Metagenome / Metatranscriptome Family F025817

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F025817
Family Type	Metagenome / Metatranscriptome
Number of Sequences	200
Average Sequence Length	39 residues
Representative Sequence	MNQQAVQEWRRRGLNIAEVAFYSVLVLVIMLLSVYVPA
Number of Associated Samples	125
Number of Associated Scaffolds	200

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	83.42 %
% of genes near scaffold ends (potentially truncated)	24.00 %
% of genes from short scaffolds (< 2000 bps)	83.00 %
Associated GOLD sequencing projects	121
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.45

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (81.000 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil (19.500 % of family members)
Environment Ontology (ENVO)	Unclassified (47.000 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (66.500 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.45
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.45
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 200 Family Scaffolds
PF04392	ABC_sub_bind	12.50
PF06035	Peptidase_C93	9.00
PF08734	GYD	2.50
PF00311	PEPcase	2.50
PF00536	SAM_1	1.50
PF01479	S4	1.00
PF00881	Nitroreductase	1.00
PF00239	Resolvase	1.00
PF12680	SnoaL_2	1.00
PF00149	Metallophos	1.00
PF13463	HTH_27	0.50
PF03734	YkuD	0.50
PF07478	Dala_Dala_lig_C	0.50
PF13964	Kelch_6	0.50
PF13374	TPR_10	0.50
PF01548	DEDD_Tnp_IS110	0.50
PF13505	OMP_b-brl	0.50
PF11867	DUF3387	0.50
PF07690	MFS_1	0.50
PF00202	Aminotran_3	0.50
PF01047	MarR	0.50
PF04545	Sigma70_r4	0.50
PF00126	HTH_1	0.50
PF03466	LysR_substrate	0.50
PF02653	BPD_transp_2	0.50
PF13414	TPR_11	0.50
PF07110	EthD	0.50
PF01300	Sua5_yciO_yrdC	0.50
PF03992	ABM	0.50
PF02371	Transposase_20	0.50
PF07045	DUF1330	0.50
PF01966	HD	0.50
PF13586	DDE_Tnp_1_2	0.50
PF00375	SDF	0.50
PF01035	DNA_binding_1	0.50
PF00108	Thiolase_N	0.50
PF02866	Ldh_1_C	0.50
PF07729	FCD	0.50
PF13356	Arm-DNA-bind_3	0.50

COG ID	Name	Functional Category	% Frequency in 200 Family Scaffolds
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	12.50
COG3672	Predicted transglutaminase-like protein	Posttranslational modification, protein turnover, chaperones [O]	9.00
COG2352	Phosphoenolpyruvate carboxylase	Energy production and conversion [C]	2.50
COG4274	Uncharacterized conserved protein, contains GYD domain	Function unknown [S]	2.50
COG1961	Site-specific DNA recombinase SpoIVCA/DNA invertase PinE	Replication, recombination and repair [L]	1.00
COG2452	Predicted site-specific integrase-resolvase	Mobilome: prophages, transposons [X]	1.00
COG3547	Transposase	Mobilome: prophages, transposons [X]	1.00
COG0039	Malate/lactate dehydrogenase	Energy production and conversion [C]	0.50
COG0183	Acetyl-CoA acetyltransferase	Lipid transport and metabolism [I]	0.50
COG0350	DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase)	Replication, recombination and repair [L]	0.50
COG1376	Lipoprotein-anchoring transpeptidase ErfK/SrfK	Cell wall/membrane/envelope biogenesis [M]	0.50
COG1802	DNA-binding transcriptional regulator, GntR family	Transcription [K]	0.50
COG2186	DNA-binding transcriptional regulator, FadR family	Transcription [K]	0.50
COG3034	Murein L,D-transpeptidase YafK	Cell wall/membrane/envelope biogenesis [M]	0.50
COG3695	Alkylated DNA nucleotide flippase Atl1, participates in nucleotide excision repair, Ada-like DNA-binding domain	Transcription [K]	0.50
COG5470	Uncharacterized conserved protein, DUF1330 family	Function unknown [S]	0.50

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	81.00 %
Unclassified	root	N/A	19.00 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	81.00 %
Unclassified	root	N/A	19.00 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	81.00 %
Unclassified	root	N/A	19.00 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	67.50 %
Unclassified	root	N/A	19.00 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	51.50 %
Unclassified	root	N/A	19.00 %
unclassified Proteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria	5.00 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.50 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	19.00 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	17.00 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	13.00 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	5.00 %
Nevskiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales	0.50 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	19.00 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	15.50 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	6.50 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	5.00 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	1.50 %
Sinobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae	0.50 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	19.00 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	15.50 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	6.00 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	5.00 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	1.50 %
Nevskia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia	0.50 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	19.00 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	15.50 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	5.00 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	1.50 %
Bradyrhizobium lablabi	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi	1.00 %
Bradyrhizobium tropiciagri	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium tropiciagri	0.50 %
Nevskia soli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli	0.50 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2124908045\|KansclcFeb2_ConsensusfromContig543058	Not Available	562	Open in IMG/M
2124908045\|KansclcFeb2_ConsensusfromContig80486	All Organisms → cellular organisms → Bacteria → Proteobacteria	728	Open in IMG/M
3300000579\|AP72_2010_repI_A01DRAFT_1015141	All Organisms → cellular organisms → Bacteria → Proteobacteria	1181	Open in IMG/M
3300000580\|AF_2010_repII_A01DRAFT_1014736	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1254	Open in IMG/M
3300000597\|AF_2010_repII_A1DRAFT_10068726	Not Available	899	Open in IMG/M
3300000655\|AF_2010_repII_A100DRAFT_1038146	All Organisms → cellular organisms → Bacteria	874	Open in IMG/M
3300000956\|JGI10216J12902_103302118	All Organisms → cellular organisms → Bacteria	614	Open in IMG/M
3300001545\|JGI12630J15595_10079632	Not Available	644	Open in IMG/M
3300001867\|JGI12627J18819_10047653	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1790	Open in IMG/M
3300002906\|JGI25614J43888_10214128	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	522	Open in IMG/M
3300002917\|JGI25616J43925_10278231	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi	625	Open in IMG/M
3300004633\|Ga0066395_10377720	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	793	Open in IMG/M
3300005468\|Ga0070707_100516258	All Organisms → cellular organisms → Bacteria	1157	Open in IMG/M
3300005554\|Ga0066661_10047259	All Organisms → cellular organisms → Bacteria	2450	Open in IMG/M
3300005559\|Ga0066700_10733071	All Organisms → cellular organisms → Bacteria	674	Open in IMG/M
3300005576\|Ga0066708_10246425	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1135	Open in IMG/M
3300005713\|Ga0066905_100055393	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2456	Open in IMG/M
3300005713\|Ga0066905_100138982	Not Available	1729	Open in IMG/M
3300005713\|Ga0066905_100178355	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1564	Open in IMG/M
3300005713\|Ga0066905_100180704	Not Available	1556	Open in IMG/M
3300005713\|Ga0066905_100417517	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1093	Open in IMG/M
3300005713\|Ga0066905_100551909	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	967	Open in IMG/M
3300005713\|Ga0066905_100589371	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	939	Open in IMG/M
3300005713\|Ga0066905_100882305	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	781	Open in IMG/M
3300005713\|Ga0066905_101607976	All Organisms → cellular organisms → Bacteria → Proteobacteria	595	Open in IMG/M
3300005719\|Ga0068861_101227496	Not Available	726	Open in IMG/M
3300005764\|Ga0066903_100064968	All Organisms → cellular organisms → Bacteria	4605	Open in IMG/M
3300005764\|Ga0066903_100373230	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2325	Open in IMG/M
3300005764\|Ga0066903_100690373	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	1796	Open in IMG/M
3300005764\|Ga0066903_101009369	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium tropiciagri	1522	Open in IMG/M
3300005764\|Ga0066903_101227799	All Organisms → cellular organisms → Bacteria → Proteobacteria	1394	Open in IMG/M
3300005764\|Ga0066903_101384224	All Organisms → cellular organisms → Bacteria → Proteobacteria	1320	Open in IMG/M
3300005764\|Ga0066903_101682515	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1207	Open in IMG/M
3300005764\|Ga0066903_101905999	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1139	Open in IMG/M
3300005764\|Ga0066903_102378792	Not Available	1024	Open in IMG/M
3300005764\|Ga0066903_103040138	Not Available	908	Open in IMG/M
3300005764\|Ga0066903_103087897	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	901	Open in IMG/M
3300005764\|Ga0066903_103728636	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	819	Open in IMG/M
3300005764\|Ga0066903_104139989	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	776	Open in IMG/M
3300005764\|Ga0066903_104632281	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	732	Open in IMG/M
3300005764\|Ga0066903_104922148	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	709	Open in IMG/M
3300005764\|Ga0066903_105120893	Not Available	694	Open in IMG/M
3300005764\|Ga0066903_105245393	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	685	Open in IMG/M
3300005764\|Ga0066903_105612749	All Organisms → cellular organisms → Bacteria	660	Open in IMG/M
3300005764\|Ga0066903_105738222	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	652	Open in IMG/M
3300005764\|Ga0066903_106155868	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	627	Open in IMG/M
3300005764\|Ga0066903_106341648	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	617	Open in IMG/M
3300005764\|Ga0066903_106395603	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	614	Open in IMG/M
3300005764\|Ga0066903_106435947	Not Available	612	Open in IMG/M
3300005764\|Ga0066903_106454699	Not Available	611	Open in IMG/M
3300005764\|Ga0066903_106493093	Not Available	609	Open in IMG/M
3300005764\|Ga0066903_106714667	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	598	Open in IMG/M
3300005764\|Ga0066903_108154653	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	536	Open in IMG/M
3300005764\|Ga0066903_108417592	Not Available	526	Open in IMG/M
3300005983\|Ga0081540_1029632	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3045	Open in IMG/M
3300006028\|Ga0070717_10840338	All Organisms → cellular organisms → Bacteria	835	Open in IMG/M
3300006028\|Ga0070717_11793883	Not Available	554	Open in IMG/M
3300006034\|Ga0066656_10167647	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1383	Open in IMG/M
3300006049\|Ga0075417_10353855	All Organisms → cellular organisms → Bacteria → Proteobacteria	720	Open in IMG/M
3300006058\|Ga0075432_10584214	Not Available	509	Open in IMG/M
3300006173\|Ga0070716_100433418	Not Available	954	Open in IMG/M
3300006173\|Ga0070716_101501898	All Organisms → cellular organisms → Bacteria	551	Open in IMG/M
3300006175\|Ga0070712_101337916	All Organisms → cellular organisms → Bacteria	624	Open in IMG/M
3300006573\|Ga0074055_11172875	All Organisms → cellular organisms → Bacteria → Proteobacteria	569	Open in IMG/M
3300006804\|Ga0079221_11188023	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi	591	Open in IMG/M
3300006844\|Ga0075428_100178429	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2300	Open in IMG/M
3300007076\|Ga0075435_100031185	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4197	Open in IMG/M
3300007255\|Ga0099791_10641703	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	521	Open in IMG/M
3300007258\|Ga0099793_10058701	All Organisms → cellular organisms → Bacteria	1716	Open in IMG/M
3300009038\|Ga0099829_10145499	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1887	Open in IMG/M
3300009100\|Ga0075418_10082861	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3411	Open in IMG/M
3300009137\|Ga0066709_100052909	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	4604	Open in IMG/M
3300009143\|Ga0099792_10109809	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1463	Open in IMG/M
3300009143\|Ga0099792_10277103	All Organisms → cellular organisms → Bacteria → Proteobacteria	987	Open in IMG/M
3300009147\|Ga0114129_10386305	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1847	Open in IMG/M
3300009162\|Ga0075423_11616970	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	697	Open in IMG/M
3300009792\|Ga0126374_10250336	All Organisms → cellular organisms → Bacteria	1156	Open in IMG/M
3300010043\|Ga0126380_10059653	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2109	Open in IMG/M
3300010043\|Ga0126380_10086716	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1833	Open in IMG/M
3300010043\|Ga0126380_10142894	All Organisms → cellular organisms → Bacteria	1519	Open in IMG/M
3300010043\|Ga0126380_10177924	All Organisms → cellular organisms → Bacteria	1398	Open in IMG/M
3300010043\|Ga0126380_10477627	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	950	Open in IMG/M
3300010043\|Ga0126380_11640905	Not Available	575	Open in IMG/M
3300010046\|Ga0126384_10403578	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1155	Open in IMG/M
3300010046\|Ga0126384_10452235	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1097	Open in IMG/M
3300010046\|Ga0126384_10710011	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	892	Open in IMG/M
3300010046\|Ga0126384_10853131	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	819	Open in IMG/M
3300010047\|Ga0126382_10144555	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1618	Open in IMG/M
3300010048\|Ga0126373_10141446	All Organisms → cellular organisms → Bacteria	2276	Open in IMG/M
3300010048\|Ga0126373_10419079	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1367	Open in IMG/M
3300010321\|Ga0134067_10492531	Not Available	507	Open in IMG/M
3300010335\|Ga0134063_10724940	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	516	Open in IMG/M
3300010337\|Ga0134062_10122174	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1136	Open in IMG/M
3300010358\|Ga0126370_11464564	All Organisms → cellular organisms → Bacteria	647	Open in IMG/M
3300010358\|Ga0126370_11927861	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	575	Open in IMG/M
3300010358\|Ga0126370_12165040	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	547	Open in IMG/M
3300010359\|Ga0126376_10433084	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1196	Open in IMG/M
3300010360\|Ga0126372_12298658	Not Available	589	Open in IMG/M
3300010361\|Ga0126378_11987719	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	662	Open in IMG/M
3300010362\|Ga0126377_10259929	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli	1695	Open in IMG/M
3300010362\|Ga0126377_10432485	All Organisms → cellular organisms → Bacteria	1335	Open in IMG/M
3300010362\|Ga0126377_10925732	Not Available	935	Open in IMG/M
3300010362\|Ga0126377_12938124	Not Available	550	Open in IMG/M
3300010366\|Ga0126379_10254924	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1731	Open in IMG/M
3300010366\|Ga0126379_13782565	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	507	Open in IMG/M
3300010376\|Ga0126381_100431093	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1844	Open in IMG/M
3300010376\|Ga0126381_101005679	All Organisms → cellular organisms → Bacteria	1203	Open in IMG/M
3300010397\|Ga0134124_12397810	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	569	Open in IMG/M
3300010398\|Ga0126383_10308268	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1585	Open in IMG/M
3300010999\|Ga0138505_100056111	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	573	Open in IMG/M
3300012199\|Ga0137383_10667347	Not Available	760	Open in IMG/M
3300012205\|Ga0137362_10077452	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2766	Open in IMG/M
3300012205\|Ga0137362_10151080	All Organisms → cellular organisms → Bacteria → Proteobacteria	1986	Open in IMG/M
3300012208\|Ga0137376_11693268	Not Available	523	Open in IMG/M
3300012211\|Ga0137377_10097817	All Organisms → cellular organisms → Bacteria	2777	Open in IMG/M
3300012285\|Ga0137370_10060649	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2052	Open in IMG/M
3300012355\|Ga0137369_10101673	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2358	Open in IMG/M
3300012357\|Ga0137384_10887735	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	719	Open in IMG/M
3300012359\|Ga0137385_10364494	All Organisms → cellular organisms → Bacteria	1235	Open in IMG/M
3300012359\|Ga0137385_10458674	All Organisms → cellular organisms → Bacteria → Proteobacteria	1081	Open in IMG/M
3300012361\|Ga0137360_10646292	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	907	Open in IMG/M
3300012362\|Ga0137361_10437716	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1201	Open in IMG/M
3300012582\|Ga0137358_10073170	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2303	Open in IMG/M
3300012917\|Ga0137395_10026600	All Organisms → cellular organisms → Bacteria → Proteobacteria	3441	Open in IMG/M
3300012929\|Ga0137404_10240086	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1551	Open in IMG/M
3300012929\|Ga0137404_10878723	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	817	Open in IMG/M
3300012948\|Ga0126375_10193653	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	1328	Open in IMG/M
3300012971\|Ga0126369_10792753	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	1029	Open in IMG/M
3300012971\|Ga0126369_12389327	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	615	Open in IMG/M
3300012985\|Ga0164308_10185516	Not Available	1571	Open in IMG/M
3300012989\|Ga0164305_11060161	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	693	Open in IMG/M
3300013307\|Ga0157372_12871918	Not Available	552	Open in IMG/M
3300016294\|Ga0182041_10035665	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3238	Open in IMG/M
3300016319\|Ga0182033_10028672	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3522	Open in IMG/M
3300016341\|Ga0182035_11671004	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	575	Open in IMG/M
3300016404\|Ga0182037_11281936	All Organisms → cellular organisms → Bacteria → Proteobacteria	645	Open in IMG/M
3300016445\|Ga0182038_12056601	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	517	Open in IMG/M
3300018433\|Ga0066667_12260324	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	508	Open in IMG/M
3300018468\|Ga0066662_11338287	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	737	Open in IMG/M
3300018482\|Ga0066669_11313152	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	655	Open in IMG/M
3300020581\|Ga0210399_11440823	All Organisms → cellular organisms → Bacteria → Proteobacteria	537	Open in IMG/M
3300020583\|Ga0210401_11349775	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	571	Open in IMG/M
3300021168\|Ga0210406_11289381	Not Available	527	Open in IMG/M
3300021170\|Ga0210400_10904043	All Organisms → cellular organisms → Bacteria	721	Open in IMG/M
3300021361\|Ga0213872_10154287	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1002	Open in IMG/M
3300021372\|Ga0213877_10015094	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2020	Open in IMG/M
3300021405\|Ga0210387_10115529	All Organisms → cellular organisms → Bacteria → Proteobacteria	2261	Open in IMG/M
3300021478\|Ga0210402_11431151	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	618	Open in IMG/M
3300021560\|Ga0126371_10616595	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1234	Open in IMG/M
3300021560\|Ga0126371_10787081	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	1098	Open in IMG/M
3300021560\|Ga0126371_11525803	Not Available	796	Open in IMG/M
3300021560\|Ga0126371_11641265	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	768	Open in IMG/M
3300021560\|Ga0126371_11907587	Not Available	713	Open in IMG/M
3300024288\|Ga0179589_10126915	Not Available	1069	Open in IMG/M
3300025922\|Ga0207646_10976123	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	749	Open in IMG/M
3300026304\|Ga0209240_1001018	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	11180	Open in IMG/M
3300026304\|Ga0209240_1198111	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	607	Open in IMG/M
3300026319\|Ga0209647_1017504	Not Available	4534	Open in IMG/M
3300026319\|Ga0209647_1049431	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2275	Open in IMG/M
3300026359\|Ga0257163_1071456	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	559	Open in IMG/M
3300026514\|Ga0257168_1047433	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	939	Open in IMG/M
3300026551\|Ga0209648_10497827	Not Available	710	Open in IMG/M
3300026552\|Ga0209577_10344356	All Organisms → cellular organisms → Bacteria	1099	Open in IMG/M
3300026846\|Ga0208273_103053	Not Available	578	Open in IMG/M
3300027061\|Ga0209729_1011612	All Organisms → cellular organisms → Bacteria → Proteobacteria	1005	Open in IMG/M
3300027502\|Ga0209622_1053265	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	735	Open in IMG/M
3300027646\|Ga0209466_1006693	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	2436	Open in IMG/M
3300028047\|Ga0209526_10026653	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	4055	Open in IMG/M
3300028047\|Ga0209526_10027000	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4027	Open in IMG/M
3300028784\|Ga0307282_10025232	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2532	Open in IMG/M
3300028878\|Ga0307278_10544214	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	506	Open in IMG/M
3300031543\|Ga0318516_10003324	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	6913	Open in IMG/M
3300031543\|Ga0318516_10026834	All Organisms → cellular organisms → Bacteria	3006	Open in IMG/M
3300031543\|Ga0318516_10090889	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1714	Open in IMG/M
3300031543\|Ga0318516_10270763	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	982	Open in IMG/M
3300031543\|Ga0318516_10453425	All Organisms → cellular organisms → Bacteria → Proteobacteria	737	Open in IMG/M
3300031561\|Ga0318528_10129054	Not Available	1339	Open in IMG/M
3300031561\|Ga0318528_10297507	Not Available	866	Open in IMG/M
3300031561\|Ga0318528_10642648	All Organisms → cellular organisms → Bacteria → Proteobacteria	568	Open in IMG/M
3300031572\|Ga0318515_10055462	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2004	Open in IMG/M
3300031572\|Ga0318515_10563524	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	606	Open in IMG/M
3300031680\|Ga0318574_10124691	All Organisms → cellular organisms → Bacteria → Proteobacteria	1448	Open in IMG/M
3300031680\|Ga0318574_10866723	Not Available	529	Open in IMG/M
3300031713\|Ga0318496_10855062	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	501	Open in IMG/M
3300031719\|Ga0306917_10074484	All Organisms → cellular organisms → Bacteria → Proteobacteria	2364	Open in IMG/M
3300031719\|Ga0306917_10873580	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	704	Open in IMG/M
3300031770\|Ga0318521_10800271	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	574	Open in IMG/M
3300031820\|Ga0307473_10760998	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	687	Open in IMG/M
3300031845\|Ga0318511_10363589	All Organisms → cellular organisms → Bacteria → Proteobacteria	660	Open in IMG/M
3300031860\|Ga0318495_10078002	All Organisms → cellular organisms → Bacteria	1480	Open in IMG/M
3300031910\|Ga0306923_10268969	All Organisms → cellular organisms → Bacteria	1949	Open in IMG/M
3300031941\|Ga0310912_10920458	All Organisms → cellular organisms → Bacteria → Proteobacteria	672	Open in IMG/M
3300031946\|Ga0310910_10730967	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	782	Open in IMG/M
3300031959\|Ga0318530_10127645	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1024	Open in IMG/M
3300032025\|Ga0318507_10011910	All Organisms → cellular organisms → Bacteria	2881	Open in IMG/M
3300032039\|Ga0318559_10175008	Not Available	981	Open in IMG/M
3300032180\|Ga0307471_100891568	All Organisms → cellular organisms → Bacteria	1057	Open in IMG/M
3300032205\|Ga0307472_100314553	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	1266	Open in IMG/M
3300033290\|Ga0318519_10792772	Not Available	582	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	94.50%
Host-Associated	Host-Associated	5.50%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	94.50%
Plants	Host-Associated → Plants	5.50%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	94.00%
Rhizosphere	Host-Associated → Plants → Rhizosphere	4.50%
Rhizoplane	Host-Associated → Plants → Rhizoplane	1.00%
Agricultural Field	Environmental → Terrestrial → Agricultural Field	0.50%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	68.00%
Loam	Environmental → Terrestrial → Soil → Loam	26.00%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	4.50%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	1.00%
Unclassified	Environmental → Terrestrial → Agricultural Field → Unclassified	0.50%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	35.00%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	22.50%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	22.50%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	10.00%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	4.50%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	3.50%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	1.00%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.50%
Unclassified	Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified	0.50%

Habitat	Taxonomy	Distribution
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	19.50%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	18.50%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	15.00%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	11.00%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	6.00%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	4.00%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	4.00%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	3.50%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	3.50%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	3.00%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	2.00%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	2.00%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	1.50%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	1.50%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.00%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.50%
Bulk Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil	0.50%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.50%
Soil	Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil	0.50%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.50%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.50%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.50%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.50%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2124908045	Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011	Environmental	Open in IMG/M
3300000579	Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A01	Environmental	Open in IMG/M
3300000580	Forest soil microbial communities from Amazon forest - 2010 replicate II A01	Environmental	Open in IMG/M
3300000597	Forest soil microbial communities from Amazon forest - 2010 replicate II A1	Environmental	Open in IMG/M
3300000655	Forest soil microbial communities from Amazon forest - 2010 replicate II A100	Environmental	Open in IMG/M
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental	Open in IMG/M
3300001545	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1	Environmental	Open in IMG/M
3300001867	Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)	Environmental	Open in IMG/M
3300002906	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm	Environmental	Open in IMG/M
3300002917	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm	Environmental	Open in IMG/M
3300004633	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio	Environmental	Open in IMG/M
3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Environmental	Open in IMG/M
3300005554	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110	Environmental	Open in IMG/M
3300005559	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149	Environmental	Open in IMG/M
3300005576	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157	Environmental	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Host-Associated	Open in IMG/M
3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Environmental	Open in IMG/M
3300006034	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105	Environmental	Open in IMG/M
3300006049	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1	Host-Associated	Open in IMG/M
3300006058	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Host-Associated	Open in IMG/M
3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Environmental	Open in IMG/M
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental	Open in IMG/M
3300006573	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006804	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200	Environmental	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300007076	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Host-Associated	Open in IMG/M
3300007255	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1	Environmental	Open in IMG/M
3300007258	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3	Environmental	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009143	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2	Environmental	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010048	Tropical forest soil microbial communities from Panama - MetaG Plot_11	Environmental	Open in IMG/M
3300010321	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015	Environmental	Open in IMG/M
3300010335	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015	Environmental	Open in IMG/M
3300010337	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015	Environmental	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300010999	Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t3i015	Environmental	Open in IMG/M
3300012199	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG	Environmental	Open in IMG/M
3300012205	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG	Environmental	Open in IMG/M
3300012208	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG	Environmental	Open in IMG/M
3300012211	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG	Environmental	Open in IMG/M
3300012285	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG	Environmental	Open in IMG/M
3300012355	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG	Environmental	Open in IMG/M
3300012357	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG	Environmental	Open in IMG/M
3300012359	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG	Environmental	Open in IMG/M
3300012361	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG	Environmental	Open in IMG/M
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental	Open in IMG/M
3300012582	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG	Environmental	Open in IMG/M
3300012917	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG	Environmental	Open in IMG/M
3300012929	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300012985	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG	Environmental	Open in IMG/M
3300012989	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG	Environmental	Open in IMG/M
3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Host-Associated	Open in IMG/M
3300016294	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178	Environmental	Open in IMG/M
3300016319	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H	Environmental	Open in IMG/M
3300016341	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170	Environmental	Open in IMG/M
3300016404	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082	Environmental	Open in IMG/M
3300016445	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108	Environmental	Open in IMG/M
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental	Open in IMG/M
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300020581	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M	Environmental	Open in IMG/M
3300020583	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M	Environmental	Open in IMG/M
3300021168	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M	Environmental	Open in IMG/M
3300021170	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M	Environmental	Open in IMG/M
3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Host-Associated	Open in IMG/M
3300021372	Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01	Environmental	Open in IMG/M
3300021405	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O	Environmental	Open in IMG/M
3300021478	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300024288	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal	Environmental	Open in IMG/M
3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300026304	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes)	Environmental	Open in IMG/M
3300026319	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes)	Environmental	Open in IMG/M
3300026359	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-A	Environmental	Open in IMG/M
3300026514	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B	Environmental	Open in IMG/M
3300026551	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)	Environmental	Open in IMG/M
3300026552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)	Environmental	Open in IMG/M
3300026846	Soil and rhizosphere microbial communities from Laval, Canada - mgHMA (SPAdes)	Environmental	Open in IMG/M
3300027061	Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M3 (SPAdes)	Environmental	Open in IMG/M
3300027502	Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes)	Environmental	Open in IMG/M
3300027646	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes)	Environmental	Open in IMG/M
3300028047	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)	Environmental	Open in IMG/M
3300028784	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121	Environmental	Open in IMG/M
3300028878	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117	Environmental	Open in IMG/M
3300031543	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20	Environmental	Open in IMG/M
3300031561	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26	Environmental	Open in IMG/M
3300031572	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19	Environmental	Open in IMG/M
3300031680	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22	Environmental	Open in IMG/M
3300031713	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22	Environmental	Open in IMG/M
3300031719	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)	Environmental	Open in IMG/M
3300031770	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17	Environmental	Open in IMG/M
3300031820	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515	Environmental	Open in IMG/M
3300031845	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18	Environmental	Open in IMG/M
3300031860	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25	Environmental	Open in IMG/M
3300031910	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)	Environmental	Open in IMG/M
3300031941	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080	Environmental	Open in IMG/M
3300031946	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172	Environmental	Open in IMG/M
3300031959	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24	Environmental	Open in IMG/M
3300032025	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20	Environmental	Open in IMG/M
3300032039	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M
3300033290	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
KansclcFeb2_06452440	2124908045	Soil	MNEQAVQERRGRGLNIAEVAFYSVLVLVVMLLSVYVPA
KansclcFeb2_07297400	2124908045	Soil	GPSICDRRRSIMNEHAVQERRGRGLDIAEVALYSALVLLVILLSVCIPA
AP72_2010_repI_A01DRAFT_10151413	3300000579	Forest Soil	EDRSTMNRQAAQEPRRRGLNIAEAAFYSVLVLVIMLLWVYVPA*
AF_2010_repII_A01DRAFT_10147361	3300000580	Forest Soil	MGQQAVQVWRRRGLDIAEVAFYSVLVVVITLVSVYVPA*
AF_2010_repII_A1DRAFT_100687262	3300000597	Forest Soil	MDQQAVQVWRRRGLNIAEVAFYSILVVVITLVSVYVPA*
AF_2010_repII_A100DRAFT_10381462	3300000655	Forest Soil	GRRRSTMNEQAVQERRRRDLNIAEVAFYSVLVLLVMLLSVYVPA*
JGI10216J12902_1033021183	3300000956	Soil	SVYDRRRSTMNQQAAQERRRWGLNIAEVAFYSVLVLVVMLLSFYIPA*
JGI12630J15595_100796322	3300001545	Forest Soil	MNEQAVQERRGRGLNIAEVAFYSVLVLVVMLLSVY
JGI12627J18819_100476532	3300001867	Forest Soil	MNQQAVQERRRRGLNIAEVAFYSGLVLVIMLLSVYVPA*
JGI25614J43888_102141282	3300002906	Grasslands Soil	DRRRSTMNEQAVQQRRGRGLDIAEVAFYSVLVLIIMLLSVYVPA*
JGI25616J43925_102782311	3300002917	Grasslands Soil	RRSTMNEQAVQERRGRGLNIAEVAFYSVLVLLIMLLSVYVPA*
Ga0066395_103777203	3300004633	Tropical Forest Soil	RRRSNMNQQAVQEWRRRGLNIAEVAFYSVLVVVITLVSVYVPA*
Ga0070707_1005162582	3300005468	Corn, Switchgrass And Miscanthus Rhizosphere	MVRRSTMNQQAVQERRRQGLNIAEVAFYSVLVLVIMLLSFYIPA*
Ga0066661_100472592	3300005554	Soil	MNQQAAQERRRWGLNIAEVAFYSVLVLVVMLLSFYIPA*
Ga0066700_107330712	3300005559	Soil	MNEQAVQERRGRGLNIAEVAFYSVLVLVVMLLSVYVPA*
Ga0066708_102464252	3300005576	Soil	MNQQAVQEWRRRGLNIAEVVFYSVVVLVIVILSIYVPA*
Ga0066905_1000553932	3300005713	Tropical Forest Soil	MNQQAVQEWRRRGLNVAEVAFYSILVLVIMLVSVYVPA*
Ga0066905_1001389822	3300005713	Tropical Forest Soil	MDQQAVQERRRRGLNIAEVAFYSVLVFVITLLSVYVPA*
Ga0066905_1001783553	3300005713	Tropical Forest Soil	MNEQTVPERRGLNIAEVAFYSALVLVILLLSVYVPA*
Ga0066905_1001807041	3300005713	Tropical Forest Soil	MNEQAVHERRGRGLTIAEVAFYSALALVVMLLSVYVPA*
Ga0066905_1004175173	3300005713	Tropical Forest Soil	MNQQAVQEWRRRGLNIAEVAFYSVLVVVITLVSVYVPA*
Ga0066905_1005519092	3300005713	Tropical Forest Soil	RRRSTMNEQAVEERRGRGLNVAEVAFYSVLALLIMLLSVYVPA*
Ga0066905_1005893712	3300005713	Tropical Forest Soil	MNEQTVQEQRSRGLNIAEVAFYSVLVLVIMLLSVYVPA*
Ga0066905_1008823053	3300005713	Tropical Forest Soil	MNEQAVQEQRGRGFNIAEVAFYSVLVLLILLLSVYVPA*
Ga0066905_1016079762	3300005713	Tropical Forest Soil	MNEQAVEERRSRGLNIAEVAFYSILVLLIMLLSVYVPA*
Ga0068861_1012274961	3300005719	Switchgrass Rhizosphere	MNQQAVQEWRRRGLNIAEVAFYSGLVLVIMLLSVYVPA*
Ga0066903_1000649685	3300005764	Tropical Forest Soil	MNQQAVQEWRRRGLDIAEVAFYSVLVLVIMLVSVYVPA*
Ga0066903_1003732304	3300005764	Tropical Forest Soil	MNEQAVQQPRGQGLNIAEVAFYSVLVVVIMLLSVYVPA*
Ga0066903_1006903733	3300005764	Tropical Forest Soil	MDQQAVQVWRRRGLNLAEVAFYSVVVVVITLASVYVPA*
Ga0066903_1010093693	3300005764	Tropical Forest Soil	MNEQAVQQWRGRGLNIAEVAFYSVLVLVIMLLSVYVPA*
Ga0066903_1012277992	3300005764	Tropical Forest Soil	MNEQAVQDRRGPGLNIAEVAFYSVLVLIVTLLSVYVPA*
Ga0066903_1013842241	3300005764	Tropical Forest Soil	MNEETVQERRGRDLNIAEIAFYSVLVFVIMLLSVYVPA*
Ga0066903_1016825153	3300005764	Tropical Forest Soil	MDQQAVQVWRRRSLNIAEVAFYSVLVVVITLVSVYVPA*
Ga0066903_1019059992	3300005764	Tropical Forest Soil	MNQQALHEWRRRGLDIAEVAFYSVLVLVIMLLSVYIPA*
Ga0066903_1023787922	3300005764	Tropical Forest Soil	MNQQAVQEWRRRGLNIAEVAFYSVLVLVIMLLSVYVPA*
Ga0066903_1030401382	3300005764	Tropical Forest Soil	MNEQAVQQRRGQGLNIAEVTFYSVLVLVIMLLSVYVPA*
Ga0066903_1030878972	3300005764	Tropical Forest Soil	MGQQAVQVWRRRGLDIAKVAFYSVLVVVITLVSVYVPA*
Ga0066903_1037286362	3300005764	Tropical Forest Soil	MNEQAVQQPRGRGLNIAEVALYSVLVLVIMFLSVYVPA*
Ga0066903_1041399892	3300005764	Tropical Forest Soil	MNEQTVQEPRGRGLNIAEVVFYSALVLVILLLSVYVPA*
Ga0066903_1046322812	3300005764	Tropical Forest Soil	MDQQGVQEWRRRGLNIAEVAFYSVLVVVITLVSVYVPA*
Ga0066903_1049221482	3300005764	Tropical Forest Soil	MDEQAVQEGRNQGLSIAEVAFYSILVLLAMLLSMYIPA*
Ga0066903_1051208931	3300005764	Tropical Forest Soil	MNEQAVQQPRGQGLNIAEVAFYSILVLVFMLLSVYVPA*
Ga0066903_1052453932	3300005764	Tropical Forest Soil	MNQQAVQEWRRRGLNIAEVAFYSVVVVVITLVSVYVPA*
Ga0066903_1056127491	3300005764	Tropical Forest Soil	MGQQAVQVWRRRGLNVAEVAFYSLLVVVITLVSVYVPA*
Ga0066903_1057382222	3300005764	Tropical Forest Soil	MDQQAVQEWRRRGLNIAEVAFYSVLVVVITLVSVYVPA*
Ga0066903_1061558683	3300005764	Tropical Forest Soil	MNEQTVQERRGRGLNIAEVAFYSALVLLILLLSVYVPA*
Ga0066903_1063416481	3300005764	Tropical Forest Soil	NMNQQAVQEWRRRGLNIAEVAFYSVLVVVITLVSVYVPA*
Ga0066903_1063956032	3300005764	Tropical Forest Soil	VYDRRRSTMDQQAVHVWRLRGFNLAEVAFYSVVVVVITLVSVYVPA*
Ga0066903_1064359472	3300005764	Tropical Forest Soil	MDQQAVRVWRRRGLNLAELAFYSVVAVVITLVSVYVPA*
Ga0066903_1064546991	3300005764	Tropical Forest Soil	MNEQAVQERRRRDLNIAEVAFYSVLVLLVMLLSVYVPA*
Ga0066903_1064930932	3300005764	Tropical Forest Soil	MNEQAVQEPRGRGLNIAEVAFYSVLVFLVMLLSVVLE*
Ga0066903_1067146673	3300005764	Tropical Forest Soil	MNQQAVQERRRRGLNIAEVAFYSVLVVVITLVSVYAPA*
Ga0066903_1081546531	3300005764	Tropical Forest Soil	MDQQAVQVWRRRGLNIAEVALYSVLVVVITLVSVYVPA*
Ga0066903_1084175921	3300005764	Tropical Forest Soil	YHRRRSNMNQQAVQEWRRRGLNIAEVAFYSVLVVVITLVSIYVPA*
Ga0081540_10296323	3300005983	Tabebuia Heterophylla Rhizosphere	MNEQAVQQRRGRGLDIAEVAFYSVLVLIIMLLSLYVPA*
Ga0070717_108403382	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MNGQAIQERRGRGLNIPEVAFYSVLVLVVMLLSVYVPA*
Ga0070717_117938832	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MNEQAVQERRGRGLNIGEVAFYSVLVLLVMLLSVCVPA*
Ga0066656_101676472	3300006034	Soil	MNQQAAEEWRRRGLNIAEVAFYSVLVLVIMLLSVYVPA*
Ga0075417_103538551	3300006049	Populus Rhizosphere	MDQQAVQERRRWGLNIAEVAFYSVLVVVITLLSFYVPA
Ga0075432_105842142	3300006058	Populus Rhizosphere	MNEQAVQEGRGRGLGIAEVAVYSVLVLLVMLLSVYVPA*
Ga0070716_1004334182	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	MNEQTVQERKGRGLNIAEIAFYSALVVVVMLLSVYVPA*
Ga0070716_1015018981	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	MNEQAVQERRGRGLNIPEVAFYSVLVLVVMLLSVYVPA*
Ga0070712_1013379162	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	MNEQAVQEQRGRGLNIAEVAFYSVLVLVVMLLSVYVPA*
Ga0074055_111728752	3300006573	Soil	DRRRSTMNEQAVQERRGPGLNIGEVAFYSVLVLVVMLLSVYVPA*
Ga0079221_111880231	3300006804	Agricultural Soil	QAVQEGRGRGLGIAEVAVYSVLVLLVMLLSVYVPA*
Ga0075428_1001784294	3300006844	Populus Rhizosphere	MDQQAVQERRRWGLNIAEVAFYSVLVVVITLLSFYVPA*
Ga0075435_1000311852	3300007076	Populus Rhizosphere	MDQQAAQGRRRRGLNIAEVAFYSGLVLVITLLSLYVPA*
Ga0099791_106417031	3300007255	Vadose Zone Soil	MNEQAVQERRGRSLNIAEVAVYSVLVLLVMLLSVYVPA*
Ga0099793_100587012	3300007258	Vadose Zone Soil	MNEQAVQERRGRGLNIGEVAFYLVLVLLIMLLSVCVPA*
Ga0066710_1001388905	3300009012	Grasslands Soil	MNEQAVQERRASDVAAVAFYSVLFLLVMFLSVYVPA
Ga0099829_101454991	3300009038	Vadose Zone Soil	MNEQAVQQRRGRGLDIAEVAFYSVLVLIIMLLSVYVPA*
Ga0075418_100828615	3300009100	Populus Rhizosphere	MDQQAVQEWRRWGLNIAEVAFYSVLVVVITLLSFYVPA*
Ga0066709_10005290910	3300009137	Grasslands Soil	MNQQAVQERRCRGLNIAEAAFYSDLVLVIMLLSVYVPA*
Ga0099792_101098093	3300009143	Vadose Zone Soil	MNEQAVQERRGRNLNIAEVAVYSVLVLLVMLLSVYVPA*
Ga0099792_102771032	3300009143	Vadose Zone Soil	MNEQAVQERRGPGLNIAEVAFYSVVVLVIMLLSVYVPA*
Ga0114129_103863053	3300009147	Populus Rhizosphere	MNEQAVHERPGRSLNIAEVAFYSVLVLLVMLLLVCVPA*
Ga0075423_116169701	3300009162	Populus Rhizosphere	RRSTMNQQAVQEPRHRGLKIAEVVFYSVVVLVITLLSVYVPA*
Ga0126374_102503362	3300009792	Tropical Forest Soil	MNEQAVQQRRGQGLNIAEVTFYSVLVLVIMFLSVYVPA*
Ga0126380_100596531	3300010043	Tropical Forest Soil	RRSTMNEQAVEERRGRGLNVAEVAFYSVLALLIMLLSVYVPA*
Ga0126380_100867162	3300010043	Tropical Forest Soil	MNEQAVQERRGRGLNIAEVAFYSVLVLLIMLLSAYVPA*
Ga0126380_101428941	3300010043	Tropical Forest Soil	MNEQAVQERRGRGLDIAEVAFYSVLVLLILLLSVYVPA*
Ga0126380_101779242	3300010043	Tropical Forest Soil	MNEQAVQERRGRGLNIAEVAFYSVLVLLIMLLSVYVPA*
Ga0126380_104776273	3300010043	Tropical Forest Soil	SQQAVQVWRRRGLNIAEVAFYSVVVVVITLVSVYVPA*
Ga0126380_116409051	3300010043	Tropical Forest Soil	MDQQAVQVWRRRGLNIAELAVYSVLVVVITLVSVYVPA*
Ga0126384_104035782	3300010046	Tropical Forest Soil	MNQQAVQNWRRRSLNIAEVAFYSVMVLAITLLSVYVPA*
Ga0126384_104522353	3300010046	Tropical Forest Soil	MNQQAVQVWRRRGLNIAEVAFYSVVVVVITLVSVYVPA*
Ga0126384_107100111	3300010046	Tropical Forest Soil	RSTINEQTVQEQRSRGLNIAEVAFYSVLVLVIMLLSIYVPA*
Ga0126384_108531312	3300010046	Tropical Forest Soil	MNQQAVQVWRRRGLNIAEVAFYSVLVVVITLVSVYVPA*
Ga0126382_101445553	3300010047	Tropical Forest Soil	MIQQAVQVWRRRGLNIAEVAFYSVVVVVITLVSVYVPA*
Ga0126373_101414463	3300010048	Tropical Forest Soil	MNEQAVQQWRGRGLNIAEVAFYSVLILVIILLSVYVPA*
Ga0126373_104190793	3300010048	Tropical Forest Soil	MNEQTVQEQRSRGLNIAEVAFYSVLVLVIMLLSIYVPA*
Ga0134067_104925311	3300010321	Grasslands Soil	MNQQAAEEWRRRGLNIAEVVFYSVVVLVIVILSIYVPA*
Ga0134063_107249401	3300010335	Grasslands Soil	MNQQAAQERRRWGLNIAEVAFYSALVLVILLLSLYIPA*
Ga0134062_101221743	3300010337	Grasslands Soil	MNQQAAQERWRGLNIAEVAFYSVLVLVVMLLSFYIPA*
Ga0126370_114645641	3300010358	Tropical Forest Soil	SVYDRRKATMNEQAVQQWRGRGLNIAEVAFYSVLILVIILLSVYVPA*
Ga0126370_119278611	3300010358	Tropical Forest Soil	MNQQAVQERRRRGFNIAEVAVYSVVVLVITLLCVYVPA*
Ga0126370_121650401	3300010358	Tropical Forest Soil	MNEQAVRERGRGLNIAEVAVYSALVLALMLLSVYVPA*
Ga0126376_104330841	3300010359	Tropical Forest Soil	MNEQAVQERRRRDLNIAEVAFYSVLVVVITLVSVYVPA*
Ga0126372_122986581	3300010360	Tropical Forest Soil	MDQQAVQVWRRRGLNIAEVAFYSVLVVVITLVSVYVPA*
Ga0126378_119877191	3300010361	Tropical Forest Soil	MSQQAVQVWRRRGLNIAEVAFYSVVVVVITLVSVYVPA*
Ga0126377_102599293	3300010362	Tropical Forest Soil	MNEQTVPERRGLNIAEVAFYSALVLVILLLSVCVPA*
Ga0126377_104324851	3300010362	Tropical Forest Soil	RKSTMNEQAVQERRGRGLNIAEVAFYSVLVLLIMLLSVYVPA*
Ga0126377_109257322	3300010362	Tropical Forest Soil	MNEQAVQERRGRGLNIAEVAFYSVLALLIMLLSVYVPA*
Ga0126377_129381241	3300010362	Tropical Forest Soil	MNEQAVQERRGRGFDVTEVAFYSILVVVILLLSVYVPA*
Ga0126379_102549243	3300010366	Tropical Forest Soil	MNQQAVQEWRRRGFNIAEVAFYSVLVVVIRLVSVYVPA*
Ga0126379_137825651	3300010366	Tropical Forest Soil	MDQQGVQEWRRRGLNIAEVAFYSVLVVVITLVSVY
Ga0126381_1004310932	3300010376	Tropical Forest Soil	MNEQAVQERRGRGFDVTEVAFYSIVVVVILLLLVYVPA*
Ga0126381_1010056792	3300010376	Tropical Forest Soil	MNEQAVQQRRGQGLHIAEVTFYSVLVLVIMLLSVYVPA*
Ga0134124_123978101	3300010397	Terrestrial Soil	RSTMNQQAVQEWRRRGLNIAEVAFYSGLVLVIMLLSVYVPA*
Ga0126383_103082681	3300010398	Tropical Forest Soil	AVQEWRRRGLNIAEVAFYSVLVVVITLVSVYVPA*
Ga0138505_1000561111	3300010999	Soil	MNERTVQERKGRGLNIAEIAFYSALVVVVMLLSVYVPA*
Ga0137383_106673472	3300012199	Vadose Zone Soil	MNGQAVEERWRRGLNIAEVAFYPVLVLVIMLLSVYVPA*
Ga0137362_100774522	3300012205	Vadose Zone Soil	MDQQAAQGRRHRGLNIAEVAFYSGLVLVIALLSVYVPA*
Ga0137362_101510803	3300012205	Vadose Zone Soil	MNEQAVQERRGRGLNIAEVAFYLVLVLLIMLLSVYVPA*
Ga0137376_116932682	3300012208	Vadose Zone Soil	MNQRAVRERGLNLAEVALYSVLVLGIMLLSFYVPA*
Ga0137377_100978172	3300012211	Vadose Zone Soil	MNQQAVQERRRQGLNIAEVAFYSVLVLVIMLLSFYIPA*
Ga0137370_100606491	3300012285	Vadose Zone Soil	MNQQAVQEWRRRGLNIAEVVFYSVVVLVIVILTIYVPA*
Ga0137369_101016731	3300012355	Vadose Zone Soil	MNEHAVQERRGRGLDIAEVALYSALVLLVILLSVCIPA*
Ga0137384_108877351	3300012357	Vadose Zone Soil	IMNEHAVQERRGRGLDIAEVALYSALVLLVILLSVCIPA*
Ga0137385_103644942	3300012359	Vadose Zone Soil	MNQQAVQEWRRRGLNIAEVAFYSVLVLVIMLLSFYIPA*
Ga0137385_104586741	3300012359	Vadose Zone Soil	MNEQAVQEWRRRGLNIAEVAFYSVLVLVIMLLSVYVPA*
Ga0137360_106462921	3300012361	Vadose Zone Soil	MNQQAVQERRRRGLNIAEVAFYSVLVLVIMLLSFYIPA*
Ga0137361_104377162	3300012362	Vadose Zone Soil	MNKQAVQERRGWGLNIAEVAFYSVVVLVIMLLSVYVPA*
Ga0137358_100731702	3300012582	Vadose Zone Soil	MNEQTVQERKGRGLNIAEVAFYSALVLVVMLLSVYVPA*
Ga0137395_100266001	3300012917	Vadose Zone Soil	MNEQAVQERRGWGRNIAEVAFYSVVVLVIMLLSVYVPA*
Ga0137404_102400863	3300012929	Vadose Zone Soil	MNQQAAQERRRGLNIAEVAFYSVLVLVVMLLSFYIPA*
Ga0137404_108787232	3300012929	Vadose Zone Soil	MNEQAVQERRGRGLNITEVAFYSVLVLVVMLLSVYVPA*
Ga0126375_101936533	3300012948	Tropical Forest Soil	MDRQAVQERRRWGLNIAEVAFYSALVLVILLLSFYIPA*
Ga0126369_107927532	3300012971	Tropical Forest Soil	MNQQAVQVWQRRGLNIAEVAFYSVVVVVITLVSVYVPA*
Ga0126369_123893271	3300012971	Tropical Forest Soil	MDQQAVHVWRLRGFNLAEVAFYSVVVVVITLVSVYVPA*
Ga0164308_101855162	3300012985	Soil	MNQQAVQEWRRRGLNIAEVAFYSILVLVIMLLSVYVPA*
Ga0164305_110601611	3300012989	Soil	MNGQAIQERRGRGLNIAEVAFYSVLVLVVMLLSVYVPA*
Ga0157372_128719182	3300013307	Corn Rhizosphere	SVYDRRRSTMNQQAVQEWRRRGLNIAEVAFYSGLVLVIMLLSVYVPA*
Ga0182041_100356651	3300016294	Soil	MNEQAVQQRRGQGLNIAEVTFYSVLVLAIMLLSVYVPA
Ga0182033_100286721	3300016319	Soil	RRRSTMNEQAVQERRGRGLNIAEVAFYSVLLLVVMLLSVYVPA
Ga0182035_116710041	3300016341	Soil	MNQQAVQVWRRRGLNIAEVAFYSVVVVVITLVSVYVPA
Ga0182037_112819362	3300016404	Soil	MDQQAVQVWRRRGLNIAEVAFYSVLVVVITLVSVY
Ga0182038_120566011	3300016445	Soil	MDEQAVQEGRGQGLSIAEVAFYSVLVLLVMLLSIYIPA
Ga0066667_122603241	3300018433	Grasslands Soil	MNQQAAQERRRWGLNIAEVAFYSVLVLVVMLLSFYIPA
Ga0066662_113382871	3300018468	Grasslands Soil	MNQQAVQEWRRRGLNIAEVVFYSVVVLVIVILSIYVPA
Ga0066669_113131521	3300018482	Grasslands Soil	MNQQAVQEWRRRGLKIAEVVFYSVVVLVILSLSIYVPAC
Ga0210399_114408231	3300020581	Soil	MNEQAVHERPGRSLNIAEVAFYSVLVLLVMLLLVCVPA
Ga0210401_113497751	3300020583	Soil	RRSTMNEQAVQEQRGRGLNIAEVAFYSVLVLVVMLLSVYVPA
Ga0210406_112893811	3300021168	Soil	MNEQAVQEQRGRGLNIAEVAFYSVLVLVVMLLSVYVPA
Ga0210400_109040433	3300021170	Soil	STMNQQAAEEWRRRGLNIAEVAFYSVLVFVIMLLSVYVPA
Ga0213872_101542873	3300021361	Rhizosphere	MNQQAVQEPRRRGLNIAEAAFYSLLVLVIMLLWVYVPA
Ga0213877_100150942	3300021372	Bulk Soil	MDQQAVQMWRRRGLNIAEVAFYSVLVVVITLMSVYVPA
Ga0210387_101155291	3300021405	Soil	MNEQTVQERKGRGLNIAEVAFYSALVVVVMLLSVYVPA
Ga0210402_114311511	3300021478	Soil	MNQQAAEEWRRRGLNIAEVAFYSVLVFVIMLLSVYVPA
Ga0126371_106165952	3300021560	Tropical Forest Soil	MNEQTVQEQRSRGLNIAEVAFYSVLVLVIMLLSIYVPA
Ga0126371_107870813	3300021560	Tropical Forest Soil	MNQQAVQEWRRRGLNIAEVAFYSVLVVVITLVSVYVPA
Ga0126371_115258032	3300021560	Tropical Forest Soil	MDEQAVQEGRNQGLSIAEVAFYSILVLLAMLLSMYIPA
Ga0126371_116412652	3300021560	Tropical Forest Soil	MNEQAVQERRGRGFDVTEVAFYSILVVVILLLSVYVPA
Ga0126371_119075872	3300021560	Tropical Forest Soil	MNQQAVQERRRRGLNIAEVAFYSVLVVVITLVSVYAPA
Ga0179589_101269151	3300024288	Vadose Zone Soil	MNEQTVQERKGRGLNIAEVAFYSALVLVVMLLSVYVPA
Ga0207646_109761232	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	MNQQAVQERRRQGLNIAEVAFYSVLVLVIMLLSFYIPA
Ga0209240_100101810	3300026304	Grasslands Soil	MNEQAVQERRGPGLNIAEVAFYSVVVLVIMLLSVYVPA
Ga0209240_11981112	3300026304	Grasslands Soil	MNEQAVQERRGRGLNIAEVAFYLVLVLLIMLLSVYVPA
Ga0209647_10175045	3300026319	Grasslands Soil	MNEQAVQERRGRGLNIAEVAFYSVLVLLIMLLSVYVPA
Ga0209647_10494311	3300026319	Grasslands Soil	MNEQAVQQRRGRGLDIAEVAFYSVLVLIIMLLSVYVPA
Ga0257163_10714562	3300026359	Soil	MNEQAVQERRGRSLNIAEVAVYSVLVLLVMLLSVYVPA
Ga0257168_10474331	3300026514	Soil	MNEQAVQERRGRGLNIPEVAFYSVLVLVVMLLSVYVPA
Ga0209648_104978272	3300026551	Grasslands Soil	MNEQGVQERGRGLNIAEVAFYSVLVLVVMLLSVYVPA
Ga0209577_103443562	3300026552	Soil	QQAAQEWRRRGLNIAEVAFYSVLVLVIMLLSVYVPA
Ga0208273_1030531	3300026846	Soil	MNEQAVQERRGPGLNIGEVAFYSVLVLVVMLLSVYVP
Ga0209729_10116122	3300027061	Forest Soil	MDQQAAQGRRRRGLNIAEVAFYSGLVLVITLLSVY
Ga0209622_10532651	3300027502	Forest Soil	MNEQAAQERRGRGLNIAEVAFYSVLVLLVMLLSVYVPA
Ga0209466_10066933	3300027646	Tropical Forest Soil	MDQQAVQVWRRRGLNIAELAVYSVLVVVITLVSVYVPA
Ga0209526_100266536	3300028047	Forest Soil	MNEQAVQERGRGLNIAEVAFYSVLVLVVMLLSVYVPA
Ga0209526_100270003	3300028047	Forest Soil	MNQQAVQKWRRRGLNIAEVAFYSVTVFAITLLSVYVPA
Ga0307282_100252321	3300028784	Soil	MNQQAVQEWRRRGLNIAEVAFYSVLVLVIMFLSVYVPA
Ga0307278_105442142	3300028878	Soil	MDQQAVQEWRRRGLNIAEVAFYSVLIVVITLLSVYVPA
Ga0318516_1000332410	3300031543	Soil	MDQQGVQEWRRRGLNIAEVAFYSVLVVVITLVSVYVPA
Ga0318516_100268341	3300031543	Soil	MDQQAVRVWRRRGLNIAEVAFYSVLVVVITLVSVYVPA
Ga0318516_100908892	3300031543	Soil	MNEQAVQQPRGQGLNIAEVALYSVLVLVIMLLSVYVPA
Ga0318516_102707633	3300031543	Soil	MNEQAVQERRGRGLNIAEVAFYSVLVLLILLLSVYVPA
Ga0318516_104534252	3300031543	Soil	MNEQAVQERRGRGLNIAEVAFYSVLLLVVMLLSVYVPA
Ga0318528_101290542	3300031561	Soil	MDQQAVHVWRLRGFNLAEVAFYSVVVVVITLVSVYVPA
Ga0318528_102975071	3300031561	Soil	MDQQAAQGRRRRGLNIAEVAFYSGLVLVITLLSVYVPA
Ga0318528_106426481	3300031561	Soil	MDQQAVRVWRRRGLNIAEVAFYSVLVVVITLVSVYV
Ga0318515_100554624	3300031572	Soil	MDQQAVQEWRRRGLNIAEVAFYSVLVVVITLVSVYVPA
Ga0318515_105635241	3300031572	Soil	MNQQAVQVWQRRGLNIAEVAFYSVVVVVITLVSVYVPA
Ga0318574_101246912	3300031680	Soil	MNQQAVQEWRRRGLNIAELAFYLVLVFVITLVSVYVPA
Ga0318574_108667232	3300031680	Soil	MDQQAVHVWRLRGFNLAEVAFYSVVVVVITLVSVYV
Ga0318496_108550621	3300031713	Soil	LLVLAIRRKSTMNEQAVQERRGRGFNIAEVAFYSVPVLVVMLLSAYVPA
Ga0306917_100744845	3300031719	Soil	MDQQAVQVWRRRGLNIAEVAFYSVLVVVITLVSVYVPA
Ga0306917_108735802	3300031719	Soil	MNEQTVQEQPSRGLNIAEVAFYSVLVLVIMLLSVYIPA
Ga0318521_108002711	3300031770	Soil	MDQQAVQVWRRRGLNIAEVAFYSVLVVVITLVSVYGPA
Ga0307473_107609982	3300031820	Hardwood Forest Soil	MNEQAVQERWGRGLNIAEVAFYSVLVLVVMLLSVYVPA
Ga0318511_103635891	3300031845	Soil	MNEQAVQEPRGRGLNIAEVAFYSVLVFLVMLLSVYVPA
Ga0318495_100780021	3300031860	Soil	YHRRRSTMDQQAVQVWRRRGLNIAEVAFYSVLVVVITLVSVYVPA
Ga0306923_102689693	3300031910	Soil	MNEQTVQEQRSRGLNIAEVAFYSVLVLVIMLLSVYIPA
Ga0310912_109204582	3300031941	Soil	MDQQAVQVWRRRGLNIAEVAFYSVLVVVITLVSVYV
Ga0310910_107309672	3300031946	Soil	MDQQAVQEWRRRGLNIAEVAFYSVLVVVITLVSVYVP
Ga0318530_101276451	3300031959	Soil	MNEQAVHERRGRGLNIAEVAFYSVLVLLILLLSVYVPA
Ga0318507_100119103	3300032025	Soil	MDQQAVRVWRRRGLNIAEVAFYSVLVVVITLVSVY
Ga0318559_101750081	3300032039	Soil	SNMDQQAVQVWRRRGLNIAEVAFYSVLVVVITLVSVYVPA
Ga0307471_1008915681	3300032180	Hardwood Forest Soil	MNKQAVEERRGWGLNIAEVAFYSVVVLVIMLLSVYVPA
Ga0307472_1003145533	3300032205	Hardwood Forest Soil	QQAVQGRRGQGLSIAEVAFYSALVLVILLLSLYIPA
Ga0318519_107927722	3300033290	Soil	MDQQAVQVWRRRGLNIAEVAFYSVLVVVITLVSVYVP

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F025817

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences