| Basic Information | |
|---|---|
| Family ID | F025844 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 200 |
| Average Sequence Length | 43 residues |
| Representative Sequence | VRAETRHQLKQDRFSRATIGAAEATVHWSVEHQSKLIIG |
| Number of Associated Samples | 171 |
| Number of Associated Scaffolds | 200 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 96.97 % |
| % of genes near scaffold ends (potentially truncated) | 98.00 % |
| % of genes from short scaffolds (< 2000 bps) | 88.50 % |
| Associated GOLD sequencing projects | 165 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.500 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (14.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.500 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.22% β-sheet: 0.00% Coil/Unstructured: 44.78% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 200 Family Scaffolds |
|---|---|---|
| PF01258 | zf-dskA_traR | 43.50 |
| PF13186 | SPASM | 3.50 |
| PF04389 | Peptidase_M28 | 3.00 |
| PF07478 | Dala_Dala_lig_C | 2.50 |
| PF01434 | Peptidase_M41 | 2.00 |
| PF05402 | PqqD | 1.50 |
| PF00117 | GATase | 1.00 |
| PF10282 | Lactonase | 1.00 |
| PF09976 | TPR_21 | 1.00 |
| PF00156 | Pribosyltran | 1.00 |
| PF00583 | Acetyltransf_1 | 1.00 |
| PF02780 | Transketolase_C | 0.50 |
| PF04237 | YjbR | 0.50 |
| PF01594 | AI-2E_transport | 0.50 |
| PF01695 | IstB_IS21 | 0.50 |
| PF00154 | RecA | 0.50 |
| PF02590 | SPOUT_MTase | 0.50 |
| PF03070 | TENA_THI-4 | 0.50 |
| PF04366 | Ysc84 | 0.50 |
| PF15956 | DUF4760 | 0.50 |
| PF01433 | Peptidase_M1 | 0.50 |
| PF04402 | SIMPL | 0.50 |
| PF14310 | Fn3-like | 0.50 |
| PF01797 | Y1_Tnp | 0.50 |
| PF00216 | Bac_DNA_binding | 0.50 |
| PF12706 | Lactamase_B_2 | 0.50 |
| PF01740 | STAS | 0.50 |
| PF04342 | DMT_6 | 0.50 |
| PF13620 | CarboxypepD_reg | 0.50 |
| PF03544 | TonB_C | 0.50 |
| PF02504 | FA_synthesis | 0.50 |
| PF12732 | YtxH | 0.50 |
| PF05598 | DUF772 | 0.50 |
| PF13439 | Glyco_transf_4 | 0.50 |
| PF00732 | GMC_oxred_N | 0.50 |
| PF00793 | DAHP_synth_1 | 0.50 |
| PF00708 | Acylphosphatase | 0.50 |
| PF00196 | GerE | 0.50 |
| PF00072 | Response_reg | 0.50 |
| COG ID | Name | Functional Category | % Frequency in 200 Family Scaffolds |
|---|---|---|---|
| COG1734 | RNA polymerase-binding transcription factor DksA | Transcription [K] | 43.50 |
| COG0465 | ATP-dependent Zn proteases | Posttranslational modification, protein turnover, chaperones [O] | 2.00 |
| COG3471 | Predicted secreted (periplasmic) protein | Function unknown [S] | 0.50 |
| COG0308 | Aminopeptidase N, contains DUF3458 domain | Amino acid transport and metabolism [E] | 0.50 |
| COG3169 | Uncharacterized membrane protein, DMT/DUF486 family | Function unknown [S] | 0.50 |
| COG2968 | Uncharacterized conserved protein YggE, contains kinase-interacting SIMPL domain | Function unknown [S] | 0.50 |
| COG2930 | Lipid-binding SYLF domain, Ysc84/FYVE family | Lipid transport and metabolism [I] | 0.50 |
| COG2859 | Outer membrane channel-forming protein BP26/OMP28, SIMPL family | Cell wall/membrane/envelope biogenesis [M] | 0.50 |
| COG2315 | Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family | Transcription [K] | 0.50 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.50 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.50 |
| COG1576 | 23S rRNA pseudoU1915 N3-methylase RlmH | Translation, ribosomal structure and biogenesis [J] | 0.50 |
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.50 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.50 |
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 0.50 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.50 |
| COG0468 | RecA/RadA recombinase | Replication, recombination and repair [L] | 0.50 |
| COG0416 | Acyl-ACP:phosphate acyltransferase (fatty acid/phospholipid biosynthesis) | Lipid transport and metabolism [I] | 0.50 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.50 % |
| Unclassified | root | N/A | 5.50 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000651|AP72_2010_repI_A10DRAFT_1022939 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300001305|C688J14111_10305381 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300001593|JGI12635J15846_10476805 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 740 | Open in IMG/M |
| 3300001867|JGI12627J18819_10027349 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2349 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100832112 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300004114|Ga0062593_103194938 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300004479|Ga0062595_101660330 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300004971|Ga0072324_1295396 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300005172|Ga0066683_10853022 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300005174|Ga0066680_10287858 | Not Available | 1048 | Open in IMG/M |
| 3300005176|Ga0066679_10012065 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4316 | Open in IMG/M |
| 3300005533|Ga0070734_10348982 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300005542|Ga0070732_10203338 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1184 | Open in IMG/M |
| 3300005556|Ga0066707_10646731 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300005598|Ga0066706_11197093 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300005602|Ga0070762_10037462 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2626 | Open in IMG/M |
| 3300005617|Ga0068859_102148470 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300006028|Ga0070717_10158414 | All Organisms → cellular organisms → Bacteria | 1963 | Open in IMG/M |
| 3300006028|Ga0070717_11640235 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300006028|Ga0070717_12080051 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300006031|Ga0066651_10640534 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300006032|Ga0066696_10791472 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300006050|Ga0075028_100397906 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300006052|Ga0075029_100092259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1808 | Open in IMG/M |
| 3300006052|Ga0075029_100899412 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300006057|Ga0075026_100474950 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300006059|Ga0075017_100329934 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1132 | Open in IMG/M |
| 3300006172|Ga0075018_10014325 | All Organisms → cellular organisms → Bacteria | 2983 | Open in IMG/M |
| 3300006174|Ga0075014_100126516 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1223 | Open in IMG/M |
| 3300006755|Ga0079222_11183047 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 682 | Open in IMG/M |
| 3300006796|Ga0066665_10533971 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300006796|Ga0066665_11536001 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300006852|Ga0075433_10052926 | All Organisms → cellular organisms → Bacteria | 3538 | Open in IMG/M |
| 3300006871|Ga0075434_102577355 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300006893|Ga0073928_10066996 | All Organisms → cellular organisms → Bacteria | 3136 | Open in IMG/M |
| 3300006893|Ga0073928_10763309 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300009038|Ga0099829_10289844 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1341 | Open in IMG/M |
| 3300009088|Ga0099830_10962427 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300009093|Ga0105240_10087595 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3813 | Open in IMG/M |
| 3300009093|Ga0105240_10369590 | Not Available | 1622 | Open in IMG/M |
| 3300009137|Ga0066709_100620940 | All Organisms → cellular organisms → Bacteria | 1543 | Open in IMG/M |
| 3300009137|Ga0066709_100695758 | All Organisms → cellular organisms → Bacteria | 1461 | Open in IMG/M |
| 3300009137|Ga0066709_102874645 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300009624|Ga0116105_1140121 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 634 | Open in IMG/M |
| 3300009629|Ga0116119_1182877 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300009638|Ga0116113_1154619 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300009672|Ga0116215_1411917 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300010360|Ga0126372_11865218 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300010366|Ga0126379_10437603 | All Organisms → cellular organisms → Bacteria | 1366 | Open in IMG/M |
| 3300010373|Ga0134128_10713955 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1113 | Open in IMG/M |
| 3300010376|Ga0126381_104608643 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
| 3300010398|Ga0126383_10120352 | All Organisms → cellular organisms → Bacteria | 2391 | Open in IMG/M |
| 3300010398|Ga0126383_11192286 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300010398|Ga0126383_11631274 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300010403|Ga0134123_10965762 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 864 | Open in IMG/M |
| 3300012096|Ga0137389_11544138 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
| 3300012199|Ga0137383_10327361 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1122 | Open in IMG/M |
| 3300012200|Ga0137382_10242004 | All Organisms → cellular organisms → Bacteria | 1248 | Open in IMG/M |
| 3300012349|Ga0137387_10708979 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300012353|Ga0137367_10518969 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300012362|Ga0137361_10350910 | All Organisms → cellular organisms → Bacteria | 1354 | Open in IMG/M |
| 3300012363|Ga0137390_11411387 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300012363|Ga0137390_11428740 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300012907|Ga0157283_10238556 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300012917|Ga0137395_10684770 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
| 3300012923|Ga0137359_10630070 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300012927|Ga0137416_11191724 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 686 | Open in IMG/M |
| 3300012930|Ga0137407_11808726 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300012944|Ga0137410_10338725 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1199 | Open in IMG/M |
| 3300012986|Ga0164304_10500683 | Not Available | 887 | Open in IMG/M |
| 3300013297|Ga0157378_10521277 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1190 | Open in IMG/M |
| 3300014325|Ga0163163_13249278 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300017822|Ga0187802_10052198 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1495 | Open in IMG/M |
| 3300017822|Ga0187802_10244003 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300017924|Ga0187820_1061965 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1027 | Open in IMG/M |
| 3300017927|Ga0187824_10321717 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
| 3300017932|Ga0187814_10379592 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300017933|Ga0187801_10341271 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300017939|Ga0187775_10402070 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300017940|Ga0187853_10279015 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300017943|Ga0187819_10036564 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2904 | Open in IMG/M |
| 3300017943|Ga0187819_10041700 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2719 | Open in IMG/M |
| 3300017955|Ga0187817_10378141 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300017955|Ga0187817_10950164 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300017961|Ga0187778_10821687 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 635 | Open in IMG/M |
| 3300017973|Ga0187780_10102565 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1970 | Open in IMG/M |
| 3300017975|Ga0187782_10129134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1872 | Open in IMG/M |
| 3300017994|Ga0187822_10059180 | All Organisms → cellular organisms → Bacteria | 1094 | Open in IMG/M |
| 3300018016|Ga0187880_1245454 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 791 | Open in IMG/M |
| 3300018022|Ga0187864_10318375 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300018026|Ga0187857_10046544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2244 | Open in IMG/M |
| 3300018047|Ga0187859_10035726 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2672 | Open in IMG/M |
| 3300018060|Ga0187765_11255005 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300018085|Ga0187772_10667992 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300018086|Ga0187769_11428643 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300018088|Ga0187771_10637231 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300018088|Ga0187771_11581777 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300018090|Ga0187770_11389060 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300019787|Ga0182031_1180847 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1426 | Open in IMG/M |
| 3300020061|Ga0193716_1210734 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300020579|Ga0210407_10148195 | All Organisms → cellular organisms → Bacteria | 1808 | Open in IMG/M |
| 3300020579|Ga0210407_10516856 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300020581|Ga0210399_10030134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4330 | Open in IMG/M |
| 3300020581|Ga0210399_10307177 | All Organisms → cellular organisms → Bacteria | 1324 | Open in IMG/M |
| 3300020581|Ga0210399_10722424 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300020583|Ga0210401_10541050 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
| 3300020583|Ga0210401_10607481 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 955 | Open in IMG/M |
| 3300021086|Ga0179596_10539009 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300021171|Ga0210405_10531309 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 920 | Open in IMG/M |
| 3300021401|Ga0210393_10078921 | All Organisms → cellular organisms → Bacteria | 2605 | Open in IMG/M |
| 3300021402|Ga0210385_10275978 | All Organisms → cellular organisms → Bacteria | 1241 | Open in IMG/M |
| 3300021402|Ga0210385_10581643 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
| 3300021403|Ga0210397_10067993 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2327 | Open in IMG/M |
| 3300021406|Ga0210386_10655096 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
| 3300021420|Ga0210394_10344301 | All Organisms → cellular organisms → Bacteria | 1309 | Open in IMG/M |
| 3300021445|Ga0182009_10007688 | All Organisms → cellular organisms → Bacteria | 3586 | Open in IMG/M |
| 3300021445|Ga0182009_10324869 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300021478|Ga0210402_11298565 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 655 | Open in IMG/M |
| 3300021479|Ga0210410_10551108 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
| 3300021479|Ga0210410_10696480 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300021559|Ga0210409_11683828 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300022467|Ga0224712_10367737 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300022530|Ga0242658_1195139 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300022532|Ga0242655_10115304 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300022722|Ga0242657_1082699 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300022722|Ga0242657_1124214 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300022722|Ga0242657_1174219 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300022726|Ga0242654_10254327 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300024177|Ga0247686_1040968 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300025469|Ga0208687_1018370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2011 | Open in IMG/M |
| 3300025500|Ga0208686_1069055 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella arctica | 789 | Open in IMG/M |
| 3300025506|Ga0208937_1048657 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
| 3300025579|Ga0207927_1045904 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1150 | Open in IMG/M |
| 3300025913|Ga0207695_10941774 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300025920|Ga0207649_10637798 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300025921|Ga0207652_10255591 | Not Available | 1580 | Open in IMG/M |
| 3300025925|Ga0207650_10492884 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
| 3300025931|Ga0207644_10773548 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300025937|Ga0207669_11783929 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300026088|Ga0207641_11576615 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300026142|Ga0207698_10720112 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
| 3300026309|Ga0209055_1047614 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1865 | Open in IMG/M |
| 3300026310|Ga0209239_1017379 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3638 | Open in IMG/M |
| 3300026328|Ga0209802_1297275 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300026524|Ga0209690_1109790 | Not Available | 1110 | Open in IMG/M |
| 3300026528|Ga0209378_1177657 | Not Available | 775 | Open in IMG/M |
| 3300026552|Ga0209577_10005030 | All Organisms → cellular organisms → Bacteria | 12386 | Open in IMG/M |
| 3300027158|Ga0208725_1055270 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 593 | Open in IMG/M |
| 3300027158|Ga0208725_1071406 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 505 | Open in IMG/M |
| 3300027172|Ga0208098_1031954 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300027330|Ga0207777_1083930 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300027371|Ga0209418_1016670 | All Organisms → cellular organisms → Bacteria | 1205 | Open in IMG/M |
| 3300027376|Ga0209004_1041141 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300027465|Ga0207626_102593 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300027545|Ga0209008_1094380 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300027583|Ga0209527_1009886 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2015 | Open in IMG/M |
| 3300027591|Ga0209733_1094077 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 760 | Open in IMG/M |
| 3300027625|Ga0208044_1165386 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300027629|Ga0209422_1029824 | All Organisms → cellular organisms → Bacteria | 1343 | Open in IMG/M |
| 3300027812|Ga0209656_10135879 | All Organisms → cellular organisms → Bacteria | 1249 | Open in IMG/M |
| 3300027826|Ga0209060_10153520 | All Organisms → cellular organisms → Bacteria | 1067 | Open in IMG/M |
| 3300027846|Ga0209180_10434788 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300027854|Ga0209517_10418331 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300027875|Ga0209283_10489343 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300027894|Ga0209068_10139395 | All Organisms → cellular organisms → Bacteria | 1306 | Open in IMG/M |
| 3300027895|Ga0209624_10559150 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300027911|Ga0209698_10383682 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1100 | Open in IMG/M |
| 3300028047|Ga0209526_10711790 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300028736|Ga0302214_1022900 | Not Available | 1263 | Open in IMG/M |
| 3300028783|Ga0302279_10301612 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300029910|Ga0311369_10633632 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300029913|Ga0311362_10101502 | All Organisms → cellular organisms → Bacteria | 3809 | Open in IMG/M |
| 3300029952|Ga0311346_10556569 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1043 | Open in IMG/M |
| 3300030730|Ga0307482_1167314 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300030991|Ga0073994_12337407 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 667 | Open in IMG/M |
| 3300031231|Ga0170824_119213789 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1174 | Open in IMG/M |
| 3300031234|Ga0302325_12390430 | Not Available | 635 | Open in IMG/M |
| 3300031421|Ga0308194_10193287 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300031474|Ga0170818_113232803 | All Organisms → cellular organisms → Bacteria | 1372 | Open in IMG/M |
| 3300031668|Ga0318542_10527983 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300031718|Ga0307474_11118241 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300031718|Ga0307474_11171684 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300031720|Ga0307469_10322602 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1283 | Open in IMG/M |
| 3300031720|Ga0307469_11398268 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300031753|Ga0307477_10299548 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
| 3300031890|Ga0306925_10361298 | All Organisms → cellular organisms → Bacteria | 1559 | Open in IMG/M |
| 3300031939|Ga0308174_11156305 | Not Available | 659 | Open in IMG/M |
| 3300031954|Ga0306926_10453895 | All Organisms → cellular organisms → Bacteria | 1579 | Open in IMG/M |
| 3300031996|Ga0308176_11733917 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300032039|Ga0318559_10339584 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300032180|Ga0307471_100972292 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1016 | Open in IMG/M |
| 3300032180|Ga0307471_102150363 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300032205|Ga0307472_102004529 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300032421|Ga0310812_10043740 | All Organisms → cellular organisms → Bacteria | 1699 | Open in IMG/M |
| 3300032421|Ga0310812_10258477 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300032782|Ga0335082_11488400 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300033158|Ga0335077_10496268 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1292 | Open in IMG/M |
| 3300034817|Ga0373948_0094701 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 697 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.50% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.50% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.00% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.50% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.50% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.00% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.50% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.00% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.50% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.50% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.50% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.50% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.50% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.00% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.00% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.50% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.50% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.50% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.50% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.50% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.50% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.50% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.50% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.50% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.50% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.50% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.50% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.50% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.50% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.50% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000651 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A10 | Environmental | Open in IMG/M |
| 3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004971 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 41 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009629 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 | Environmental | Open in IMG/M |
| 3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020061 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022530 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024177 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK27 | Environmental | Open in IMG/M |
| 3300025469 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025500 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025506 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025579 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027158 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027172 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF038 (SPAdes) | Environmental | Open in IMG/M |
| 3300027330 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 35 (SPAdes) | Environmental | Open in IMG/M |
| 3300027371 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027376 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027465 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-BECK03-A (SPAdes) | Environmental | Open in IMG/M |
| 3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028736 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_3 | Environmental | Open in IMG/M |
| 3300028783 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_3 | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300029913 | III_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029952 | II_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AP72_2010_repI_A10DRAFT_10229391 | 3300000651 | Forest Soil | VRAETRHQLKTDRFTQATIEAAEATAHWTAEHKSKLIAG |
| C688J14111_103053812 | 3300001305 | Soil | VRAEARHQLKQDRFSRATMHAAEQTVHWTVEHKGKLVIAGVVV |
| JGI12635J15846_104768052 | 3300001593 | Forest Soil | VRAETRHQLKQDRFSKATFEAAGNAAHWTVEHRSKVVAAVI |
| JGI12627J18819_100273493 | 3300001867 | Forest Soil | VRAETRHQLKSDRFTRATIGAAEATAHWTVEHKSKIVTAVVVA |
| JGIcombinedJ26739_1008321123 | 3300002245 | Forest Soil | VRAETRHQLKQDRFSRVTIDAAERTAHWSVEHKSKLVVAAIIV |
| Ga0062593_1031949382 | 3300004114 | Soil | VRAETRRQLKQDKFSKTTLQVAEQTVHWSAEHKGKLMAGAAIAL |
| Ga0062595_1016603301 | 3300004479 | Soil | VRAETRHQLKQDRFSRATIGAAEATVHWTVEHQSKLIAAAMVAV |
| Ga0072324_12953962 | 3300004971 | Peatlands Soil | VRAETRHSLKQDRFSRATIDAAERTAHWSVEHKNKLTVAAVI |
| Ga0066683_108530221 | 3300005172 | Soil | VRAETRHQLKQDRFSRATIDVAEKTVHWTVEHQSKLIVGAVILLALVTALLG |
| Ga0066680_102878581 | 3300005174 | Soil | VRAQTRHQLKQDRFRGATIGAAEATVHWSVEHKTKLAIAAIVTLIVVAG |
| Ga0066679_100120654 | 3300005176 | Soil | VRAQTRHQLKQDRFRGATIGAAEATVHWSVEHKTKLAIAAIVTLIVVAGA |
| Ga0070734_103489822 | 3300005533 | Surface Soil | VRAETRHQLKSDRFTRATIGAAEATAHWTVEHKSKIVMGVVAALVVLIAVG |
| Ga0070732_102033381 | 3300005542 | Surface Soil | VRAETRHQLKSDRFTRATIGAAEATAHWTVEHKSKIIVSVVVAAVVL |
| Ga0066707_106467311 | 3300005556 | Soil | VRAEARRQLKQDRFRGATIQVAENTVHWTVEHQSKLI |
| Ga0066703_108685431 | 3300005568 | Soil | VRAQTRHSLKEDRFSRTTIQVAERTADWTVEHKSKLIVGTLVVAVIVAAVLGGWYYLSQQ |
| Ga0066706_111970931 | 3300005598 | Soil | VRAETRHQLKQDRFSRVTIDAAERTVHWSVEHQKKLIIAAIVL |
| Ga0070762_100374624 | 3300005602 | Soil | VRAETRHQLKQDRFSKATFEAAGNAANWSEEHKTKLVVIVIAAVVIA |
| Ga0068859_1021484701 | 3300005617 | Switchgrass Rhizosphere | VRAETRHSLKEDRFSRATINAAERTVHWTVEHQKR |
| Ga0070717_101584143 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VRAETRHQLKTDRFTQATIGVAEATAHWTVEHKYK |
| Ga0070717_116402352 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VRAETRHSLKEDRFRVTTIEAAEKTAHWTAEHRSSLIVAAVVVVVLVA |
| Ga0070717_120800511 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VRAETRHQLKQDRFRGATIDAAEKTVHWSVEHKNKLFAAAVVALIV |
| Ga0066651_106405341 | 3300006031 | Soil | VRAQTRHQLKQDRFRGATIGAAEATIHWTVEHKTKLAVAAIVILV |
| Ga0066696_107914722 | 3300006032 | Soil | VRAETRHQLKQDRFSRATIDVAEKTVHWTVEHQSKLI |
| Ga0075028_1003979061 | 3300006050 | Watersheds | VRAETRHQLKQDRFSQVTIDAAENAAHWSVEHKSKLMVA |
| Ga0075029_1000922591 | 3300006052 | Watersheds | VRAETRHQLKQDRFRQGTLEAAENAAHWTVEHQSK |
| Ga0075029_1008994121 | 3300006052 | Watersheds | VRAETRHQLKEDRFSKATFEAAEKTVHWTQEHQSKLIVAVV |
| Ga0075026_1004749501 | 3300006057 | Watersheds | VRAETRHQLKTDRFTQATIGAAEATAHWTAEHKSKLIGGILIAA |
| Ga0075017_1003299343 | 3300006059 | Watersheds | VRAETRHQLKQDRFRQGTLEAAENAAHWTVEHQSKLIAAVIAVVVIA |
| Ga0075018_100143251 | 3300006172 | Watersheds | VRAETRHQMKQDRFSRVTIDAAERTAHWSVEHKSKLIIAAVAVLV |
| Ga0075014_1001265163 | 3300006174 | Watersheds | VRAETRHQLKQDRFRQGTLEAAENAAHWTVEHQSKL |
| Ga0079222_111830471 | 3300006755 | Agricultural Soil | VRAETRHSLKEDRFRGATIEATERAVHWTVEHKSKLVIAGI |
| Ga0066665_105339711 | 3300006796 | Soil | VRAETRRQLKQDRFSRTTLQVAEQTVHWTVEHQGKLIV |
| Ga0066665_115360011 | 3300006796 | Soil | VRAETRHQLKQDRFSRATIDVAEKTVHWTVEHQSKLIVGAVILLALVTALLGG |
| Ga0075433_100529261 | 3300006852 | Populus Rhizosphere | VRAETRHQLKTDKFTRTTIGVAEATAHWSVEHKSKIITG |
| Ga0075434_1025773552 | 3300006871 | Populus Rhizosphere | VRAETRHQLKQDRFSQATMGAAEATVHWTVEHKSKLIVGAVVLVVLLVA |
| Ga0073928_100669965 | 3300006893 | Iron-Sulfur Acid Spring | VRAETRHQLKQDRFSKVTFEAAGNAAHWSVEHQSKL |
| Ga0073928_107633091 | 3300006893 | Iron-Sulfur Acid Spring | VRAQTRHRLKEDRFSRATIGAAEATVHWSEEHKAKLIIGALILA |
| Ga0099829_102898443 | 3300009038 | Vadose Zone Soil | VRAETRHQLKEDRFSKATLHAAEQTVHWTVEHQSKLLIVGIVVAV |
| Ga0099830_109624271 | 3300009088 | Vadose Zone Soil | VRAETRHQLKQDRFSRTTIQVAEQTVHWTVEHKNKMIAGAIAL |
| Ga0105240_100875956 | 3300009093 | Corn Rhizosphere | VRAETRRQLKQDKFSKATLQVAEQTVHWSAEHKGKLIAGAV |
| Ga0105240_103695901 | 3300009093 | Corn Rhizosphere | VRAETRHRLKEDRFSRATMNAAEATVHWSEEHKSKLII |
| Ga0066709_1006209403 | 3300009137 | Grasslands Soil | VRAETRHRLKQDRFSRATIEAAEATAHWTVEHKGKLIIGSVVVIVLAAAILG |
| Ga0066709_1006957583 | 3300009137 | Grasslands Soil | VRAETRHRLKQDRFSRATIEAAEATAHWTVEHKGKLIIGSVVVIVLAA |
| Ga0066709_1028746451 | 3300009137 | Grasslands Soil | VRAETRHQLKQDRFSRVTIDAAERTVHWSVEHQKKLIIA |
| Ga0116105_11401211 | 3300009624 | Peatland | VRAETRHQLKQDRFSKATFEAAGNAAHWTVEHQSKVVAAVIA |
| Ga0116119_11828772 | 3300009629 | Peatland | VRAETRHQLKQDRFSKVTLEAAENAAHWTAEHQAKLVAAIIAVVVI |
| Ga0116113_11546191 | 3300009638 | Peatland | VRAETRHQLKEDRFSIATIHAAEATAHWSVEHKSTLTYGAIIVAV |
| Ga0116215_14119171 | 3300009672 | Peatlands Soil | MKQDRFSRVTIDAAERTAHWSVEHKSKLIIAAVVVAVAAAAVV |
| Ga0126372_118652181 | 3300010360 | Tropical Forest Soil | VRAETRHQLKTDRFTQATIGVAEATAHWTAEHKSKLVVGVGSA |
| Ga0126379_104376033 | 3300010366 | Tropical Forest Soil | LWIEGKYVRAETRHQLKSDRFTKATIGAAEATAHWS |
| Ga0134128_107139551 | 3300010373 | Terrestrial Soil | VRAQARHQLKQDKFSKTTIRVAENTVHWTQEHQSKLILA |
| Ga0126381_1046086431 | 3300010376 | Tropical Forest Soil | VRAETSHQLKTDRFSKATIQAAEQTVDWTVEHRSKLIVAAVVTII |
| Ga0126383_101203521 | 3300010398 | Tropical Forest Soil | VRAETRHQLKSDRFARGTIAAAEATAHWTSEHRSKLIAGIIAV |
| Ga0126383_111922861 | 3300010398 | Tropical Forest Soil | VRAEARRQLKEDRFSRATIDVAESAAHWTVEHKSTLIAAAVVVAVLVL |
| Ga0126383_116312742 | 3300010398 | Tropical Forest Soil | VRAETRHSLKEDRFSKATISAAEITVHWTAEHRKTLIAGAVALVLLV |
| Ga0134123_109657621 | 3300010403 | Terrestrial Soil | VRAQARHQLKEDKFSKTTIRVAENTVHWTQEHQSKLILAAGIL |
| Ga0137389_115441382 | 3300012096 | Vadose Zone Soil | VRAETRHQLKEDRFSKATLHAAEQTVHWTVEHQSKLLIAGIVVAV |
| Ga0137383_103273613 | 3300012199 | Vadose Zone Soil | VRAETRHQLKQDRFSKVTFEAAGNAAHWSVEHQSKLIAAVIAVIVI |
| Ga0137382_102420041 | 3300012200 | Vadose Zone Soil | VRAETRHQLKQDRFSKVTFEAAGNAAHWSVEHQSKLIAAVIAVIVIG |
| Ga0137387_107089791 | 3300012349 | Vadose Zone Soil | VRAEARRQLKQDRFRGATIQVAENTVHWTVEHQNKLIVVAAV |
| Ga0137367_105189691 | 3300012353 | Vadose Zone Soil | VRAETRHQLKEDRFSKATIQAAEKTVHWTVEHQSKLIAAAIA |
| Ga0137361_103509101 | 3300012362 | Vadose Zone Soil | VRAETRHQLKQDRFSKVTFEAAGNAAHWSEEHKSTLIAAAVAVVV |
| Ga0137390_114113871 | 3300012363 | Vadose Zone Soil | VRAQARHQLKQDRFSRATIDAAEATVHWSVEHKSKLIIGAVILVVVVTAGL |
| Ga0137390_114287401 | 3300012363 | Vadose Zone Soil | MYVRAQTRHRLKEDRFSRATIGAAEATVHWSEEHKAKLIIGALILA |
| Ga0157283_102385561 | 3300012907 | Soil | VRAETRHRLKEDRFSRATMNAAEATVHWSEEHKSKL |
| Ga0137395_106847702 | 3300012917 | Vadose Zone Soil | VRAETRHQLKQDRFSRATIDVAEKTVHWTVEHQSKLIVGAVILLALVTALL |
| Ga0137359_106300701 | 3300012923 | Vadose Zone Soil | VRAETRHQLKQDRFSKVTFEAAGNAAHWSVEHQSKLIAAVI |
| Ga0137416_111917241 | 3300012927 | Vadose Zone Soil | VRAETRHQLKQDRFSKVTFEAAGNAAHWSVEHQSKLI |
| Ga0137407_118087262 | 3300012930 | Vadose Zone Soil | VRAEARHQLKQDRFSRATIGAAEATVHWTVEHQAKLILGGVVL |
| Ga0137410_103387251 | 3300012944 | Vadose Zone Soil | VRAETRHQLKTDKFTRATIGAAEATAHWSLEHKSKIIAGVAI |
| Ga0164304_105006831 | 3300012986 | Soil | VRAETRHRLKEDKFSRATMNAAEATVHWSEEHKSKLIVGGLIL |
| Ga0157378_105212773 | 3300013297 | Miscanthus Rhizosphere | VRAETRHRLKEDKFSRATIGAAEATVHWSEEHKSRLI |
| Ga0163163_132492781 | 3300014325 | Switchgrass Rhizosphere | VRAETRRQLKQDKFSKTTLQVAEQTVHWSAKHKGKLMAGAAIALLV |
| Ga0157376_107063423 | 3300014969 | Miscanthus Rhizosphere | VRAETRRQLKQDKFSKTTLQVAEQTVHWSAEHKGKLMAGAAIALLVIGGAL |
| Ga0187802_100521981 | 3300017822 | Freshwater Sediment | VRAETRHQLKQDRFSKVTLEAAENAAHWTVEHQSKLI |
| Ga0187802_102440032 | 3300017822 | Freshwater Sediment | VRAETRHQLKQDRFSRTTIDVAERTVHWSAEHQNKLIVVAVIVLVL |
| Ga0187820_10619651 | 3300017924 | Freshwater Sediment | VRAETRHRLKEDKFSRATMGAAEATVHWTEEHKSRLII |
| Ga0187824_103217171 | 3300017927 | Freshwater Sediment | VRAETRHQLKQDKFSRATLEAAEATVHWSAEHQSKLLAGGVILLVLVGAFAGAWY |
| Ga0187814_103795921 | 3300017932 | Freshwater Sediment | VRAETRHQLKQDRFSRVTIDAAERTAHWSVEHKNKLVVVAVVVLVVAAAAAASWYY |
| Ga0187801_103412712 | 3300017933 | Freshwater Sediment | VRAETRHQLKQDRFSRTTIDVAEKTAHWSVEHKNTIAI |
| Ga0187775_104020702 | 3300017939 | Tropical Peatland | VRAETRHHLKQDAFSRAALGAAETTVHWTVEHKSKLLVGGVVAAVVLAGLLGS |
| Ga0187853_102790152 | 3300017940 | Peatland | VRAETRHQLKQDRFSKVTIEAAENAAHWSVEHQAKL |
| Ga0187819_100365641 | 3300017943 | Freshwater Sediment | VRAQTRHQLKTDRFRGATIDAAEMTVRWTVEHKNKLLVAVVIGFVVVSASI |
| Ga0187819_100417001 | 3300017943 | Freshwater Sediment | VRAETRHQLKQDRFSKVTIEAAENAAHWTVEHRAKLIAA |
| Ga0187817_103781411 | 3300017955 | Freshwater Sediment | VRAETRHQLKQDRFSRATIDAAERTAHWSVEHKNKLTVAAVVVVVVAAAVV |
| Ga0187817_109501641 | 3300017955 | Freshwater Sediment | VRAETRHQLKQDRFSKVTIEAAETAAHWTVEHQSKLIAAVIAVVVI |
| Ga0187778_108216871 | 3300017961 | Tropical Peatland | VRAETRHQLKTDRFSRVTIDAAERTAHWSAEHQKNLAIAGVVVLVAAALS |
| Ga0187780_101025653 | 3300017973 | Tropical Peatland | VRAQTRHQLKEDRFSKATIEVAEKTVHWSVEHQDKLIVA |
| Ga0187782_101291344 | 3300017975 | Tropical Peatland | VRAEARHQLKQDRFSKATLEAAEATVHWSQEHQSKLVAAGIV |
| Ga0187822_100591801 | 3300017994 | Freshwater Sediment | VRAETRHQLKQDRFSRATFGAAEATAHWTAEHQTKLIVGGIVLAI |
| Ga0187880_12454541 | 3300018016 | Peatland | VRAETRHQLKQDRFSKVTIEAAENAAHWSVEHQAKLIAAVI |
| Ga0187864_103183751 | 3300018022 | Peatland | VRAETRHQMKQDRFSRVTIDAAERTAHWSVEHKNKLMVAAVIV |
| Ga0187857_100465441 | 3300018026 | Peatland | VRAETRHQLKQDRFSKVTIEAAEKTAHWTVEHQSKLIIA |
| Ga0187859_100357263 | 3300018047 | Peatland | VRAETRHQLKTDRFSRATIDAAERTAHWSVEHKNKLAVA |
| Ga0187765_112550051 | 3300018060 | Tropical Peatland | VRAETRHQLKQDSFSRATIDAAERTAHWSVEHKDKLVVAGVVVL |
| Ga0187772_106679921 | 3300018085 | Tropical Peatland | VRAETRHQLKQDRFSRTTIDVAERTVHWSAEHQNKL |
| Ga0187769_114286431 | 3300018086 | Tropical Peatland | VRAEKRHQLKEDRFSRATIDAAEATVHWSVEHQNKLIAGGIALLV |
| Ga0187771_106372311 | 3300018088 | Tropical Peatland | VRAETRHQLKQDRFSKVTIEAAENAAHWTVEHRAKLIAAAIAVVV |
| Ga0187771_115817772 | 3300018088 | Tropical Peatland | VRAQTRHQLKEDRFSRATIDAAEATVHWSVEHQNKLIAGAIALAVVVAVVA |
| Ga0187770_113890602 | 3300018090 | Tropical Peatland | VRAEKRHQLKEDRFSRATIDAAEATVHWSVEHQNKLIAGGIALVVVV |
| Ga0182031_11808471 | 3300019787 | Bog | VRAETRHQLKQDRFSKVTIEAAENAAHWTAEHQSKVVAAVIAV |
| Ga0193716_12107342 | 3300020061 | Soil | KQDRFSRVTIDAAEATAHWSVEHKNKVIAGAAIVLVVAAAALAAGIS |
| Ga0210407_101481953 | 3300020579 | Soil | VRAETRHQLKQDRFSRVTIDAAERTAHWSVEHKNKLVVAAVVVLVVAAAAA |
| Ga0210407_105168561 | 3300020579 | Soil | VRAETRHQLKQDRFSRATIDAAERTAHWSVEHKNKLTAAVVMVLLLA |
| Ga0210399_100301341 | 3300020581 | Soil | VRAETRHQLKQDRFSKVTFEAAENAAHWSEEHKSTLILAAIAVVV |
| Ga0210399_103071773 | 3300020581 | Soil | VRAETRHQLKQDRFSRATIDAAERTAHWSVEHKNKLIV |
| Ga0210399_107224242 | 3300020581 | Soil | MKQDRFSRVTIDAAERTAHWSVEHKGKLTVAAVIVLVVAAAAAGTWYYLGQQD |
| Ga0210401_105410501 | 3300020583 | Soil | VRAETRHQLKQDRFSRVTIDAAERTAHWSVEHKNKLVVAAVVVLVVAAAAAASWY |
| Ga0210401_106074812 | 3300020583 | Soil | VRAETRHQLKQDRFSKVTFEAAGNAAHWSVEHQSKLIA |
| Ga0179596_105390091 | 3300021086 | Vadose Zone Soil | VRAETRHQLKQDRFSKVTFEAAENAAHWTVEHQSKLIVAAIAV |
| Ga0210405_105313092 | 3300021171 | Soil | VRAETRHQLKQDRFSKVTFEAAGNAAHWSVEHQSKLIAAVIVVIVI |
| Ga0210393_100789211 | 3300021401 | Soil | VRAETRHQLKTDRFSQATIDAAERTAHWSVEHKNKLVVAVVIVLV |
| Ga0210385_102759783 | 3300021402 | Soil | VRAETRHQLKTDQFSRVTIDAAERTAHWSVEHKSKLIAVAVAVLVVAIAV |
| Ga0210385_105816431 | 3300021402 | Soil | VRAETRHQLKQDRFSRVTIDAAERTAHWSVEHKNKLVVAAVVVLV |
| Ga0210397_100679931 | 3300021403 | Soil | VRAETRHQLKQDRFSRVTIDAAERTAHWSVEHKNKLVVAAVVVLIVAAAAAASW |
| Ga0210386_106550961 | 3300021406 | Soil | VRAETRHQLKQDRFSRVTIDAAERTAHWSVEHKNKLVVAAVVVLVVAAAA |
| Ga0210394_103443012 | 3300021420 | Soil | VRAETRHQLKTDRFSRATIDAAERTAHWSVEHKSKLAVAIV |
| Ga0182009_100076885 | 3300021445 | Soil | VRAETRHSLKEDRFSRATINAAERTVHWTVEHQKRLIIASA |
| Ga0182009_103248691 | 3300021445 | Soil | VRAETRHQLKQDKFSRATIGAAEATVHWTVEHQSKL |
| Ga0210402_112985651 | 3300021478 | Soil | VRAETRHQLKEDRFSKVTLEVAEKTAHWTADNQAKVIAGV |
| Ga0210410_105511081 | 3300021479 | Soil | VRAETRHQLKQDRFSRATFGAAGATVDWTVDHKSKLVVGAVTL |
| Ga0210410_106964802 | 3300021479 | Soil | MYVRAQTRHRLKEDRFSRATIGAAEATVHWSEEHKAKLIIG |
| Ga0210409_116838281 | 3300021559 | Soil | VRAETRHQMKQDRFSRVTIDAAERTAHWSVEHKGKLT |
| Ga0224712_103677372 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | VRAETRHQLKQDKFSKTTIEVAEQTFDWSIEHKSQLIVGGIVAAI |
| Ga0242658_11951391 | 3300022530 | Soil | VRAETRHQLKQDRFSRATIDAAERTAHWSVEHKNKLIAALAI |
| Ga0242655_101153042 | 3300022532 | Soil | MKQDRFSRVTIDAAERTAHWSVEHKSKLVIAAVIAVVVAAAVPGPGIS |
| Ga0242657_10826992 | 3300022722 | Soil | MKQDRFSRVTIDAAERTAHWSVEHKGKLTVAAVIVLVVAAAAAGT |
| Ga0242657_11242141 | 3300022722 | Soil | MKQERFSRVTIDAAERTAHWSVEHKNKLVIAAVIAVVVAAAAAGTW |
| Ga0242657_11742191 | 3300022722 | Soil | VRAETRHQMKQDRFSRVTIDAAERTAHWSVEHKNKLTVT |
| Ga0242654_102543271 | 3300022726 | Soil | VRAETRHQMKQDRFSRVTIDAAERTAHWSVEHKNKVILAA |
| Ga0247686_10409681 | 3300024177 | Soil | VRAETRRQLKTDRFSKVTIEAAEQTVHWTAEHRNTLIVAAIIVVIVVGA |
| Ga0208687_10183703 | 3300025469 | Peatland | VRAETRHQLKQDRFSKVTLEAAEKTANWTVEHQSK |
| Ga0208686_10690552 | 3300025500 | Peatland | VRAETRHQLKQDRFRKGTLEAAESAAHWTVEHQSKLI |
| Ga0208937_10486572 | 3300025506 | Peatland | VRAETRHQLKQDRFSKVTIEAAEKTAHWTVEHQSKLIIAVIAVIAIGAMA |
| Ga0207927_10459044 | 3300025579 | Arctic Peat Soil | VRAETRHQLKQDRFSKVTIEAAENAAHWTEEHKTKL |
| Ga0207695_109417742 | 3300025913 | Corn Rhizosphere | VRAETRRQLKQDKFSKATLQVAEQTVHWSAEHKGKLI |
| Ga0207649_106377982 | 3300025920 | Corn Rhizosphere | VRAETRHSLKEDRFSRATINAAERTVHWTVEHQKKLIIASAA |
| Ga0207652_102555911 | 3300025921 | Corn Rhizosphere | VRAETRHRLKEDRFSRATMNAAEATVHWSEEHKSKLIIGGLI |
| Ga0207650_104928841 | 3300025925 | Switchgrass Rhizosphere | VRAETRHSLKEDRFSRATINAAERTVHWTVEHQKKLIIAS |
| Ga0207644_107735481 | 3300025931 | Switchgrass Rhizosphere | VRAETRHSLKEDRFSRATINAAERTVHWTVEHQKKLIIASA |
| Ga0207669_117839292 | 3300025937 | Miscanthus Rhizosphere | VRAETRHRLKEDRFSRATMSAAEATVHWSEEHKSKLI |
| Ga0207641_115766152 | 3300026088 | Switchgrass Rhizosphere | VRAETRHSLKEDRFSRATINAAERTVHWTVEHQKK |
| Ga0207698_107201121 | 3300026142 | Corn Rhizosphere | VRAETRHSLKEDRFSRATINAAERTVHWTVEHQKKLIIASAAVV |
| Ga0209055_10476144 | 3300026309 | Soil | VRAQTRHSLKEDRFSRTTIQVAERTADWTVEHKSKLIVGTLVVVVIVA |
| Ga0209239_10173794 | 3300026310 | Grasslands Soil | VRAQTRHQLKQDRFRGATIGAAEATVHWSVEHKAKLAIAAIVILIVLAGAIG |
| Ga0209802_12972752 | 3300026328 | Soil | VRAETRHQLKTDRFTQATIGVAEATAHWTVEHKYKL |
| Ga0209690_11097901 | 3300026524 | Soil | VRAQTRHSLKEDRFSRTTIQVAERTADWTVEHKSKLIVGT |
| Ga0209378_11776572 | 3300026528 | Soil | VRAQTRHQLKQDRFRGATIGAAEATVHWSVEHKTKLAIAAIVILVVVAA |
| Ga0209577_1000503013 | 3300026552 | Soil | VRAQTRHSLKEDRFRGATIVAAERTAHWTVEHKNRLMIGAIVLTVL |
| Ga0208725_10552702 | 3300027158 | Forest Soil | VRAETRHQLKEDRFSKVTFQAAENAVHWSDEHRSTLIMAAI |
| Ga0208725_10714061 | 3300027158 | Forest Soil | VRAETRHQLKQDRFSKVTLEAAENAAHWSVEHQSKLIVATIAVVVIA |
| Ga0208098_10319542 | 3300027172 | Forest Soil | VRAETRHQLKSDRFTRATIGAAEATAHWTVEHKSKIVTS |
| Ga0207777_10839301 | 3300027330 | Tropical Forest Soil | VRAETRHQLKTDAFSRTTIEAAGSAVHWTVEHKTRLVSGAIAVLVALLAGVG |
| Ga0209418_10166701 | 3300027371 | Forest Soil | VRAETRHQLKTDRFTQATIGVAEATAHWTVEHKSKLILGVVVAVV |
| Ga0209004_10411412 | 3300027376 | Forest Soil | VRAETRHQLKTDRFTQATIGVAEATAHWTVEHKSKLILGVVVAVVV |
| Ga0207626_1025931 | 3300027465 | Soil | VRAETRHSLKEDRFSRATINAAERTVHWTVEHQKKLII |
| Ga0209008_10943801 | 3300027545 | Forest Soil | VRAETRHQLKQDRFSKVTFEAAEATVHWSQEHQSKLIVGAI |
| Ga0209527_10098861 | 3300027583 | Forest Soil | VRAEARHQLKEDRFSKVTFQAAEKTVHWTAEHQAKLIAAVIAVVVIA |
| Ga0209733_10940772 | 3300027591 | Forest Soil | VRAETRHQLKQDRFSKVTFEAAGNAAHWSVEHQSKLIAALIAIIVIG |
| Ga0208044_11653861 | 3300027625 | Peatlands Soil | VRAETRHQLKQDRFSKVTLEAAEKTAHWTVEHQAKLIAAVI |
| Ga0209422_10298241 | 3300027629 | Forest Soil | VRAETRHQLKQDRFSKVTFEAAGNAVHWTAEHQAKLIAAVI |
| Ga0209656_101358791 | 3300027812 | Bog Forest Soil | VRAETRHQMKEDRFSRATIEAAEKTVHWTVEHESKLLVVGIVVAVVAALA |
| Ga0209060_101535203 | 3300027826 | Surface Soil | VRAETRHQLKQDRFSQATMDVAEKTVHWSVEHQSNLIVAGVI |
| Ga0209180_104347882 | 3300027846 | Vadose Zone Soil | VRAETRHSLKQDRFSKATIRAAEQTAHWTAEHKLKLI |
| Ga0209517_104183311 | 3300027854 | Peatlands Soil | VRAETRHQLKQDRFSKVTIEAAENAAHWTVEHQAKLIAAVIA |
| Ga0209283_104893432 | 3300027875 | Vadose Zone Soil | VRAETRHQLKQDRFSRATIGAAEATVHWSVEHQSKLIIG |
| Ga0209068_101393951 | 3300027894 | Watersheds | VRAETRHSLKEDRFSKATIHAAENAVHWSVEHKKNLAIGIAAAVALVAIVLG |
| Ga0209624_105591503 | 3300027895 | Forest Soil | VRAETRHQLKQDRFSRVTIDAAERTAHWSVEHKNKLIIA |
| Ga0209698_103836822 | 3300027911 | Watersheds | VRAETRHQLKQDRFRQGTLEAAENAAHWTVEHQSKLIAAVIAVV |
| Ga0209526_107117901 | 3300028047 | Forest Soil | VRAETRHQLKQDRFSRVTIGAAEATVHWSVEHKSKLIIGGISVA |
| Ga0302214_10229003 | 3300028736 | Fen | VRAETRHQLKEDRFSKAAIGAAEKTVHWTVEHQSKLILAAVVVLVVA |
| Ga0302279_103016122 | 3300028783 | Bog | VRAEARHQLKQDRFSKVTFEAAGNAAHWSEEHKGTLIIAVVAI |
| Ga0311369_106336322 | 3300029910 | Palsa | VRAETRHQLKQDRFRKTTLDAAENAAHWTVEHQSKVIVGVIAVVVI |
| Ga0311362_101015021 | 3300029913 | Bog | VRTETHHQLKEDRFRAVTIHAAEATVHWSVEHKSKLIAAVVAVVVLIAAV |
| Ga0311346_105565691 | 3300029952 | Bog | VRTETHHQLKEDRFRAVTIHAAEATVHWSVEHKSKLIAAVVAVVVLIAAVSGTWY |
| Ga0307482_11673142 | 3300030730 | Hardwood Forest Soil | VRAEARHQLKQDRFSRATMHAAEQTVHWTVEHKGKLIIAGVVVAVVI |
| Ga0073994_123374072 | 3300030991 | Soil | VRAETRHQLKQDRFSKVTFEAAGNAAHWSVEHQSKLIAAV |
| Ga0170824_1192137891 | 3300031231 | Forest Soil | AFSRVTIDAAERTAHWSVEHRSTLTIAAVVVAVVLTAVIGGWY |
| Ga0302325_123904302 | 3300031234 | Palsa | VRAETRHQLKQDRFSKVTFEAAGNAAHWTAEHQTKLVV |
| Ga0308194_101932871 | 3300031421 | Soil | VRAETRHQLKQDRFSRATIGAAEATVHWTVEHQAKLILGGVVLVVLL |
| Ga0170818_1132328033 | 3300031474 | Forest Soil | VRAETRHQLKQDRFSQATIGAAEATVHWTVEHKTRLVFGGVALAVV |
| Ga0318542_105279832 | 3300031668 | Soil | VRAETRHQLKTDRFTQATIGAAEATAHWTVEHKSKLMIGGGAAVIL |
| Ga0307474_111182412 | 3300031718 | Hardwood Forest Soil | VRAETRHQLKQDRFSRATIDAAERTAHWSVEHKNKLIIAVVIVLAIVAA |
| Ga0307474_111716842 | 3300031718 | Hardwood Forest Soil | VRAETRHQLKTDRFSQATIDAAERTAHWSVEHKNKLVVAVVIVL |
| Ga0307469_103226021 | 3300031720 | Hardwood Forest Soil | VRAETRHRLKEDKFSRATIGAAEATVHWSEEHKSRLII |
| Ga0307469_113982681 | 3300031720 | Hardwood Forest Soil | VRAETRHQLKQDRFSQATFGAAEATVHWTVEHKSRL |
| Ga0307477_102995483 | 3300031753 | Hardwood Forest Soil | VRAETRHQLKTDRFTQATIGVAEATAHWTVEHKYKLVIGVVIAA |
| Ga0306925_103612981 | 3300031890 | Soil | VRAETRHQLKTDKFTRVTIDAAEATAHWSIQHKSKIITGVATLV |
| Ga0308174_111563051 | 3300031939 | Soil | VRAEARHQLKQDRFSRATMHAAEQTVHWTVEHQGKLIIAGIVVAVV |
| Ga0306926_104538953 | 3300031954 | Soil | VRAETRHQLKTDKFTRVTIDAAEATAHWSIQHKSK |
| Ga0308176_117339172 | 3300031996 | Soil | VRAETRRQLKEDKFSKATLQVAEQTVHWSAEHKGKVIAGA |
| Ga0318559_103395841 | 3300032039 | Soil | VRAETRHQLKTDRFTQATIGAAEATAHWTVEHKSKLMIGG |
| Ga0307471_1009722923 | 3300032180 | Hardwood Forest Soil | VRAETRHQLKTDRFTQATIGAAEATAHWTAEHKGKLAA |
| Ga0307471_1021503632 | 3300032180 | Hardwood Forest Soil | VRAETRHQLKQDRFSRATIGAAEATVHWSVEHKSKLILGGIAAAV |
| Ga0307472_1020045291 | 3300032205 | Hardwood Forest Soil | VRAETRHQLKTDRFTQATIGAAEATAHWTAEHKGKLAAGIGIAA |
| Ga0310812_100437401 | 3300032421 | Soil | VRAETRRQLKQDKFSRTTIQVAEQTVHWSVEHKGKVIAGAIV |
| Ga0310812_102584771 | 3300032421 | Soil | VRAETRHSLKEDRFSRATINAAERTVHWTVEHQKRLIIASAAVVVLIAAAVGIW |
| Ga0335082_114884001 | 3300032782 | Soil | VRAEARHQLKEDRFSKATIGAAENAVHWTVEHQSKLIAVAAAV |
| Ga0335077_104962681 | 3300033158 | Soil | VRAQTRHQLKEDRFSKATMQVAEKTVHWSVEHQNKLMVAAII |
| Ga0373948_0094701_588_695 | 3300034817 | Rhizosphere Soil | MRAETRHRLKEDRFSRATMNAAEATVHWSEEHKSKL |
| ⦗Top⦘ |