Metagenome / Metatranscriptome Family F025733

Basic Information
Family ID	F025733
Family Type	Metagenome / Metatranscriptome
Number of Sequences	200
Average Sequence Length	40 residues
Representative Sequence	MHAPMRQVAFSAIRVGAMVALAMLLILGLLPAVLAVQAAST
Number of Associated Samples	164
Number of Associated Scaffolds	200

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	10.00 %
% of genes near scaffold ends (potentially truncated)	12.50 %
% of genes from short scaffolds (< 2000 bps)	91.00 %
Associated GOLD sequencing projects	157
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.59

Most Common Taxonomy
Group	Bacteria (80.500 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (25.500 % of family members)
Environment Ontology (ENVO)	Unclassified (28.500 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (39.500 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 52.17% β-sheet: 0.00% Coil/Unstructured: 47.83%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 200 Family Scaffolds
PF02811	PHP	58.50
PF07733	DNA_pol3_alpha	5.50
PF00932	LTD	1.00
PF04075	F420H2_quin_red	1.00
PF05544	Pro_racemase	0.50
PF14079	DUF4260	0.50
PF13305	TetR_C_33	0.50
PF00154	RecA	0.50
PF00561	Abhydrolase_1	0.50
PF08327	AHSA1	0.50
PF11799	IMS_C	0.50
PF00491	Arginase	0.50
PF13602	ADH_zinc_N_2	0.50
PF01230	HIT	0.50
PF02469	Fasciclin	0.50

COG ID	Name	Functional Category	% Frequency in 200 Family Scaffolds
COG0587	DNA polymerase III, alpha subunit	Replication, recombination and repair [L]	5.50
COG2176	DNA polymerase III, alpha subunit (gram-positive type)	Replication, recombination and repair [L]	5.50
COG0010	Arginase/agmatinase family enzyme	Amino acid transport and metabolism [E]	0.50
COG0468	RecA/RadA recombinase	Replication, recombination and repair [L]	0.50
COG2335	Uncaracterized surface protein containing fasciclin (FAS1) repeats	General function prediction only [R]	0.50
COG3938	Proline racemase/hydroxyproline epimerase	Amino acid transport and metabolism [E]	0.50

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	80.50 %
Unclassified	root	N/A	19.50 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	80.50 %
Unclassified	root	N/A	19.50 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	80.50 %
Unclassified	root	N/A	19.50 %

Name	Rank	Taxonomy	Distribution
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	71.00 %
Unclassified	root	N/A	19.50 %
environmental samples	no rank	All Organisms → cellular organisms → Bacteria → environmental samples	0.50 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.50 %

Name	Rank	Taxonomy	Distribution
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	62.50 %
Unclassified	root	N/A	19.50 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	8.50 %
uncultured bacterium 148	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 148	0.50 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	0.50 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	19.50 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	5.50 %
unclassified Chloroflexi	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi	5.00 %
Thermomicrobia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia	4.00 %
Acidobacteriales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales	0.50 %
Acidimicrobiia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia	0.50 %
uncultured bacterium 148	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 148	0.50 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	19.50 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	4.50 %
Thermomicrobiales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales	4.00 %
Micromonosporales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales	1.00 %
Propionibacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales	1.00 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	0.50 %
Chloroflexi bacterium 13_1_40CM_68_21	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_68_21	0.50 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	0.50 %
Pseudonocardiales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales	0.50 %
Corynebacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales	0.50 %
Acidimicrobiales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales	0.50 %
uncultured bacterium 148	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 148	0.50 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	19.50 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	4.50 %
unclassified Thermomicrobiales	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales	4.00 %
Nocardioidaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae	1.00 %
Micromonosporaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae	1.00 %
Edaphobacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter	0.50 %
Pseudonocardiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae	0.50 %
Nocardiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae	0.50 %
Acidimicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae	0.50 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	0.50 %
Chloroflexi bacterium 13_1_40CM_68_21	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_68_21	0.50 %
uncultured bacterium 148	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 148	0.50 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	19.50 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	4.50 %
Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium	4.00 %
Nocardioidaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae	1.00 %
Micromonosporaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae	1.00 %
Edaphobacter aggregans	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans	0.50 %
unclassified Acidimicrobiaceae	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae	0.50 %
Pseudonocardiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae	0.50 %
Nocardiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae	0.50 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	0.50 %
Chloroflexi bacterium 13_1_40CM_68_21	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_68_21	0.50 %
uncultured bacterium 148	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 148	0.50 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	19.50 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	4.50 %
Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium	4.00 %
Nocardioidaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae	1.00 %
Micromonosporaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae	1.00 %
Acidimicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium	0.50 %
Edaphobacter aggregans	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans	0.50 %
Pseudonocardiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae	0.50 %
Nocardiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae	0.50 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	0.50 %
Chloroflexi bacterium 13_1_40CM_68_21	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_68_21	0.50 %
uncultured bacterium 148	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 148	0.50 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2067725000\|GPWRP_F5MPXY302ID2T5	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	542	Open in IMG/M
2124908041\|P3_CLC_ConsensusfromContig50819	All Organisms → cellular organisms → Bacteria	1542	Open in IMG/M
3300000033\|ICChiseqgaiiDRAFT_c0586098	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1309	Open in IMG/M
3300000364\|INPhiseqgaiiFebDRAFT_105353342	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	912	Open in IMG/M
3300000364\|INPhiseqgaiiFebDRAFT_105756733	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	2193	Open in IMG/M
3300000956\|JGI10216J12902_115434909	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	820	Open in IMG/M
3300001537\|A2065W1_11127812	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1440	Open in IMG/M
3300002568\|C688J35102_120476290	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1100	Open in IMG/M
3300004061\|Ga0055487_10002204	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae	1861	Open in IMG/M
3300004062\|Ga0055500_10132053	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	579	Open in IMG/M
3300004157\|Ga0062590_100952407	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	810	Open in IMG/M
3300004480\|Ga0062592_100372330	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1122	Open in IMG/M
3300004643\|Ga0062591_100526182	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans	1023	Open in IMG/M
3300005093\|Ga0062594_101318126	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae	726	Open in IMG/M
3300005165\|Ga0066869_10085432	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	611	Open in IMG/M
3300005333\|Ga0070677_10452341	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	687	Open in IMG/M
3300005334\|Ga0068869_100929383	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	754	Open in IMG/M
3300005345\|Ga0070692_11118171	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	557	Open in IMG/M
3300005440\|Ga0070705_101119487	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	645	Open in IMG/M
3300005456\|Ga0070678_101746354	Not Available	586	Open in IMG/M
3300005468\|Ga0070707_100011897	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	8122	Open in IMG/M
3300005535\|Ga0070684_100911256	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	824	Open in IMG/M
3300005546\|Ga0070696_101610873	Not Available	558	Open in IMG/M
3300005564\|Ga0070664_101807086	Not Available	580	Open in IMG/M
3300005618\|Ga0068864_101151220	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	773	Open in IMG/M
3300005618\|Ga0068864_101583074	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	659	Open in IMG/M
3300005718\|Ga0068866_11106509	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	568	Open in IMG/M
3300005764\|Ga0066903_106190061	Not Available	626	Open in IMG/M
3300005764\|Ga0066903_107300036	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	571	Open in IMG/M
3300005836\|Ga0074470_11255215	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_68_21	1871	Open in IMG/M
3300005836\|Ga0074470_11747550	All Organisms → cellular organisms → Bacteria	4507	Open in IMG/M
3300005840\|Ga0068870_11172868	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	555	Open in IMG/M
3300005842\|Ga0068858_100237480	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1729	Open in IMG/M
3300005937\|Ga0081455_10310924	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	1126	Open in IMG/M
3300006041\|Ga0075023_100160635	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	836	Open in IMG/M
3300006046\|Ga0066652_100223478	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 148	1634	Open in IMG/M
3300006046\|Ga0066652_100355005	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1321	Open in IMG/M
3300006057\|Ga0075026_101091983	Not Available	501	Open in IMG/M
3300006575\|Ga0074053_11619409	Not Available	1014	Open in IMG/M
3300006578\|Ga0074059_11070017	Not Available	683	Open in IMG/M
3300006604\|Ga0074060_11904500	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	667	Open in IMG/M
3300006606\|Ga0074062_12727138	Not Available	503	Open in IMG/M
3300006755\|Ga0079222_10096954	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1537	Open in IMG/M
3300006904\|Ga0075424_101222811	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	799	Open in IMG/M
3300009087\|Ga0105107_10250602	Not Available	1237	Open in IMG/M
3300009098\|Ga0105245_10704872	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1043	Open in IMG/M
3300009098\|Ga0105245_10720047	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1032	Open in IMG/M
3300009098\|Ga0105245_12138659	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	613	Open in IMG/M
3300009137\|Ga0066709_103706939	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	554	Open in IMG/M
3300009148\|Ga0105243_11007274	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	836	Open in IMG/M
3300009162\|Ga0075423_10298201	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1689	Open in IMG/M
3300009176\|Ga0105242_12097879	Not Available	609	Open in IMG/M
3300009177\|Ga0105248_12154732	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	634	Open in IMG/M
3300009789\|Ga0126307_10033615	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	3958	Open in IMG/M
3300010036\|Ga0126305_10300166	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1042	Open in IMG/M
3300010362\|Ga0126377_12961241	Not Available	548	Open in IMG/M
3300010396\|Ga0134126_11003758	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	934	Open in IMG/M
3300010401\|Ga0134121_11238336	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	748	Open in IMG/M
3300010401\|Ga0134121_11882951	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	627	Open in IMG/M
3300010403\|Ga0134123_10465582	All Organisms → cellular organisms → Bacteria	1180	Open in IMG/M
3300011119\|Ga0105246_10703720	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	886	Open in IMG/M
3300011119\|Ga0105246_10903634	Not Available	792	Open in IMG/M
3300011400\|Ga0137312_1028648	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	837	Open in IMG/M
3300011442\|Ga0137437_1169424	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	757	Open in IMG/M
3300012001\|Ga0120167_1094401	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	615	Open in IMG/M
3300012003\|Ga0120163_1133582	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	524	Open in IMG/M
3300012204\|Ga0137374_10444509	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1019	Open in IMG/M
3300012212\|Ga0150985_108038904	Not Available	828	Open in IMG/M
3300012212\|Ga0150985_116725158	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium	960	Open in IMG/M
3300012469\|Ga0150984_116128972	Not Available	532	Open in IMG/M
3300012883\|Ga0157281_1025352	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	783	Open in IMG/M
3300012903\|Ga0157289_10045265	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1094	Open in IMG/M
3300012908\|Ga0157286_10116471	Not Available	808	Open in IMG/M
3300012909\|Ga0157290_10481456	Not Available	503	Open in IMG/M
3300012911\|Ga0157301_10133068	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	772	Open in IMG/M
3300012915\|Ga0157302_10037655	Not Available	1310	Open in IMG/M
3300012951\|Ga0164300_10218257	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae	946	Open in IMG/M
3300012951\|Ga0164300_10273426	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	870	Open in IMG/M
3300012951\|Ga0164300_10581791	Not Available	657	Open in IMG/M
3300012951\|Ga0164300_10589193	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	654	Open in IMG/M
3300012955\|Ga0164298_10463532	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae	837	Open in IMG/M
3300012955\|Ga0164298_11135620	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	587	Open in IMG/M
3300012957\|Ga0164303_10065193	All Organisms → cellular organisms → Bacteria	1677	Open in IMG/M
3300012957\|Ga0164303_10553733	Not Available	747	Open in IMG/M
3300012958\|Ga0164299_10067546	Not Available	1742	Open in IMG/M
3300012958\|Ga0164299_10459599	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	835	Open in IMG/M
3300012958\|Ga0164299_10608457	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	748	Open in IMG/M
3300012960\|Ga0164301_10849021	Not Available	703	Open in IMG/M
3300012984\|Ga0164309_10346600	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1089	Open in IMG/M
3300012985\|Ga0164308_11313073	All Organisms → cellular organisms → Bacteria	657	Open in IMG/M
3300012987\|Ga0164307_10314008	Not Available	1123	Open in IMG/M
3300012988\|Ga0164306_10115377	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae	1779	Open in IMG/M
3300012989\|Ga0164305_11164734	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	666	Open in IMG/M
3300013308\|Ga0157375_10291210	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae	1796	Open in IMG/M
3300013763\|Ga0120179_1113158	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	597	Open in IMG/M
3300013766\|Ga0120181_1018384	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1826	Open in IMG/M
3300014056\|Ga0120125_1053695	Not Available	890	Open in IMG/M
3300014320\|Ga0075342_1067890	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium	891	Open in IMG/M
3300014325\|Ga0163163_11675639	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	697	Open in IMG/M
3300015085\|Ga0167632_1001542	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	3525	Open in IMG/M
3300015163\|Ga0167665_1013860	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1621	Open in IMG/M
3300015191\|Ga0167659_1008294	All Organisms → cellular organisms → Bacteria	2951	Open in IMG/M
3300015192\|Ga0167646_1002713	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	5965	Open in IMG/M
3300015192\|Ga0167646_1034537	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1223	Open in IMG/M
3300015192\|Ga0167646_1059698	Not Available	860	Open in IMG/M
3300015192\|Ga0167646_1076101	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	729	Open in IMG/M
3300015194\|Ga0167666_1001186	All Organisms → cellular organisms → Bacteria	9408	Open in IMG/M
3300015199\|Ga0167647_1024307	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium	1814	Open in IMG/M
3300015199\|Ga0167647_1071787	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	916	Open in IMG/M
3300015371\|Ga0132258_10713573	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	2525	Open in IMG/M
3300015371\|Ga0132258_11073351	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	2035	Open in IMG/M
3300015372\|Ga0132256_102715706	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	594	Open in IMG/M
3300015372\|Ga0132256_102773494	Not Available	589	Open in IMG/M
3300015373\|Ga0132257_102049515	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	738	Open in IMG/M
3300015374\|Ga0132255_103351582	Not Available	682	Open in IMG/M
3300017792\|Ga0163161_11000351	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	714	Open in IMG/M
3300017965\|Ga0190266_10014520	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	2133	Open in IMG/M
3300017965\|Ga0190266_11329096	Not Available	507	Open in IMG/M
3300018028\|Ga0184608_10291670	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	717	Open in IMG/M
3300018053\|Ga0184626_10152007	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	984	Open in IMG/M
3300018072\|Ga0184635_10069199	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1376	Open in IMG/M
3300018073\|Ga0184624_10492533	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	534	Open in IMG/M
3300018075\|Ga0184632_10192911	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	897	Open in IMG/M
3300018081\|Ga0184625_10242934	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	943	Open in IMG/M
3300018083\|Ga0184628_10468557	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	655	Open in IMG/M
3300018084\|Ga0184629_10057924	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium	1791	Open in IMG/M
3300018084\|Ga0184629_10585135	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	571	Open in IMG/M
3300018432\|Ga0190275_10647656	All Organisms → cellular organisms → Bacteria	1109	Open in IMG/M
3300018469\|Ga0190270_13212741	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	518	Open in IMG/M
3300018469\|Ga0190270_13409249	Not Available	504	Open in IMG/M
3300018476\|Ga0190274_11091490	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	877	Open in IMG/M
3300018481\|Ga0190271_11875745	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	710	Open in IMG/M
3300019356\|Ga0173481_10133522	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1002	Open in IMG/M
3300019361\|Ga0173482_10315154	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	694	Open in IMG/M
3300019884\|Ga0193741_1180650	Not Available	507	Open in IMG/M
3300020016\|Ga0193696_1101112	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	740	Open in IMG/M
3300021081\|Ga0210379_10006675	All Organisms → cellular organisms → Bacteria	4234	Open in IMG/M
3300021082\|Ga0210380_10137211	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1093	Open in IMG/M
3300021082\|Ga0210380_10156045	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1025	Open in IMG/M
3300022886\|Ga0247746_1059555	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	890	Open in IMG/M
3300023062\|Ga0247791_1069760	Not Available	572	Open in IMG/M
3300023266\|Ga0247789_1056389	Not Available	731	Open in IMG/M
3300025315\|Ga0207697_10339867	All Organisms → cellular organisms → Bacteria	667	Open in IMG/M
3300025899\|Ga0207642_10622593	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	674	Open in IMG/M
3300025922\|Ga0207646_10244883	All Organisms → cellular organisms → Bacteria	1619	Open in IMG/M
3300025927\|Ga0207687_10314469	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1266	Open in IMG/M
3300025931\|Ga0207644_11347231	Not Available	600	Open in IMG/M
3300025933\|Ga0207706_10282470	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1447	Open in IMG/M
3300025933\|Ga0207706_10953084	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	723	Open in IMG/M
3300025946\|Ga0210126_105230	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1066	Open in IMG/M
3300025972\|Ga0207668_10428653	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1124	Open in IMG/M
3300026035\|Ga0207703_10291364	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1486	Open in IMG/M
3300026078\|Ga0207702_11101850	Not Available	788	Open in IMG/M
3300026121\|Ga0207683_10193067	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1849	Open in IMG/M
3300027876\|Ga0209974_10238773	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	681	Open in IMG/M
3300028710\|Ga0307322_10112051	Not Available	708	Open in IMG/M
3300028717\|Ga0307298_10050941	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1135	Open in IMG/M
3300028720\|Ga0307317_10039944	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1485	Open in IMG/M
3300028768\|Ga0307280_10016520	All Organisms → cellular organisms → Bacteria	2079	Open in IMG/M
3300028768\|Ga0307280_10092193	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	998	Open in IMG/M
3300028784\|Ga0307282_10306570	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	766	Open in IMG/M
3300028790\|Ga0307283_10139978	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	661	Open in IMG/M
3300028802\|Ga0307503_10119206	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1154	Open in IMG/M
3300028803\|Ga0307281_10001086	All Organisms → cellular organisms → Bacteria	7380	Open in IMG/M
3300028803\|Ga0307281_10002235	All Organisms → cellular organisms → Bacteria	5366	Open in IMG/M
3300028803\|Ga0307281_10009680	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	2663	Open in IMG/M
3300028803\|Ga0307281_10059031	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium	1222	Open in IMG/M
3300028819\|Ga0307296_10243526	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium	978	Open in IMG/M
3300028876\|Ga0307286_10169007	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	788	Open in IMG/M
3300028885\|Ga0307304_10277632	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	735	Open in IMG/M
3300030010\|Ga0302299_10094706	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium	1646	Open in IMG/M
3300031539\|Ga0307380_10046536	All Organisms → cellular organisms → Bacteria	4825	Open in IMG/M
3300031640\|Ga0318555_10150134	All Organisms → cellular organisms → Bacteria	1247	Open in IMG/M
3300031713\|Ga0318496_10561840	All Organisms → cellular organisms → Bacteria	631	Open in IMG/M
3300031740\|Ga0307468_101421050	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	639	Open in IMG/M
3300031819\|Ga0318568_10426991	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	826	Open in IMG/M
3300031892\|Ga0310893_10475200	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	558	Open in IMG/M
3300031908\|Ga0310900_10917095	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	716	Open in IMG/M
3300031918\|Ga0311367_10266613	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium	1781	Open in IMG/M
3300031941\|Ga0310912_10511362	Not Available	936	Open in IMG/M
3300031965\|Ga0326597_10038067	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	6082	Open in IMG/M
3300031965\|Ga0326597_11834837	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	567	Open in IMG/M
3300031997\|Ga0315278_10291460	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1686	Open in IMG/M
3300032000\|Ga0310903_10807048	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	514	Open in IMG/M
3300032075\|Ga0310890_11505833	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	555	Open in IMG/M
3300032143\|Ga0315292_10938386	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	721	Open in IMG/M
3300032164\|Ga0315283_10549686	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1253	Open in IMG/M
3300032173\|Ga0315268_11288012	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium	741	Open in IMG/M
3300032256\|Ga0315271_10647499	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	905	Open in IMG/M
3300032256\|Ga0315271_10674793	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	886	Open in IMG/M
3300032275\|Ga0315270_10136306	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1467	Open in IMG/M
3300033289\|Ga0310914_11680178	Not Available	539	Open in IMG/M
3300033289\|Ga0310914_11760463	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	524	Open in IMG/M
3300034126\|Ga0370486_035027	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1148	Open in IMG/M
3300034147\|Ga0364925_0339384	Not Available	565	Open in IMG/M
3300034150\|Ga0364933_084754	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	797	Open in IMG/M
3300034150\|Ga0364933_089934	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	774	Open in IMG/M
3300034176\|Ga0364931_0338726	Not Available	502	Open in IMG/M
3300034195\|Ga0370501_0177591	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	745	Open in IMG/M
3300034417\|Ga0364941_079704	Not Available	769	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	78.50%
Host-Associated	Host-Associated	21.50%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	64.00%
Plants	Host-Associated → Plants	21.50%
Aquatic	Environmental → Aquatic	14.50%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	60.50%
Rhizoplane	Host-Associated → Plants → Rhizoplane	10.50%
Rhizosphere	Host-Associated → Plants → Rhizosphere	10.50%
Sediment	Environmental → Aquatic → Sediment	7.50%
Freshwater	Environmental → Aquatic → Freshwater	5.50%
Floodplain	Environmental → Terrestrial → Floodplain	2.50%
Marine	Environmental → Aquatic → Marine	1.50%
Peat	Environmental → Terrestrial → Peat	1.00%
Roots	Host-Associated → Plants → Roots	0.50%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	54.00%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	7.50%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	6.50%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	6.00%
Loam	Environmental → Terrestrial → Soil → Loam	4.50%
Soil	Host-Associated → Plants → Rhizosphere → Soil	4.50%
Lake	Environmental → Aquatic → Freshwater → Lake	3.50%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	3.00%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	2.50%
Sediment	Environmental → Aquatic → Freshwater → Sediment	2.00%
Wetlands	Environmental → Aquatic → Marine → Wetlands	1.50%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	1.50%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	1.00%
Soil	Host-Associated → Plants → Rhizoplane → Soil	1.00%
Clay	Environmental → Terrestrial → Soil → Clay	0.50%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.50%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	37.00%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	7.50%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	6.50%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	6.00%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	4.50%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	4.00%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	4.00%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	3.50%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	3.50%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	3.50%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	3.00%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	3.00%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	2.50%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	2.00%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	2.00%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	1.50%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	1.50%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	1.00%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	1.00%
Unclassified	Host-Associated → Plants → Rhizoplane → Soil → Unclassified	1.00%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.50%
Unclassified	Environmental → Terrestrial → Soil → Clay → Unclassified	0.50%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.50%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	25.50%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	5.00%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	4.50%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	4.00%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	3.50%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	3.50%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost	3.00%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	3.00%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	2.50%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	2.50%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	2.50%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	2.00%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	2.00%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	2.00%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	2.00%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.00%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	2.00%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	1.50%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	1.50%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	1.50%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	1.50%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	1.00%
Sediment (Intertidal)	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)	1.00%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	1.00%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	1.00%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	1.00%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	1.00%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	1.00%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	1.00%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere	1.00%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	1.00%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	1.00%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	1.00%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	0.50%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	0.50%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	0.50%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.50%
Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil	0.50%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.50%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.50%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	0.50%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.50%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.50%
Soil	Environmental → Terrestrial → Soil → Clay → Unclassified → Soil	0.50%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.50%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.50%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	0.50%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.50%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.50%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.50%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.50%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.50%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.50%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	0.50%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2067725000	Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soil	Environmental	Open in IMG/M
2124908041	Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P3	Environmental	Open in IMG/M
3300000033	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental	Open in IMG/M
3300001537	Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-65 cm-11A)- 1 week illumina	Environmental	Open in IMG/M
3300002568	Grasslands soil microbial communities from Hopland, California, USA - 2	Environmental	Open in IMG/M
3300004061	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqC_D2	Environmental	Open in IMG/M
3300004062	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2	Environmental	Open in IMG/M
3300004157	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2	Environmental	Open in IMG/M
3300004480	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4	Environmental	Open in IMG/M
3300004643	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3	Environmental	Open in IMG/M
3300005093	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks	Environmental	Open in IMG/M
3300005165	Soil and rhizosphere microbial communities from Laval, Canada - mgHMC	Environmental	Open in IMG/M
3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Host-Associated	Open in IMG/M
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated	Open in IMG/M
3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Environmental	Open in IMG/M
3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Environmental	Open in IMG/M
3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Host-Associated	Open in IMG/M
3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Environmental	Open in IMG/M
3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Environmental	Open in IMG/M
3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Environmental	Open in IMG/M
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated	Open in IMG/M
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated	Open in IMG/M
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005836	Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB	Environmental	Open in IMG/M
3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Host-Associated	Open in IMG/M
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated	Open in IMG/M
3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated	Open in IMG/M
3300006041	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014	Environmental	Open in IMG/M
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental	Open in IMG/M
3300006057	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012	Environmental	Open in IMG/M
3300006575	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006578	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006604	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006606	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300009087	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015	Environmental	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300009789	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28	Environmental	Open in IMG/M
3300010036	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated	Open in IMG/M
3300011400	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT133_2	Environmental	Open in IMG/M
3300011442	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2	Environmental	Open in IMG/M
3300012001	Permafrost microbial communities from Nunavut, Canada - A24_80cm_12M	Environmental	Open in IMG/M
3300012003	Permafrost microbial communities from Nunavut, Canada - A20_80cm_0.25M	Environmental	Open in IMG/M
3300012204	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated	Open in IMG/M
3300012883	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1	Environmental	Open in IMG/M
3300012903	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1	Environmental	Open in IMG/M
3300012908	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1	Environmental	Open in IMG/M
3300012909	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1	Environmental	Open in IMG/M
3300012911	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2	Environmental	Open in IMG/M
3300012915	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2	Environmental	Open in IMG/M
3300012951	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG	Environmental	Open in IMG/M
3300012955	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG	Environmental	Open in IMG/M
3300012957	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG	Environmental	Open in IMG/M
3300012958	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG	Environmental	Open in IMG/M
3300012960	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG	Environmental	Open in IMG/M
3300012984	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG	Environmental	Open in IMG/M
3300012985	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG	Environmental	Open in IMG/M
3300012987	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG	Environmental	Open in IMG/M
3300012988	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG	Environmental	Open in IMG/M
3300012989	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG	Environmental	Open in IMG/M
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated	Open in IMG/M
3300013763	Permafrost microbial communities from Nunavut, Canada - A15_65cm_0M	Environmental	Open in IMG/M
3300013766	Permafrost microbial communities from Nunavut, Canada - A26_65cm_6M	Environmental	Open in IMG/M
3300014056	Permafrost microbial communities from Nunavut, Canada - A20_5cm_0M	Environmental	Open in IMG/M
3300014320	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1	Environmental	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300015085	Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4B, Ice margin, adjacent to proglacial lake)	Environmental	Open in IMG/M
3300015163	Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb1b, glacier snout)	Environmental	Open in IMG/M
3300015191	Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-10 : a,b,c samples pooled, hydrological sediment from glacier outflow)	Environmental	Open in IMG/M
3300015192	Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-2a, rock/snow interface)	Environmental	Open in IMG/M
3300015194	Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb1c, glacier snout)	Environmental	Open in IMG/M
3300015199	Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-2c, rock/snow interface)	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated	Open in IMG/M
3300017965	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T	Environmental	Open in IMG/M
3300018028	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex	Environmental	Open in IMG/M
3300018053	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1	Environmental	Open in IMG/M
3300018072	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2	Environmental	Open in IMG/M
3300018073	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1	Environmental	Open in IMG/M
3300018075	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1	Environmental	Open in IMG/M
3300018081	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1	Environmental	Open in IMG/M
3300018083	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1	Environmental	Open in IMG/M
3300018084	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1	Environmental	Open in IMG/M
3300018432	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T	Environmental	Open in IMG/M
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental	Open in IMG/M
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental	Open in IMG/M
3300018481	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T	Environmental	Open in IMG/M
3300019356	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)	Environmental	Open in IMG/M
3300019361	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)	Environmental	Open in IMG/M
3300019884	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2	Environmental	Open in IMG/M
3300020016	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1	Environmental	Open in IMG/M
3300021081	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo	Environmental	Open in IMG/M
3300021082	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo	Environmental	Open in IMG/M
3300022886	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5	Environmental	Open in IMG/M
3300023062	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S081-202R-4	Environmental	Open in IMG/M
3300023266	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S220-509R-4	Environmental	Open in IMG/M
3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Host-Associated	Open in IMG/M
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025946	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqC_D2 (SPAdes)	Environmental	Open in IMG/M
3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes)	Host-Associated	Open in IMG/M
3300028710	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380	Environmental	Open in IMG/M
3300028717	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158	Environmental	Open in IMG/M
3300028720	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357	Environmental	Open in IMG/M
3300028768	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119	Environmental	Open in IMG/M
3300028784	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121	Environmental	Open in IMG/M
3300028790	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122	Environmental	Open in IMG/M
3300028802	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S	Environmental	Open in IMG/M
3300028803	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120	Environmental	Open in IMG/M
3300028819	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153	Environmental	Open in IMG/M
3300028876	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140	Environmental	Open in IMG/M
3300028885	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185	Environmental	Open in IMG/M
3300030010	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_4	Environmental	Open in IMG/M
3300031539	Soil microbial communities from Risofladan, Vaasa, Finland - UN-3	Environmental	Open in IMG/M
3300031640	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23	Environmental	Open in IMG/M
3300031713	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22	Environmental	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300031819	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21	Environmental	Open in IMG/M
3300031892	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2	Environmental	Open in IMG/M
3300031908	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1	Environmental	Open in IMG/M
3300031918	III_Fen_N3 coassembly	Environmental	Open in IMG/M
3300031941	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080	Environmental	Open in IMG/M
3300031965	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185	Environmental	Open in IMG/M
3300031997	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0	Environmental	Open in IMG/M
3300032000	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3	Environmental	Open in IMG/M
3300032075	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3	Environmental	Open in IMG/M
3300032143	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0	Environmental	Open in IMG/M
3300032164	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0	Environmental	Open in IMG/M
3300032173	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top	Environmental	Open in IMG/M
3300032256	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top	Environmental	Open in IMG/M
3300032275	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom	Environmental	Open in IMG/M
3300033289	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108	Environmental	Open in IMG/M
3300034126	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_16	Environmental	Open in IMG/M
3300034147	Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17	Environmental	Open in IMG/M
3300034150	Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17	Environmental	Open in IMG/M
3300034176	Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17	Environmental	Open in IMG/M
3300034195	Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17	Environmental	Open in IMG/M
3300034417	Sediment microbial communities from East River floodplain, Colorado, United States - 17_s17	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.59
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.59
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F025733

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
GPWRP_02742300	2067725000	Soil	MHAPMRQITFSAVRIGAMVALAMLLILGLLPAILSVQAATQ
P3_CLC_02308140	2124908041	Soil	MHAPMRQIAFSAIRTGAMVALAMLLILGLLPAILAVQAAST
ICChiseqgaiiDRAFT_05860982	3300000033	Soil	MHAPMRQIAFSAVRVGAMVALAMGLILGLLPAVLAVQAAST*
INPhiseqgaiiFebDRAFT_1053533423	3300000364	Soil	MQAPVHAPTRQVAISAVRTALLVAVAMLLILGLLPAVLAVQAASM*
INPhiseqgaiiFebDRAFT_1057567333	3300000364	Soil	MHAPMRQVAYSAIRVGAMVALAMLLILGLLPAVLAVQAAST*
JGI10216J12902_1154349092	3300000956	Soil	MRQVAFAVIRTGLMVGLAMLLILGLLPAVLAVQAASM*
A2065W1_111278122	3300001537	Permafrost	MHAPTRQIAFSAIRIGAMVALAMLLILGLLPAVLAVQAASS*
C688J35102_1204762902	3300002568	Soil	MHAPMRQVAFSAARIGFMVALAMMLILGLLPAILSVQAATQ*
Ga0055487_100022042	3300004061	Natural And Restored Wetlands	MHAPMRQIAFSAIRTGILVALAMLLILGLLPAILAVQAAGL*
Ga0055500_101320531	3300004062	Natural And Restored Wetlands	MHAPMRQLAFSAIRIGAMVAFAMLLILGLLPAILAVQAAS
Ga0062590_1009524071	3300004157	Soil	MHAPMRQLAFSVVRVGFMVAIAMLLILGLLPAVLAVQAAST*
Ga0062592_1003723301	3300004480	Soil	MHAPVRQVAFSAIRVGAMVALAMLLILGLLPAILAVQAAST*
Ga0062591_1005261821	3300004643	Soil	APTRQVAISAVRTALLVAVAMLLILGLLPAVLAVQAASM*
Ga0062594_1013181261	3300005093	Soil	MHAPMRQLTVSAVRIGFMVALAMLLILGLLPAVLAVQAASH*
Ga0066869_100854322	3300005165	Soil	MHAPVRQVAFSAIRVGAMVALAMLLILGLLPAVLAVQAAST*
Ga0070677_104523412	3300005333	Miscanthus Rhizosphere	MHAPMRQIAFSAFRVGAMVALAMLLILGLLPAVLAVQAAST*
Ga0068869_1009293832	3300005334	Miscanthus Rhizosphere	MHAPMHAPTRQVAISAVRTALLVAVAMLLILGLLPAVLAVQAASM*
Ga0070692_111181712	3300005345	Corn, Switchgrass And Miscanthus Rhizosphere	MHAPVRQFAFSAIRVGAMVALAMLLILGLLPAVLAVQAAST*
Ga0070705_1011194871	3300005440	Corn, Switchgrass And Miscanthus Rhizosphere	MHAPMHAPTRQVAISAVRTALLVAFAMLLILGLLPAVLAVQ
Ga0070678_1017463541	3300005456	Miscanthus Rhizosphere	MHAPMRQITFSAVRIGAMVALAMLLILGLLPAILSVQAASQ*
Ga0070707_10001189711	3300005468	Corn, Switchgrass And Miscanthus Rhizosphere	VHAPIQPVAASVLRAGILVALAMLLILGLLPAVLAAEASRS*
Ga0070684_1009112562	3300005535	Corn Rhizosphere	MHAPVRQVAFSALRVGAMVALAMLLILGLLPAVLAVQAAST*
Ga0070696_1016108731	3300005546	Corn, Switchgrass And Miscanthus Rhizosphere	MHAPTRQVAISAVRTALLVAVAMLLILGLLPAVLAVQAASM*
Ga0070664_1018070861	3300005564	Corn Rhizosphere	MNAPMRQIAFSAFRVGAMVALAMGLILGLLPAVLAVQAAST*
Ga0068864_1011512202	3300005618	Switchgrass Rhizosphere	MTAPMRQIAFSTARIGLLVALAMMLILGLLPAILSVEAATQ*
Ga0068864_1015830741	3300005618	Switchgrass Rhizosphere	MHAPTRQLAFSVARIGVSVAVAMLLILGLLPAILAVQAATT*
Ga0068866_111065092	3300005718	Miscanthus Rhizosphere	MHAPMHAPTRQVAISAVRTALLVAVAMLLILGLLPAVLAVQAAS
Ga0066903_1061900611	3300005764	Tropical Forest Soil	MDAPMRQVAFAVIRTGLMVGLAMLLILGLLPAVLAVQAAGM*
Ga0066903_1073000361	3300005764	Tropical Forest Soil	MRQLAVSVIRIGLMVGLAMLLILGLLPAVLAVQAASM*
Ga0074470_112552152	3300005836	Sediment (Intertidal)	MRQIAFSAVRIGAMIALAMLLILGLLPAILAVQAAT*
Ga0074470_117475506	3300005836	Sediment (Intertidal)	MNAPMRQVTFTVIRIVAMVALAMLLILGLLPAALAVEAAGP*
Ga0068870_111728681	3300005840	Miscanthus Rhizosphere	MHAPARQVAFSAIRLGAMVALAMLLILGLLPAVLAVQAAST*
Ga0068858_1002374802	3300005842	Switchgrass Rhizosphere	MHAPMRQLAFSTARIGLLVALAMMLILGLLPAILSVEAATQ*
Ga0081455_103109242	3300005937	Tabebuia Heterophylla Rhizosphere	MRQVAVSVVRIGLMVGLAMLLILGLLPAVLAVQAASM*
Ga0075023_1001606352	3300006041	Watersheds	MNAPMRQITFSVIRIGAMVVLAMGLILGLLPAILEMEATGL*
Ga0066652_1002234784	3300006046	Soil	MHAPMRQIAFATIRTGALVALAMLLILGLLPTVLAVQAAGS*
Ga0066652_1003550052	3300006046	Soil	MHAPTRQLAFSVVRIGVSVAVAMLLILGLLPAILAVQAAST*
Ga0075026_1010919831	3300006057	Watersheds	MHAPMRQFAFSVIRIGAMVALAMLLILGLLPAILAVQAAST*
Ga0074053_116194091	3300006575	Soil	QIAVSTIRIGAMVALAMLLILGLLPAILAVEAASR*
Ga0074059_110700172	3300006578	Soil	MHAPMRQLAFSAIRTGALVALAMLLILGLLPAVLAVQAAGT*
Ga0074060_119045002	3300006604	Soil	MRQLAFSAIRTGALVALAMLLILGLLPAVLAVQAAST*
Ga0074062_127271382	3300006606	Soil	RRHTGMHAPMRQFAFSAARIGLMVALAMMLILGLLPAILSVQAATQ*
Ga0079222_100969542	3300006755	Agricultural Soil	MHAPTRQVAISAVRTALLVAVAMLLILGLLPAVLAV
Ga0075424_1012228112	3300006904	Populus Rhizosphere	MHAPMHAPTRQIAISAVRTALLVAVAMLLILGLLP
Ga0105107_102506022	3300009087	Freshwater Sediment	MRQIAFSVIRIGAMVALAMLLILGLLPAILAVQAAST*
Ga0105245_107048722	3300009098	Miscanthus Rhizosphere	MRQLAFSTARIGLLVALAMMLILGLLPAILSVEAATQ*
Ga0105245_107200472	3300009098	Miscanthus Rhizosphere	MHAPMRQIAVSAIRTGAMVALAMLLILGLLPAILAVEAASR*
Ga0105245_121386592	3300009098	Miscanthus Rhizosphere	MRQVAFSTIRVGAMVALAMLLILGLLPAVLAVQAAST*
Ga0066709_1037069392	3300009137	Grasslands Soil	MHAPTRQLAFSVVRIGVSVAVAMLLILGLLPAILAVQATST*
Ga0105243_110072742	3300009148	Miscanthus Rhizosphere	MHAPTRQVAISAVRTALLVAVAMLLILGLLPAVLAVQAAST*
Ga0075423_102982012	3300009162	Populus Rhizosphere	MHAPTRQIAISAVRTALLVAVAMLLILGLLPAVLAVQAASM*
Ga0105242_120978791	3300009176	Miscanthus Rhizosphere	TRQVAISAVRTALLVAVAMLLILGLLPAVLAVQAASM*
Ga0105248_121547322	3300009177	Switchgrass Rhizosphere	MRQLAFSTARIGLLVALAMMLILGLLPAILSVEAAIQ*
Ga0126307_100336152	3300009789	Serpentine Soil	MHAPIRQIAYSALRLGAMVALAMLLILGLLPAVLAVQAASA*
Ga0126305_103001662	3300010036	Serpentine Soil	MHAPIRQIAYSALRLGAMVALAMLLILGLLPAVLAVHAA
Ga0126377_129612411	3300010362	Tropical Forest Soil	MDAPMRQLAVSVIRIGLMVGLAMLLILGLLPAVLAVQAASM*
Ga0134126_110037581	3300010396	Terrestrial Soil	MNAPTRQVAISAVRTALLVAVAMLLILGLLPAVLAVQAASM*
Ga0134121_112383361	3300010401	Terrestrial Soil	MNAPMRQIAFTTARIGLLVALAMMLILGLLPAILSVEAATQ*
Ga0134121_118829512	3300010401	Terrestrial Soil	MRQIAVSAIRTGAMVALAMLLILGLLPAILAVEAASR*
Ga0134123_104655822	3300010403	Terrestrial Soil	MRQVALSTIRVGAMVALAMLLILGLLPAVLAVQAAST*
Ga0105246_107037201	3300011119	Miscanthus Rhizosphere	MHAPMRQIAVSAVRIGAMVALAMLLILGLLPAILAVEAASR*
Ga0105246_109036341	3300011119	Miscanthus Rhizosphere	MHAPVRQVAFSAIRLGAMVALAMLLILGLLPAVLAVQAAST*
Ga0137312_10286482	3300011400	Soil	MRQIAFSVFRVGAMVALAMLLILGLLPAVLAVQAATT*
Ga0137437_11694242	3300011442	Soil	MHAPMRQLAFSVIRIGAMVALAMLLILGLLPAILAVQAAST*
Ga0120167_10944012	3300012001	Permafrost	MHAPTRQIAFTAIRIGAMVALAMLLILGLLPAVLAVQAASS*
Ga0120163_11335821	3300012003	Permafrost	MHAPMRQIAFSAIRIGALVALAMLLILGVLPAVLAVQAAS*
Ga0137374_104445092	3300012204	Vadose Zone Soil	MHAPLRQILVPVLRSGAMVALAMMLILGLLPVILAVQAGRN*
Ga0150985_1080389041	3300012212	Avena Fatua Rhizosphere	SQVAFSAARVGFMIALAMMLILGLLPAILSVQAATQ*
Ga0150985_1167251582	3300012212	Avena Fatua Rhizosphere	RQVAFSAARIGFMVALAMMLILGLLPAILSVQAATQ*
Ga0150984_1161289722	3300012469	Avena Fatua Rhizosphere	MNAPMRHIAFSAVRVGSMVALAMLLILGLLPAVLSVQAATP*
Ga0157281_10253522	3300012883	Soil	MHAPVRQVAFSAIRVGAMVALAMMLILGLLPAVLAVQAAST*
Ga0157289_100452652	3300012903	Soil	MHAPVSQVAFSAIRVGAMVALAMLLILGLLPAILAVQAAST*
Ga0157286_101164711	3300012908	Soil	MHTPVRQVAFSAIRLGAMVALAMLLILGLLPAVLAVQAAST*
Ga0157290_104814561	3300012909	Soil	MHAPVRQVAFSAVRLVAMVALAMLLILGLLPAVLAVQAAST*
Ga0157301_101330682	3300012911	Soil	MHAPVRQLAFSAIRVGAMVALAMLLILGLLPAVLAVQAAST*
Ga0157302_100376553	3300012915	Soil	MHAPVRQFAFSAIRVGAMVALAMLLILGLLPAVIAVQAATT*
Ga0164300_102182572	3300012951	Soil	MHAPVRQVAYSAIRVGAMVALAMLLILGLLPAVLAVQAAST*
Ga0164300_102734262	3300012951	Soil	MRQIAVSAIRIGAMVALAMLLILGLLPAILAVEAAGR*
Ga0164300_105817911	3300012951	Soil	RHTGMHAPMRQLAFSTARIGLLVALAMMLILGLLPAILSVEAATQ*
Ga0164300_105891931	3300012951	Soil	MHAPARQVAFSAIRLGAMVALAMLLILGLLPAVLAVQAANT*
Ga0164298_104635322	3300012955	Soil	MHAPVRQVAYSAIRVGAMVAFAMLLILGLLPAVLAVQAAST*
Ga0164298_111356201	3300012955	Soil	MRQIAVSAIRIGAMVALAMLLILGLLPAILAVEAASR*
Ga0164303_100651932	3300012957	Soil	MRQVAFSAIRVGAMVAFAMLLILGLLPAVLAVQAAST*
Ga0164303_105537331	3300012957	Soil	MDAPVRQIAVAVIRTGLMVGLAMLLILGLLPAVLAVQAASM*
Ga0164299_100675461	3300012958	Soil	MHAPMRQVAFSAIRVGAMVAFAMLLILGLLPAVLAVQAAST*
Ga0164299_104595992	3300012958	Soil	MHAPTRQLAFSVARIGVSVAVAMLLILGLLPAILAVQAAST*
Ga0164299_106084572	3300012958	Soil	MHAPVRQVAYSAIRLGAMVALAMLLILGLLPAVLAVQAAST*
Ga0164301_108490212	3300012960	Soil	MHAPMRQIAFSAIRTGALVALAMLLILGLLPAILAVQAAGK*
Ga0164309_103466003	3300012984	Soil	MHAPMRQIAVSAIRIGAMVALAMLLILGLLPAILAVEAASR*
Ga0164308_113130731	3300012985	Soil	MRQITFSAVRIGAMVALAMLLILGLLPAILSVQAASQ*
Ga0164307_103140082	3300012987	Soil	MRQIAFSAIRTGALVALAMLLILGLLPAILAVQAAGK*
Ga0164306_101153773	3300012988	Soil	MHEPMRQLAFSTARIGLLVALAMMLILGLLPAILPVEAATQ*
Ga0164305_111647342	3300012989	Soil	MNAPMRQIAFSTARIGLMVALAMLLILGLLPAILSVQAATQ*
Ga0157375_102912103	3300013308	Miscanthus Rhizosphere	MRQLAFSTARIGLLVALAMMLILGPLPAILSVEAATQ*
Ga0120179_11131581	3300013763	Permafrost	MHAPMRQIAFSAIRIGAMVALAMLLILGLLPAVLAVQAASS*
Ga0120181_10183842	3300013766	Permafrost	MRQIAFSAIRIGAMVALAMLLILGLLPAVLAVQAASS*
Ga0120125_10536951	3300014056	Permafrost	MHAPMRQIAFSAIRIGALIALAMVLILGLLPAVLAVQAAS*
Ga0075342_10678901	3300014320	Natural And Restored Wetlands	MRQIAFSAIRTGILVALAMLLILGLLPAILAVQAAGL*
Ga0163163_116756391	3300014325	Switchgrass Rhizosphere	MHAPVRQLAFSAIRVGAMVALAMLLILGLLPAILA
Ga0167632_10015422	3300015085	Glacier Forefield Soil	MRQIAFTAIRIGAMVALAMLLILGLLPAVLAVQAASS*
Ga0167665_10138602	3300015163	Glacier Forefield Soil	MRQIAFSVIRIGALVALAMLLILGLLPAVLAVQAART*
Ga0167659_10082943	3300015191	Glacier Forefield Soil	MHAEMRQIAFSVIRIGALVALAMLLILGLLPAVLAVQAAST*
Ga0167646_10027137	3300015192	Glacier Forefield Soil	MHAPMRQIAFSAVRVLALVGLAMLLILGLLPAVLAVEAASV*
Ga0167646_10345372	3300015192	Glacier Forefield Soil	MYAPMRQIAFSAIRTGAMVALAMLLILGLLPAVLAVQAAST*
Ga0167646_10596982	3300015192	Glacier Forefield Soil	MRPIAFSAVRTAAMIALAMLLILGLLPAILAIQTASV*
Ga0167646_10761012	3300015192	Glacier Forefield Soil	MRQIAFSVIRIGTLVALAMLLILGLLPAVLAVQAAST*
Ga0167666_100118610	3300015194	Glacier Forefield Soil	MHAEMRQIAFSVIRIGALVALAMLLILGLLPAVLAVQAART*
Ga0167647_10243072	3300015199	Glacier Forefield Soil	MHAEMRQIAFSVIRIGTLVALAMLLILGLLPAVLAVQAAST*
Ga0167647_10717872	3300015199	Glacier Forefield Soil	MQAPMRPIAFSAVRTAAMIALAMLLILGLLPAILAIQTASV*
Ga0132258_107135732	3300015371	Arabidopsis Rhizosphere	MRQLTVSAVRIGFMVALAMLLILGLLPAVLAVQAASH*
Ga0132258_110733512	3300015371	Arabidopsis Rhizosphere	MRQVAISAIRTGLLVAIAMLLILGLLPAVLAVQAATV*
Ga0132256_1027157061	3300015372	Arabidopsis Rhizosphere	MHAPTRQLALSVARIGVSVAVAMLLILGLLPAILAVQAAST*
Ga0132256_1027734942	3300015372	Arabidopsis Rhizosphere	MRQLALSVVRIGVAVAVAMLLILGLLPAILAVQAAST*
Ga0132257_1020495151	3300015373	Arabidopsis Rhizosphere	MRQLAFSVVRIGVAVAVAMLLILGLLPAILAVQAAST*
Ga0132255_1033515821	3300015374	Arabidopsis Rhizosphere	MRQLTVSAVRIGFMVALAMLLILGLLPAVLAVQAASN*
Ga0163161_110003511	3300017792	Switchgrass Rhizosphere	MRQLAFSTARIGLLVALAMMLILGLLPAILSVEAATQ
Ga0190266_100145202	3300017965	Soil	MRQIAFSAVRLGAMVALAMLLILGILPAILSVQAASQ
Ga0190266_113290962	3300017965	Soil	MHAPMRQIAFSAFRVGAMVALALLLILGLLPAVLAVQAAST
Ga0184608_102916701	3300018028	Groundwater Sediment	MHAPMRQIASSAIRTGAMVALAMLLILGLFPAILAVQAAGK
Ga0184626_101520072	3300018053	Groundwater Sediment	MHAPMRQIAFSVIRIGALVALAMLLILGLLPAILAVQAASK
Ga0184635_100691992	3300018072	Groundwater Sediment	MRQIAFSAFRVGAMVALAMLLILGLLPAVLAVQAATT
Ga0184624_104925332	3300018073	Groundwater Sediment	MHAPVRQVAFSAIRLGAMVALAMLLILGLLPAVLAVQAAST
Ga0184632_101929112	3300018075	Groundwater Sediment	MRQIAFSVIRIGALVALAMLLILGLLPAILAVQAASK
Ga0184625_102429342	3300018081	Groundwater Sediment	MRQIAFSAFRVGAMVALAMLLILGLLPAVLAVQAAST
Ga0184628_104685571	3300018083	Groundwater Sediment	MHAPTRQLAFSVARIGVSVAVAMLLILGLLPAILAVQAAST
Ga0184629_100579243	3300018084	Groundwater Sediment	LTGMHAPMRQLAFSVIRIGAMVALAMLLILGLLPAILAVQAASK
Ga0184629_105851351	3300018084	Groundwater Sediment	MHAPMRQIAFSAIRVGAMVALAMLLILGLLPAVLAVQAATT
Ga0190275_106476562	3300018432	Soil	MHAPMRQVAFSAFRVGAMVALAMGLILGLLPAVLAVQAAST
Ga0190270_132127412	3300018469	Soil	MRQIAFSAFRVGAMVALAMGLILGLLPAVLAVQAAST
Ga0190270_134092491	3300018469	Soil	MEAPMRQIAFSAVRLGAMVALAMLLILGILPAILSVQAASQ
Ga0190274_110914901	3300018476	Soil	MNAPMRQIAFSAFRVGAMVALAMGLILGLLPAVLAVQAAST
Ga0190271_118757451	3300018481	Soil	MNAPMRQIAFSAFRVGAMVALALGLILGLLPAVLAVQAAST
Ga0173481_101335222	3300019356	Soil	MHAPVRQVAFSAIRVGAMVALAMLLILGLLPAILAVQAAST
Ga0173482_103151542	3300019361	Soil	MHAPVRQVAFSAIRVGAMVALAMLLILGLLPAVLAVQAAST
Ga0193741_11806501	3300019884	Soil	MHAPMRQIAFSAFRVGAMVALAMGLILGLLPAVLAVQAAST
Ga0193696_11011121	3300020016	Soil	MHAPVRQVAFSAIQLGAMVALAMLLILGLLPAVLAVQATST
Ga0210379_100066755	3300021081	Groundwater Sediment	MHAPMRQLAFSVIRIGAMVALAMLLILGLLPAILAVQAASK
Ga0210380_101372112	3300021082	Groundwater Sediment	MRQLAFSVIRISVMVAVAMLLILGLLPAVLAVQAAST
Ga0210380_101560452	3300021082	Groundwater Sediment	MHAPTRQIAFSVVRVGAMVALAMLLILGLLPAILSVQAASQ
Ga0247746_10595551	3300022886	Soil	MHAPVSQVAFSAIRVGAMVALAMLLILGLLPAVLAVQAAST
Ga0247791_10697601	3300023062	Soil	LTDMHAPVSQVAFSAIRVGAMVALAMLLILGLLPAVLAVQAAST
Ga0247789_10563891	3300023266	Soil	MHAPVRQLAFSAIRVGAMVALAMLLILGLLPAVLAVQAAST
Ga0207697_103398672	3300025315	Corn, Switchgrass And Miscanthus Rhizosphere	MHAPVRQVAFSALRVGAMVALAMLLILGLLPAVLAVQAAST
Ga0207642_106225932	3300025899	Miscanthus Rhizosphere	MHAPTRQVAISAVRTALLVAVAMLLILGLLPAVLAVQAASH
Ga0207646_102448831	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	VHAPIQPVAASVLRAGILVALAMLLILGLLPAVLAAEASRS
Ga0207687_103144692	3300025927	Miscanthus Rhizosphere	MHAPTRQVAISAVRTALLVAVAMLLILGLLPAVLAVQAASM
Ga0207644_113472311	3300025931	Switchgrass Rhizosphere	MHAPARQVAFSAIRVGAMVALAMLLILGLLPAVLAVQAAST
Ga0207706_102824702	3300025933	Corn Rhizosphere	MNAPTRQVAISAVRTALLVAVAMLLILGLLPAVLAVQAASM
Ga0207706_109530841	3300025933	Corn Rhizosphere	MHAPMRQLTVSAVRIGFMVALAMLLILGLLPAVLAVQAASM
Ga0210126_1052302	3300025946	Natural And Restored Wetlands	MRQIAFSAIRTGILVALAMLLILGLLPAILAVQAAGL
Ga0207668_104286532	3300025972	Switchgrass Rhizosphere	MHAPMRQIAFSAFRVGAMVALAMLLILGLLPAVLAVQAAST
Ga0207703_102913641	3300026035	Switchgrass Rhizosphere	MHAPVRQFAFSAIRVGAIVALAMMLILGLLPAVLAVQAAST
Ga0207702_111018502	3300026078	Corn Rhizosphere	MHAPMRQVAFSAIRVGAMLALAMLLILGLLPAVLAVQAAST
Ga0207683_101930672	3300026121	Miscanthus Rhizosphere	MHAPVRQFAFSAIRVGAMVALAMLLILGLLPAVLAVQAAST
Ga0209974_102387731	3300027876	Arabidopsis Thaliana Rhizosphere	MHAPMRQVAFSAIRVGAMVALAMLLILGLLPAVLAVQAAST
Ga0307322_101120512	3300028710	Soil	MHAPMRQVAFSAVRVGAMVALAMLLILGLLPAVLAVQAAST
Ga0307298_100509411	3300028717	Soil	MHAPMRQVAYSAIRLGAMVALAMLLILGLLPAVLAVQAAST
Ga0307317_100399442	3300028720	Soil	MRQVAFSAIRVGAMVALAMLLILGLLPAVIAVQAAST
Ga0307280_100165202	3300028768	Soil	MRQVALSTIRVGAMVALAMLLILGLLPAVLAVQAAST
Ga0307280_100921932	3300028768	Soil	MRQVAFSAIRVGAMVALAMLLILGLLPAVLAVQAAST
Ga0307282_103065701	3300028784	Soil	MHAPMRQVAFSAIRVGAMVALAMLLILGLLPAVIAVQAATT
Ga0307283_101399781	3300028790	Soil	MHAPMRQVALSTIRVGAMVALAMLLILGLLPAVLAVQAAST
Ga0307503_101192062	3300028802	Soil	MHAPVRQAAFSAIRLGAMVALAMLLILGLLPAVLAVQAAST
Ga0307281_100010863	3300028803	Soil	MRQIAFSAIRLGAMVALAMGLILGLLPAVLAVQAATT
Ga0307281_100022352	3300028803	Soil	MHAPMRQIAFSAIRTGVLVALAMLLILGLLPAILAVQAAGS
Ga0307281_100096802	3300028803	Soil	MHAPMRQIAFSAIRIGVMIALAMLLILGLLPAILAVQAAST
Ga0307281_100590312	3300028803	Soil	MQSPVRQVAFSAIRVAAMIALALLLILGLLPAVLAVQAAST
Ga0307296_102435262	3300028819	Soil	RLTGMHAPMRQIASSAIRTGAMVALAMLLILGLFPAILAVQAAGK
Ga0307286_101690072	3300028876	Soil	MHAPMRQVAFSAIRVWAMVALAMLLILGLLPAVIAVQAAST
Ga0307304_102776321	3300028885	Soil	MHAPVRQTAFSAIRLGAMVALALLLILGLLPAVLAVQAAST
Ga0302299_100947062	3300030010	Fen	MHAPMRQLALSVVRIGAMVGFALLLILGLLPAILSVESAAI
Ga0307380_100465366	3300031539	Soil	MHAQKRQIALSAARVGLLVALAMLLILDLLPATLAAQAATR
Ga0318555_101501342	3300031640	Soil	MHQHAPVRQVAISAIRTGLLVAIAMLLILGLLPAILAVQAAGM
Ga0318496_105618401	3300031713	Soil	MHQHAPVRQVAVSAIRTRLLVAIAMLLILGLLPAILAVQAAGM
Ga0307468_1014210502	3300031740	Hardwood Forest Soil	MRQLAFSVVRIGVAVAVAMLLILGLLPAILAVQAAST
Ga0318568_104269912	3300031819	Soil	MHQHAPVRQVAVSAIRTGLLVAIAMLLILGLLPAILAVQAAGM
Ga0310893_104752002	3300031892	Soil	MRQLAFSVVRVGFMVAIAMLLILGLLPAVLAVQAAST
Ga0310900_109170952	3300031908	Soil	MHAPTRQIAISAVRTALLVAVAMLLILGLLPAVLAVQAASM
Ga0311367_102666132	3300031918	Fen	MRQLALSVVRIGAMVGFALLLILGLLPAILSVESAAI
Ga0310912_105113621	3300031941	Soil	RQVAISAIRTGLLVAIAMLLILGLLPAILAVQAAGM
Ga0326597_100380671	3300031965	Soil	MHAPMRQIAFSAIRVGAMVAFAMLLILGLLPAILAAQAASM
Ga0326597_118348371	3300031965	Soil	MHAPMRQIAFSAIRIGAMVALAMLLILGLLPAILAV
Ga0315278_102914601	3300031997	Sediment	MLQVAFSAIRIGAMIALAMLLILGLLPATLAMQAAST
Ga0310903_108070481	3300032000	Soil	MHAPMHAPTRQIAISAVRTALLVAVAMLLILGLLPAVLAVQAAST
Ga0310890_115058332	3300032075	Soil	MRQLAFSVVRVGFMVAMAMLLILGLLPAVLAVQAAST
Ga0315292_109383862	3300032143	Sediment	MLQVAFSAIRIGAMIALAMLLILGLLPTILAMQAAST
Ga0315283_105496862	3300032164	Sediment	MHEPMRQIAFSAIRIGAMVALSMLLILGLLPAILAVQTASW
Ga0315268_112880121	3300032173	Sediment	NDMHAPLLQIAFSAIRTGVMVAIAMLLILGLLPAILAAST
Ga0315271_106474992	3300032256	Sediment	MRSIAFSAVRTGVLVALAMLLILGLLPAILAFQAAST
Ga0315271_106747932	3300032256	Sediment	MRSIAFSAVRTGALVALAMLLILGLLPAILAFQAAST
Ga0315270_101363062	3300032275	Sediment	MHAPLLQIAFSAIRTGVMVAIAMLLILGLLPAILAAST
Ga0310914_116801781	3300033289	Soil	PMHQHPPVRQVAISAIRTGLLVAIAMLLILGLLPAILAVQAAGM
Ga0310914_117604632	3300033289	Soil	MHAPMHQHAPVRQVAISAIRTGLLVAIAMLLILGLLPA
Ga0370486_035027_139_264	3300034126	Untreated Peat Soil	MHAPRNRVVSSIIRTGAMVALAVLLILGLLPAILAAQAGRT
Ga0364925_0339384_445_558	3300034147	Sediment	MRQLAFSAIRIGAMVALAMLLILGLLPAILAVQAAST
Ga0364933_084754_43_168	3300034150	Sediment	MHAPMRQVAYSAIRVGAMIALAMLLILGLLPAVLAVQAAST
Ga0364933_089934_216_341	3300034150	Sediment	MHAPMRQLAFSVIRIGAMVALAMLLILGLLPAVLAGQAAST
Ga0364931_0338726_235_360	3300034176	Sediment	MHAPMRQIAFSAIRIGAMVALAMLLILGLLPAILAVQAAST
Ga0370501_0177591_103_228	3300034195	Untreated Peat Soil	MHAPMRQIAFIAVRTGVLIALAMLLILGLLPAILSVQAASR
Ga0364941_079704_137_262	3300034417	Sediment	MPAPTRQIAFSVLRIGIMVAFAMLLILGILPAVLAVEAASN

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign