ga0196905_11744351 | 3300022198 | Aqueous | MTRSIALSLLRQGNTGTDILSILDVIVSDIEQEGINSCAEVFATSDVIEFX |
| Ga0210292_1078441 | 3300022353 | Estuarine | MSKQVILSMLAQGNTGDELLSILDVIVSDIEQEGIDNCAEVFAN |
| Ga0181351_10958174 | 3300022407 | Freshwater Lake | MSKSVIISLLAQGNTATEILTILDMLVESIVEENIDNCAEVFAI |
| Ga0210003_10189198 | 3300024262 | Deep Subsurface | MSLSIALSLLAQGNNGNEILNILDTLVADLEQDGINSCAEVFEV |
| Ga0244775_1000098376 | 3300024346 | Estuarine | MSKSVVLSLLARGNTGNEILTILDNIVSDIEQENIDDVAAYFAAL |
| Ga0244775_101357911 | 3300024346 | Estuarine | MSKSVILSLLAQGNTATEILTILDMLVESIVEENINDVAGYYAAL |
| Ga0244776_101727901 | 3300024348 | Estuarine | MSKSVILSLLAQGNTATEILTILDMLVESIVEENIDSCAEVFAIX |
| Ga0255228_10144615 | 3300024531 | Freshwater | MSKSMMFSLLAQGNTGDEILSILDVIVSDIEQENIDSCAEVFAD |
| Ga0208161_10852183 | 3300025646 | Aqueous | MSKDVILSLLSKGNTGAEILQILDVIVEDIEQENINSCAEV |
| Ga0208161_11708451 | 3300025646 | Aqueous | MSKDVILSLLSKGSTGAEILQILDVIVEDIEQENINSCAEVFAAA |
| Ga0208795_11332452 | 3300025655 | Aqueous | MSKDVILSLLSKGSTGAEILQILDVIVEDIEQENINSCA |
| Ga0208784_100028814 | 3300025732 | Aqueous | MSKSVILSLLSKGSTGNEILSILDVIVADIEQENIDSCAEVFAN |
| Ga0209850_10003857 | 3300026931 | Sand | MSKSVVLSLLAQGNTGSEILTILDSIVADIEQENIDDVAAYFAAL |
| Ga0255067_10316571 | 3300027129 | Freshwater | MSKSVILSLLAQGNTGDEILSILDTIVESIEQENIDSCAEVFAA |
| Ga0255067_10487191 | 3300027129 | Freshwater | MSKSVILSLLARGNTGNEILTILDNIVADIEQENI |
| Ga0255102_10508321 | 3300027144 | Freshwater | MSKSVILSLLAQGNTGTEILSILDTLVADIEQENIDDVAE |
| Ga0208800_10212562 | 3300027193 | Estuarine | MSKSVIISLLAQGNTATEILTILDMLVESIVEENIDNCAEVFAIX |
| Ga0208926_10607541 | 3300027205 | Estuarine | MSKSVVLSLLARGNTGNEILTILDSIVADIEQENIDDVAAYFAAL |
| Ga0208806_10954932 | 3300027242 | Estuarine | YCTFDRIMSKQVILSMLSQGNTGDELLSILDVIVADIEEEGINSCAEVFAVN |
| Ga0208932_10798032 | 3300027256 | Estuarine | MSKQVILSMLAQGNTGDEILSILDVIVSDIEQEGIDSCAEVFAVNXQLHS |
| Ga0255087_10806871 | 3300027337 | Freshwater | MSKSLILSLLAQGNTGDEILSILDTIVESIEQENIDSCAEVFAA |
| Ga0255086_10235263 | 3300027486 | Freshwater | MSKSVVLSLLARGNEILTILDNIVSDIEQENIDDVAAYFAAL |
| Ga0209552_10000756 | 3300027563 | Freshwater Lake | MSKSVILSLLAQGNTATEILTILDMLVESIVEENIDNCAEVYNTQY |
| Ga0208974_10061216 | 3300027608 | Freshwater Lentic | MSLSVALSLLAQGNNGDQILQILDTLVADIEQEGINSCAEVFEV |
| Ga0208974_10431782 | 3300027608 | Freshwater Lentic | MSKSVILSLLAQGNSGTEILTILDTLVADIEQENIDDVAEYYAAL |
| Ga0208133_11155021 | 3300027631 | Estuarine | MSLSIALSLLAQGNNGNEILDILDTLVADIEQEGINSCAEVFEVXM |
| Ga0209356_10289512 | 3300027644 | Freshwater Lake | MSKSVILSLLDQGNTATEILTILDMLVESIVDENIDNCAEVFAIX |
| Ga0208975_10828371 | 3300027659 | Freshwater Lentic | MILSLLAQGNTGTEILSILDTLVADIEQENIDDVAEYYAAL |
| (restricted) Ga0247836_10273877 | 3300027728 | Freshwater | MSKSVILSLLAQGNSGTEILSILDALVADIEQENIDDVAEYYAAL |
| Ga0209442_12635772 | 3300027732 | Freshwater Lake | MSKSVILSLLAQGNTATEILTILDMLVESIVEENID |
| Ga0209087_13266142 | 3300027734 | Freshwater Lake | MSKSVILSLLAQGDTATEILTILDMLVESIVEENIDNCAEVFAI |
| Ga0209190_12486292 | 3300027736 | Freshwater Lake | MSKSVILSLLAQGNTATEILTILDMLVESIVEDNIDSCAEVFAI |
| Ga0209444_101394842 | 3300027756 | Freshwater Lake | QLTQLSFVIMSKSVILSLLAQGTTATEILTILDMLVESIVEENIDDVAGYYAVL |
| Ga0209296_12060561 | 3300027759 | Freshwater Lake | MSKSLILSLLAQGNTGSEILTILDSIVADIEQENIDDAAAYFAAL |
| Ga0209296_13568271 | 3300027759 | Freshwater Lake | MSKSVILSLLAQGNTATEILTILDMLVESIVEENIDSC |
| Ga0209088_100218708 | 3300027763 | Freshwater Lake | MSKSVILSLLAQGNTGSEILTILDSIVADIEQENIDDVAAYFAAL |
| Ga0209088_101243232 | 3300027763 | Freshwater Lake | MSKSVILSLLAQGNTGSEILTILDNIVADIEQENIDDAAAYFAAL |
| Ga0209088_103807641 | 3300027763 | Freshwater Lake | MSKSVILSLLAQGNTGDEILSILDNIVEHIEQENI |
| Ga0209972_100145138 | 3300027793 | Freshwater Lake | MSKTVILSMLAQGNTGDEILSILDVIVSDIEQEGIDSCAEVFAVN |
| Ga0209353_100805803 | 3300027798 | Freshwater Lake | MSKSVILSLLAQGNSATEILTILDMLVESIVEENIDSCAEVFAI |
| Ga0209354_100558584 | 3300027808 | Freshwater Lake | VIMSKSVILSLLAQGTTATEILTILDMLVESIVEENIDDVAGYYAAL |
| Ga0209230_106778332 | 3300027836 | Freshwater And Sediment | ILSLLAQGNTGTEILSILDTLVADIEQENIDDVAEYYAAL |
| Ga0209550_100974426 | 3300027892 | Freshwater Lake | VILSLLAQGNTATEILTILDMLVESIVEENIDSCAEVFAI |
| Ga0209893_10060792 | 3300027940 | Sand | MTRSIALSLLAQGNTGDEILSILDNIVEHIEQENINSCAEVFAA |
| Ga0209299_10178961 | 3300027974 | Freshwater Lake | LSLLAQGNTGAEILSILDSIVADIEQENIDDVAAYFAAL |
| (restricted) Ga0247834_10545132 | 3300027977 | Freshwater | MSKSVILSLLAQGNTGTEILSILDTLIADIEQENINDVAEYYAAL |
| (restricted) Ga0247834_12760562 | 3300027977 | Freshwater | MSKSVILSLLAQGNTATEILTILDMLVESIVEENIDDVAGYYAAL |
| Ga0265595_12241991 | 3300028191 | Saline Water | MSKSVILSLLAQGNTATEILTILDMLVESIVEENIDSCAEVF |
| (restricted) Ga0247839_13559162 | 3300028553 | Freshwater | MLSTFFVIMSKSVILSLLAQGNTGTEIMGILDTLIADIEQEN |
| (restricted) Ga0247843_10343711 | 3300028569 | Freshwater | MSKSVILSLLAQGNTATEILSILDTLVADIEQENIDDVAEYYAAL |
| (restricted) Ga0247840_101181334 | 3300028581 | Freshwater | MSKSVILSLLAQGNTGTEIMGILDTLIADIEQENINDVAEYYAAL |
| (restricted) Ga0247840_105025492 | 3300028581 | Freshwater | LTHGYRVILSLLAQGNTATEILTILDMLVESIVEENIDDVAGYYAAL |
| (restricted) Ga0247842_105376762 | 3300029268 | Freshwater | MSKSVILSLLAQGNSGTEILSILDTLVADIEQENIDDVAEYYAAL |
| Ga0119944_10374122 | 3300029930 | Aquatic | KNVILSLLAQGNNGAEILEILDVIVADIEQENIDSVAEVFAA |
| Ga0119944_10483731 | 3300029930 | Aquatic | MSKSVILSLLSKGNTGDEILSILDVIVADIEQENIESCAEVFAN |
| Ga0119945_10300642 | 3300029933 | Aquatic | MSKNVILSLLAQGNNGTEILEILDVIVADIEQENIDSVAEVFAA |
| Ga0307488_100664383 | 3300031519 | Sackhole Brine | MSLSVALSLLAQGNNGDEILTILDTLVSDIEQDGINSCAEVFEV |
| Ga0307488_105798621 | 3300031519 | Sackhole Brine | LIMSKSVVLSLLAQGNTGNEILTILDTIVEDITQENIDSCAEVFAA |
| Ga0307380_110095302 | 3300031539 | Soil | MRLIDTHPRTLVYSFFLIMSKSVILSLLAQGNTGTEILTILDTIVESIVQENIDSCAEVFAV |
| Ga0315291_104937491 | 3300031707 | Sediment | VILSLLAQGNTATEILTILDMLVESIVEENIDDVAGYYAAL |
| Ga0315291_107499331 | 3300031707 | Sediment | MTLSVALSLLAQGNNGDEILTILNTLVADIEQEGINSCAEVFEVXI |
| Ga0315291_114896022 | 3300031707 | Sediment | MSLSVALSLLAQGNNGDEILTILDTLVADIEQDGINSCAEVFEV |
| Ga0315293_103440933 | 3300031746 | Sediment | ILSLLAQGNTGAEILSILDTIVEHIEQENIDSCAEVFAA |
| Ga0315293_104150111 | 3300031746 | Sediment | MSKSVILSLLAQGNTGNEILSILDTIVSDIEQEGIDSCAEVFAA |
| Ga0315293_106191402 | 3300031746 | Sediment | MSKSVILSLLAQGNTGNEILTILDSIVSDIEQANIDSCAEVFEV |
| Ga0315293_112389952 | 3300031746 | Sediment | MSNSIALSLLAQGNTGNEILTILDNIVSDIEQENIDSCAEVFAA |
| Ga0315293_112751321 | 3300031746 | Sediment | LSVALSLLAQGNNGDEILTILDTLVADIEQEGINSCAEVFEV |
| Ga0315288_106906881 | 3300031772 | Sediment | MSLSIALSLLAQGNNGAEILTILDTLVSDIEQEGIN |
| Ga0315909_107925602 | 3300031857 | Freshwater | MSKTVILSMLAQGNTGDEILSILDVIVSDIEQEGIDSCAEVFEGA |
| Ga0315284_109332851 | 3300032053 | Sediment | MSLSVALSLLAQGNNGDQILQILDTLVADIEQDGINSCAEIFEV |
| Ga0315284_114005182 | 3300032053 | Sediment | MSLSIALSLLAQGNNGNEILNILDTLVADIEQDGINSCAEVFEV |
| Ga0316616_1021362853 | 3300033521 | Soil | MSKSIALSLLAQGNTGDEILSILDVIESTVIEENIDSVAEVFAAV |
| Ga0334994_0352804_205_342 | 3300033993 | Freshwater | MSKQVILSMLAQGNTGDEILSILDVIVSDIEQEGIDSCAEVFAVN |
| Ga0334996_0013139_92_226 | 3300033994 | Freshwater | MSKQVILSMLAQGNTGDELLSILDVIVSDIEQEGIDSCAEVFAN |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |