| Basic Information | |
|---|---|
| Family ID | F025733 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 200 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MHAPMRQVAFSAIRVGAMVALAMLLILGLLPAVLAVQAAST |
| Number of Associated Samples | 164 |
| Number of Associated Scaffolds | 200 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 10.00 % |
| % of genes near scaffold ends (potentially truncated) | 12.50 % |
| % of genes from short scaffolds (< 2000 bps) | 91.00 % |
| Associated GOLD sequencing projects | 157 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.59 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (80.500 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (25.500 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.500 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (39.500 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.17% β-sheet: 0.00% Coil/Unstructured: 47.83% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 200 Family Scaffolds |
|---|---|---|
| PF02811 | PHP | 58.50 |
| PF07733 | DNA_pol3_alpha | 5.50 |
| PF00932 | LTD | 1.00 |
| PF04075 | F420H2_quin_red | 1.00 |
| PF05544 | Pro_racemase | 0.50 |
| PF14079 | DUF4260 | 0.50 |
| PF13305 | TetR_C_33 | 0.50 |
| PF00154 | RecA | 0.50 |
| PF00561 | Abhydrolase_1 | 0.50 |
| PF08327 | AHSA1 | 0.50 |
| PF11799 | IMS_C | 0.50 |
| PF00491 | Arginase | 0.50 |
| PF13602 | ADH_zinc_N_2 | 0.50 |
| PF01230 | HIT | 0.50 |
| PF02469 | Fasciclin | 0.50 |
| COG ID | Name | Functional Category | % Frequency in 200 Family Scaffolds |
|---|---|---|---|
| COG0587 | DNA polymerase III, alpha subunit | Replication, recombination and repair [L] | 5.50 |
| COG2176 | DNA polymerase III, alpha subunit (gram-positive type) | Replication, recombination and repair [L] | 5.50 |
| COG0010 | Arginase/agmatinase family enzyme | Amino acid transport and metabolism [E] | 0.50 |
| COG0468 | RecA/RadA recombinase | Replication, recombination and repair [L] | 0.50 |
| COG2335 | Uncaracterized surface protein containing fasciclin (FAS1) repeats | General function prediction only [R] | 0.50 |
| COG3938 | Proline racemase/hydroxyproline epimerase | Amino acid transport and metabolism [E] | 0.50 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 80.50 % |
| Unclassified | root | N/A | 19.50 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2067725000|GPWRP_F5MPXY302ID2T5 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 542 | Open in IMG/M |
| 2124908041|P3_CLC_ConsensusfromContig50819 | All Organisms → cellular organisms → Bacteria | 1542 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c0586098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1309 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_105353342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 912 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_105756733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2193 | Open in IMG/M |
| 3300000956|JGI10216J12902_115434909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 820 | Open in IMG/M |
| 3300001537|A2065W1_11127812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1440 | Open in IMG/M |
| 3300002568|C688J35102_120476290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1100 | Open in IMG/M |
| 3300004061|Ga0055487_10002204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae | 1861 | Open in IMG/M |
| 3300004062|Ga0055500_10132053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 579 | Open in IMG/M |
| 3300004157|Ga0062590_100952407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 810 | Open in IMG/M |
| 3300004480|Ga0062592_100372330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1122 | Open in IMG/M |
| 3300004643|Ga0062591_100526182 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 1023 | Open in IMG/M |
| 3300005093|Ga0062594_101318126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 726 | Open in IMG/M |
| 3300005165|Ga0066869_10085432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 611 | Open in IMG/M |
| 3300005333|Ga0070677_10452341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 687 | Open in IMG/M |
| 3300005334|Ga0068869_100929383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 754 | Open in IMG/M |
| 3300005345|Ga0070692_11118171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 557 | Open in IMG/M |
| 3300005440|Ga0070705_101119487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 645 | Open in IMG/M |
| 3300005456|Ga0070678_101746354 | Not Available | 586 | Open in IMG/M |
| 3300005468|Ga0070707_100011897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 8122 | Open in IMG/M |
| 3300005535|Ga0070684_100911256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 824 | Open in IMG/M |
| 3300005546|Ga0070696_101610873 | Not Available | 558 | Open in IMG/M |
| 3300005564|Ga0070664_101807086 | Not Available | 580 | Open in IMG/M |
| 3300005618|Ga0068864_101151220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 773 | Open in IMG/M |
| 3300005618|Ga0068864_101583074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 659 | Open in IMG/M |
| 3300005718|Ga0068866_11106509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 568 | Open in IMG/M |
| 3300005764|Ga0066903_106190061 | Not Available | 626 | Open in IMG/M |
| 3300005764|Ga0066903_107300036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 571 | Open in IMG/M |
| 3300005836|Ga0074470_11255215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_68_21 | 1871 | Open in IMG/M |
| 3300005836|Ga0074470_11747550 | All Organisms → cellular organisms → Bacteria | 4507 | Open in IMG/M |
| 3300005840|Ga0068870_11172868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 555 | Open in IMG/M |
| 3300005842|Ga0068858_100237480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1729 | Open in IMG/M |
| 3300005937|Ga0081455_10310924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1126 | Open in IMG/M |
| 3300006041|Ga0075023_100160635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 836 | Open in IMG/M |
| 3300006046|Ga0066652_100223478 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 148 | 1634 | Open in IMG/M |
| 3300006046|Ga0066652_100355005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1321 | Open in IMG/M |
| 3300006057|Ga0075026_101091983 | Not Available | 501 | Open in IMG/M |
| 3300006575|Ga0074053_11619409 | Not Available | 1014 | Open in IMG/M |
| 3300006578|Ga0074059_11070017 | Not Available | 683 | Open in IMG/M |
| 3300006604|Ga0074060_11904500 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 667 | Open in IMG/M |
| 3300006606|Ga0074062_12727138 | Not Available | 503 | Open in IMG/M |
| 3300006755|Ga0079222_10096954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1537 | Open in IMG/M |
| 3300006904|Ga0075424_101222811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 799 | Open in IMG/M |
| 3300009087|Ga0105107_10250602 | Not Available | 1237 | Open in IMG/M |
| 3300009098|Ga0105245_10704872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1043 | Open in IMG/M |
| 3300009098|Ga0105245_10720047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1032 | Open in IMG/M |
| 3300009098|Ga0105245_12138659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 613 | Open in IMG/M |
| 3300009137|Ga0066709_103706939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 554 | Open in IMG/M |
| 3300009148|Ga0105243_11007274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 836 | Open in IMG/M |
| 3300009162|Ga0075423_10298201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1689 | Open in IMG/M |
| 3300009176|Ga0105242_12097879 | Not Available | 609 | Open in IMG/M |
| 3300009177|Ga0105248_12154732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 634 | Open in IMG/M |
| 3300009789|Ga0126307_10033615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 3958 | Open in IMG/M |
| 3300010036|Ga0126305_10300166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1042 | Open in IMG/M |
| 3300010362|Ga0126377_12961241 | Not Available | 548 | Open in IMG/M |
| 3300010396|Ga0134126_11003758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 934 | Open in IMG/M |
| 3300010401|Ga0134121_11238336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 748 | Open in IMG/M |
| 3300010401|Ga0134121_11882951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 627 | Open in IMG/M |
| 3300010403|Ga0134123_10465582 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
| 3300011119|Ga0105246_10703720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 886 | Open in IMG/M |
| 3300011119|Ga0105246_10903634 | Not Available | 792 | Open in IMG/M |
| 3300011400|Ga0137312_1028648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 837 | Open in IMG/M |
| 3300011442|Ga0137437_1169424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 757 | Open in IMG/M |
| 3300012001|Ga0120167_1094401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 615 | Open in IMG/M |
| 3300012003|Ga0120163_1133582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 524 | Open in IMG/M |
| 3300012204|Ga0137374_10444509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1019 | Open in IMG/M |
| 3300012212|Ga0150985_108038904 | Not Available | 828 | Open in IMG/M |
| 3300012212|Ga0150985_116725158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium | 960 | Open in IMG/M |
| 3300012469|Ga0150984_116128972 | Not Available | 532 | Open in IMG/M |
| 3300012883|Ga0157281_1025352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 783 | Open in IMG/M |
| 3300012903|Ga0157289_10045265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1094 | Open in IMG/M |
| 3300012908|Ga0157286_10116471 | Not Available | 808 | Open in IMG/M |
| 3300012909|Ga0157290_10481456 | Not Available | 503 | Open in IMG/M |
| 3300012911|Ga0157301_10133068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 772 | Open in IMG/M |
| 3300012915|Ga0157302_10037655 | Not Available | 1310 | Open in IMG/M |
| 3300012951|Ga0164300_10218257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae | 946 | Open in IMG/M |
| 3300012951|Ga0164300_10273426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 870 | Open in IMG/M |
| 3300012951|Ga0164300_10581791 | Not Available | 657 | Open in IMG/M |
| 3300012951|Ga0164300_10589193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 654 | Open in IMG/M |
| 3300012955|Ga0164298_10463532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae | 837 | Open in IMG/M |
| 3300012955|Ga0164298_11135620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 587 | Open in IMG/M |
| 3300012957|Ga0164303_10065193 | All Organisms → cellular organisms → Bacteria | 1677 | Open in IMG/M |
| 3300012957|Ga0164303_10553733 | Not Available | 747 | Open in IMG/M |
| 3300012958|Ga0164299_10067546 | Not Available | 1742 | Open in IMG/M |
| 3300012958|Ga0164299_10459599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 835 | Open in IMG/M |
| 3300012958|Ga0164299_10608457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 748 | Open in IMG/M |
| 3300012960|Ga0164301_10849021 | Not Available | 703 | Open in IMG/M |
| 3300012984|Ga0164309_10346600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1089 | Open in IMG/M |
| 3300012985|Ga0164308_11313073 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300012987|Ga0164307_10314008 | Not Available | 1123 | Open in IMG/M |
| 3300012988|Ga0164306_10115377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 1779 | Open in IMG/M |
| 3300012989|Ga0164305_11164734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 666 | Open in IMG/M |
| 3300013308|Ga0157375_10291210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 1796 | Open in IMG/M |
| 3300013763|Ga0120179_1113158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 597 | Open in IMG/M |
| 3300013766|Ga0120181_1018384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1826 | Open in IMG/M |
| 3300014056|Ga0120125_1053695 | Not Available | 890 | Open in IMG/M |
| 3300014320|Ga0075342_1067890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium | 891 | Open in IMG/M |
| 3300014325|Ga0163163_11675639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 697 | Open in IMG/M |
| 3300015085|Ga0167632_1001542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 3525 | Open in IMG/M |
| 3300015163|Ga0167665_1013860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1621 | Open in IMG/M |
| 3300015191|Ga0167659_1008294 | All Organisms → cellular organisms → Bacteria | 2951 | Open in IMG/M |
| 3300015192|Ga0167646_1002713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 5965 | Open in IMG/M |
| 3300015192|Ga0167646_1034537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1223 | Open in IMG/M |
| 3300015192|Ga0167646_1059698 | Not Available | 860 | Open in IMG/M |
| 3300015192|Ga0167646_1076101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 729 | Open in IMG/M |
| 3300015194|Ga0167666_1001186 | All Organisms → cellular organisms → Bacteria | 9408 | Open in IMG/M |
| 3300015199|Ga0167647_1024307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium | 1814 | Open in IMG/M |
| 3300015199|Ga0167647_1071787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 916 | Open in IMG/M |
| 3300015371|Ga0132258_10713573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2525 | Open in IMG/M |
| 3300015371|Ga0132258_11073351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2035 | Open in IMG/M |
| 3300015372|Ga0132256_102715706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 594 | Open in IMG/M |
| 3300015372|Ga0132256_102773494 | Not Available | 589 | Open in IMG/M |
| 3300015373|Ga0132257_102049515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 738 | Open in IMG/M |
| 3300015374|Ga0132255_103351582 | Not Available | 682 | Open in IMG/M |
| 3300017792|Ga0163161_11000351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 714 | Open in IMG/M |
| 3300017965|Ga0190266_10014520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2133 | Open in IMG/M |
| 3300017965|Ga0190266_11329096 | Not Available | 507 | Open in IMG/M |
| 3300018028|Ga0184608_10291670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 717 | Open in IMG/M |
| 3300018053|Ga0184626_10152007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 984 | Open in IMG/M |
| 3300018072|Ga0184635_10069199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1376 | Open in IMG/M |
| 3300018073|Ga0184624_10492533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 534 | Open in IMG/M |
| 3300018075|Ga0184632_10192911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 897 | Open in IMG/M |
| 3300018081|Ga0184625_10242934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 943 | Open in IMG/M |
| 3300018083|Ga0184628_10468557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 655 | Open in IMG/M |
| 3300018084|Ga0184629_10057924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium | 1791 | Open in IMG/M |
| 3300018084|Ga0184629_10585135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 571 | Open in IMG/M |
| 3300018432|Ga0190275_10647656 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
| 3300018469|Ga0190270_13212741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 518 | Open in IMG/M |
| 3300018469|Ga0190270_13409249 | Not Available | 504 | Open in IMG/M |
| 3300018476|Ga0190274_11091490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 877 | Open in IMG/M |
| 3300018481|Ga0190271_11875745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 710 | Open in IMG/M |
| 3300019356|Ga0173481_10133522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1002 | Open in IMG/M |
| 3300019361|Ga0173482_10315154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 694 | Open in IMG/M |
| 3300019884|Ga0193741_1180650 | Not Available | 507 | Open in IMG/M |
| 3300020016|Ga0193696_1101112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 740 | Open in IMG/M |
| 3300021081|Ga0210379_10006675 | All Organisms → cellular organisms → Bacteria | 4234 | Open in IMG/M |
| 3300021082|Ga0210380_10137211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1093 | Open in IMG/M |
| 3300021082|Ga0210380_10156045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1025 | Open in IMG/M |
| 3300022886|Ga0247746_1059555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 890 | Open in IMG/M |
| 3300023062|Ga0247791_1069760 | Not Available | 572 | Open in IMG/M |
| 3300023266|Ga0247789_1056389 | Not Available | 731 | Open in IMG/M |
| 3300025315|Ga0207697_10339867 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300025899|Ga0207642_10622593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 674 | Open in IMG/M |
| 3300025922|Ga0207646_10244883 | All Organisms → cellular organisms → Bacteria | 1619 | Open in IMG/M |
| 3300025927|Ga0207687_10314469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1266 | Open in IMG/M |
| 3300025931|Ga0207644_11347231 | Not Available | 600 | Open in IMG/M |
| 3300025933|Ga0207706_10282470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1447 | Open in IMG/M |
| 3300025933|Ga0207706_10953084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 723 | Open in IMG/M |
| 3300025946|Ga0210126_105230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1066 | Open in IMG/M |
| 3300025972|Ga0207668_10428653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1124 | Open in IMG/M |
| 3300026035|Ga0207703_10291364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1486 | Open in IMG/M |
| 3300026078|Ga0207702_11101850 | Not Available | 788 | Open in IMG/M |
| 3300026121|Ga0207683_10193067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1849 | Open in IMG/M |
| 3300027876|Ga0209974_10238773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 681 | Open in IMG/M |
| 3300028710|Ga0307322_10112051 | Not Available | 708 | Open in IMG/M |
| 3300028717|Ga0307298_10050941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1135 | Open in IMG/M |
| 3300028720|Ga0307317_10039944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1485 | Open in IMG/M |
| 3300028768|Ga0307280_10016520 | All Organisms → cellular organisms → Bacteria | 2079 | Open in IMG/M |
| 3300028768|Ga0307280_10092193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 998 | Open in IMG/M |
| 3300028784|Ga0307282_10306570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 766 | Open in IMG/M |
| 3300028790|Ga0307283_10139978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 661 | Open in IMG/M |
| 3300028802|Ga0307503_10119206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1154 | Open in IMG/M |
| 3300028803|Ga0307281_10001086 | All Organisms → cellular organisms → Bacteria | 7380 | Open in IMG/M |
| 3300028803|Ga0307281_10002235 | All Organisms → cellular organisms → Bacteria | 5366 | Open in IMG/M |
| 3300028803|Ga0307281_10009680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2663 | Open in IMG/M |
| 3300028803|Ga0307281_10059031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium | 1222 | Open in IMG/M |
| 3300028819|Ga0307296_10243526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium | 978 | Open in IMG/M |
| 3300028876|Ga0307286_10169007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 788 | Open in IMG/M |
| 3300028885|Ga0307304_10277632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 735 | Open in IMG/M |
| 3300030010|Ga0302299_10094706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium | 1646 | Open in IMG/M |
| 3300031539|Ga0307380_10046536 | All Organisms → cellular organisms → Bacteria | 4825 | Open in IMG/M |
| 3300031640|Ga0318555_10150134 | All Organisms → cellular organisms → Bacteria | 1247 | Open in IMG/M |
| 3300031713|Ga0318496_10561840 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300031740|Ga0307468_101421050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 639 | Open in IMG/M |
| 3300031819|Ga0318568_10426991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 826 | Open in IMG/M |
| 3300031892|Ga0310893_10475200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 558 | Open in IMG/M |
| 3300031908|Ga0310900_10917095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 716 | Open in IMG/M |
| 3300031918|Ga0311367_10266613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium | 1781 | Open in IMG/M |
| 3300031941|Ga0310912_10511362 | Not Available | 936 | Open in IMG/M |
| 3300031965|Ga0326597_10038067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 6082 | Open in IMG/M |
| 3300031965|Ga0326597_11834837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 567 | Open in IMG/M |
| 3300031997|Ga0315278_10291460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1686 | Open in IMG/M |
| 3300032000|Ga0310903_10807048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 514 | Open in IMG/M |
| 3300032075|Ga0310890_11505833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 555 | Open in IMG/M |
| 3300032143|Ga0315292_10938386 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 721 | Open in IMG/M |
| 3300032164|Ga0315283_10549686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1253 | Open in IMG/M |
| 3300032173|Ga0315268_11288012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 741 | Open in IMG/M |
| 3300032256|Ga0315271_10647499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 905 | Open in IMG/M |
| 3300032256|Ga0315271_10674793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 886 | Open in IMG/M |
| 3300032275|Ga0315270_10136306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1467 | Open in IMG/M |
| 3300033289|Ga0310914_11680178 | Not Available | 539 | Open in IMG/M |
| 3300033289|Ga0310914_11760463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 524 | Open in IMG/M |
| 3300034126|Ga0370486_035027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1148 | Open in IMG/M |
| 3300034147|Ga0364925_0339384 | Not Available | 565 | Open in IMG/M |
| 3300034150|Ga0364933_084754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 797 | Open in IMG/M |
| 3300034150|Ga0364933_089934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 774 | Open in IMG/M |
| 3300034176|Ga0364931_0338726 | Not Available | 502 | Open in IMG/M |
| 3300034195|Ga0370501_0177591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 745 | Open in IMG/M |
| 3300034417|Ga0364941_079704 | Not Available | 769 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 25.50% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 5.00% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.50% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.00% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 3.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.50% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 3.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.50% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.50% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 2.50% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.00% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.50% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.50% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.50% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.00% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.00% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.00% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.00% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.00% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.00% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.50% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.50% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.50% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.50% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.50% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.50% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.50% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.50% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.50% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.50% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.50% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.50% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.50% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.50% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.50% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.50% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.50% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.50% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.50% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.50% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2067725000 | Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soil | Environmental | Open in IMG/M |
| 2124908041 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P3 | Environmental | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001537 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-65 cm-11A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004061 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300004062 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005165 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC | Environmental | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006575 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006578 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006604 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011400 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT133_2 | Environmental | Open in IMG/M |
| 3300011442 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2 | Environmental | Open in IMG/M |
| 3300012001 | Permafrost microbial communities from Nunavut, Canada - A24_80cm_12M | Environmental | Open in IMG/M |
| 3300012003 | Permafrost microbial communities from Nunavut, Canada - A20_80cm_0.25M | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012883 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 | Environmental | Open in IMG/M |
| 3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
| 3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
| 3300012909 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1 | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013763 | Permafrost microbial communities from Nunavut, Canada - A15_65cm_0M | Environmental | Open in IMG/M |
| 3300013766 | Permafrost microbial communities from Nunavut, Canada - A26_65cm_6M | Environmental | Open in IMG/M |
| 3300014056 | Permafrost microbial communities from Nunavut, Canada - A20_5cm_0M | Environmental | Open in IMG/M |
| 3300014320 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015085 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4B, Ice margin, adjacent to proglacial lake) | Environmental | Open in IMG/M |
| 3300015163 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb1b, glacier snout) | Environmental | Open in IMG/M |
| 3300015191 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-10 : a,b,c samples pooled, hydrological sediment from glacier outflow) | Environmental | Open in IMG/M |
| 3300015192 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-2a, rock/snow interface) | Environmental | Open in IMG/M |
| 3300015194 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb1c, glacier snout) | Environmental | Open in IMG/M |
| 3300015199 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-2c, rock/snow interface) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019884 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2 | Environmental | Open in IMG/M |
| 3300020016 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1 | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300022886 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5 | Environmental | Open in IMG/M |
| 3300023062 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S081-202R-4 | Environmental | Open in IMG/M |
| 3300023266 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S220-509R-4 | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025946 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028790 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122 | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300030010 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_4 | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
| 3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
| 3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300034126 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_16 | Environmental | Open in IMG/M |
| 3300034147 | Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17 | Environmental | Open in IMG/M |
| 3300034150 | Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17 | Environmental | Open in IMG/M |
| 3300034176 | Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17 | Environmental | Open in IMG/M |
| 3300034195 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17 | Environmental | Open in IMG/M |
| 3300034417 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPWRP_02742300 | 2067725000 | Soil | MHAPMRQITFSAVRIGAMVALAMLLILGLLPAILSVQAATQ |
| P3_CLC_02308140 | 2124908041 | Soil | MHAPMRQIAFSAIRTGAMVALAMLLILGLLPAILAVQAAST |
| ICChiseqgaiiDRAFT_05860982 | 3300000033 | Soil | MHAPMRQIAFSAVRVGAMVALAMGLILGLLPAVLAVQAAST* |
| INPhiseqgaiiFebDRAFT_1053533423 | 3300000364 | Soil | MQAPVHAPTRQVAISAVRTALLVAVAMLLILGLLPAVLAVQAASM* |
| INPhiseqgaiiFebDRAFT_1057567333 | 3300000364 | Soil | MHAPMRQVAYSAIRVGAMVALAMLLILGLLPAVLAVQAAST* |
| JGI10216J12902_1154349092 | 3300000956 | Soil | MRQVAFAVIRTGLMVGLAMLLILGLLPAVLAVQAASM* |
| A2065W1_111278122 | 3300001537 | Permafrost | MHAPTRQIAFSAIRIGAMVALAMLLILGLLPAVLAVQAASS* |
| C688J35102_1204762902 | 3300002568 | Soil | MHAPMRQVAFSAARIGFMVALAMMLILGLLPAILSVQAATQ* |
| Ga0055487_100022042 | 3300004061 | Natural And Restored Wetlands | MHAPMRQIAFSAIRTGILVALAMLLILGLLPAILAVQAAGL* |
| Ga0055500_101320531 | 3300004062 | Natural And Restored Wetlands | MHAPMRQLAFSAIRIGAMVAFAMLLILGLLPAILAVQAAS |
| Ga0062590_1009524071 | 3300004157 | Soil | MHAPMRQLAFSVVRVGFMVAIAMLLILGLLPAVLAVQAAST* |
| Ga0062592_1003723301 | 3300004480 | Soil | MHAPVRQVAFSAIRVGAMVALAMLLILGLLPAILAVQAAST* |
| Ga0062591_1005261821 | 3300004643 | Soil | APTRQVAISAVRTALLVAVAMLLILGLLPAVLAVQAASM* |
| Ga0062594_1013181261 | 3300005093 | Soil | MHAPMRQLTVSAVRIGFMVALAMLLILGLLPAVLAVQAASH* |
| Ga0066869_100854322 | 3300005165 | Soil | MHAPVRQVAFSAIRVGAMVALAMLLILGLLPAVLAVQAAST* |
| Ga0070677_104523412 | 3300005333 | Miscanthus Rhizosphere | MHAPMRQIAFSAFRVGAMVALAMLLILGLLPAVLAVQAAST* |
| Ga0068869_1009293832 | 3300005334 | Miscanthus Rhizosphere | MHAPMHAPTRQVAISAVRTALLVAVAMLLILGLLPAVLAVQAASM* |
| Ga0070692_111181712 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MHAPVRQFAFSAIRVGAMVALAMLLILGLLPAVLAVQAAST* |
| Ga0070705_1011194871 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MHAPMHAPTRQVAISAVRTALLVAFAMLLILGLLPAVLAVQ |
| Ga0070678_1017463541 | 3300005456 | Miscanthus Rhizosphere | MHAPMRQITFSAVRIGAMVALAMLLILGLLPAILSVQAASQ* |
| Ga0070707_10001189711 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VHAPIQPVAASVLRAGILVALAMLLILGLLPAVLAAEASRS* |
| Ga0070684_1009112562 | 3300005535 | Corn Rhizosphere | MHAPVRQVAFSALRVGAMVALAMLLILGLLPAVLAVQAAST* |
| Ga0070696_1016108731 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MHAPTRQVAISAVRTALLVAVAMLLILGLLPAVLAVQAASM* |
| Ga0070664_1018070861 | 3300005564 | Corn Rhizosphere | MNAPMRQIAFSAFRVGAMVALAMGLILGLLPAVLAVQAAST* |
| Ga0068864_1011512202 | 3300005618 | Switchgrass Rhizosphere | MTAPMRQIAFSTARIGLLVALAMMLILGLLPAILSVEAATQ* |
| Ga0068864_1015830741 | 3300005618 | Switchgrass Rhizosphere | MHAPTRQLAFSVARIGVSVAVAMLLILGLLPAILAVQAATT* |
| Ga0068866_111065092 | 3300005718 | Miscanthus Rhizosphere | MHAPMHAPTRQVAISAVRTALLVAVAMLLILGLLPAVLAVQAAS |
| Ga0066903_1061900611 | 3300005764 | Tropical Forest Soil | MDAPMRQVAFAVIRTGLMVGLAMLLILGLLPAVLAVQAAGM* |
| Ga0066903_1073000361 | 3300005764 | Tropical Forest Soil | MRQLAVSVIRIGLMVGLAMLLILGLLPAVLAVQAASM* |
| Ga0074470_112552152 | 3300005836 | Sediment (Intertidal) | MRQIAFSAVRIGAMIALAMLLILGLLPAILAVQAAT* |
| Ga0074470_117475506 | 3300005836 | Sediment (Intertidal) | MNAPMRQVTFTVIRIVAMVALAMLLILGLLPAALAVEAAGP* |
| Ga0068870_111728681 | 3300005840 | Miscanthus Rhizosphere | MHAPARQVAFSAIRLGAMVALAMLLILGLLPAVLAVQAAST* |
| Ga0068858_1002374802 | 3300005842 | Switchgrass Rhizosphere | MHAPMRQLAFSTARIGLLVALAMMLILGLLPAILSVEAATQ* |
| Ga0081455_103109242 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MRQVAVSVVRIGLMVGLAMLLILGLLPAVLAVQAASM* |
| Ga0075023_1001606352 | 3300006041 | Watersheds | MNAPMRQITFSVIRIGAMVVLAMGLILGLLPAILEMEATGL* |
| Ga0066652_1002234784 | 3300006046 | Soil | MHAPMRQIAFATIRTGALVALAMLLILGLLPTVLAVQAAGS* |
| Ga0066652_1003550052 | 3300006046 | Soil | MHAPTRQLAFSVVRIGVSVAVAMLLILGLLPAILAVQAAST* |
| Ga0075026_1010919831 | 3300006057 | Watersheds | MHAPMRQFAFSVIRIGAMVALAMLLILGLLPAILAVQAAST* |
| Ga0074053_116194091 | 3300006575 | Soil | QIAVSTIRIGAMVALAMLLILGLLPAILAVEAASR* |
| Ga0074059_110700172 | 3300006578 | Soil | MHAPMRQLAFSAIRTGALVALAMLLILGLLPAVLAVQAAGT* |
| Ga0074060_119045002 | 3300006604 | Soil | MRQLAFSAIRTGALVALAMLLILGLLPAVLAVQAAST* |
| Ga0074062_127271382 | 3300006606 | Soil | RRHTGMHAPMRQFAFSAARIGLMVALAMMLILGLLPAILSVQAATQ* |
| Ga0079222_100969542 | 3300006755 | Agricultural Soil | MHAPTRQVAISAVRTALLVAVAMLLILGLLPAVLAV |
| Ga0075424_1012228112 | 3300006904 | Populus Rhizosphere | MHAPMHAPTRQIAISAVRTALLVAVAMLLILGLLP |
| Ga0105107_102506022 | 3300009087 | Freshwater Sediment | MRQIAFSVIRIGAMVALAMLLILGLLPAILAVQAAST* |
| Ga0105245_107048722 | 3300009098 | Miscanthus Rhizosphere | MRQLAFSTARIGLLVALAMMLILGLLPAILSVEAATQ* |
| Ga0105245_107200472 | 3300009098 | Miscanthus Rhizosphere | MHAPMRQIAVSAIRTGAMVALAMLLILGLLPAILAVEAASR* |
| Ga0105245_121386592 | 3300009098 | Miscanthus Rhizosphere | MRQVAFSTIRVGAMVALAMLLILGLLPAVLAVQAAST* |
| Ga0066709_1037069392 | 3300009137 | Grasslands Soil | MHAPTRQLAFSVVRIGVSVAVAMLLILGLLPAILAVQATST* |
| Ga0105243_110072742 | 3300009148 | Miscanthus Rhizosphere | MHAPTRQVAISAVRTALLVAVAMLLILGLLPAVLAVQAAST* |
| Ga0075423_102982012 | 3300009162 | Populus Rhizosphere | MHAPTRQIAISAVRTALLVAVAMLLILGLLPAVLAVQAASM* |
| Ga0105242_120978791 | 3300009176 | Miscanthus Rhizosphere | TRQVAISAVRTALLVAVAMLLILGLLPAVLAVQAASM* |
| Ga0105248_121547322 | 3300009177 | Switchgrass Rhizosphere | MRQLAFSTARIGLLVALAMMLILGLLPAILSVEAAIQ* |
| Ga0126307_100336152 | 3300009789 | Serpentine Soil | MHAPIRQIAYSALRLGAMVALAMLLILGLLPAVLAVQAASA* |
| Ga0126305_103001662 | 3300010036 | Serpentine Soil | MHAPIRQIAYSALRLGAMVALAMLLILGLLPAVLAVHAA |
| Ga0126377_129612411 | 3300010362 | Tropical Forest Soil | MDAPMRQLAVSVIRIGLMVGLAMLLILGLLPAVLAVQAASM* |
| Ga0134126_110037581 | 3300010396 | Terrestrial Soil | MNAPTRQVAISAVRTALLVAVAMLLILGLLPAVLAVQAASM* |
| Ga0134121_112383361 | 3300010401 | Terrestrial Soil | MNAPMRQIAFTTARIGLLVALAMMLILGLLPAILSVEAATQ* |
| Ga0134121_118829512 | 3300010401 | Terrestrial Soil | MRQIAVSAIRTGAMVALAMLLILGLLPAILAVEAASR* |
| Ga0134123_104655822 | 3300010403 | Terrestrial Soil | MRQVALSTIRVGAMVALAMLLILGLLPAVLAVQAAST* |
| Ga0105246_107037201 | 3300011119 | Miscanthus Rhizosphere | MHAPMRQIAVSAVRIGAMVALAMLLILGLLPAILAVEAASR* |
| Ga0105246_109036341 | 3300011119 | Miscanthus Rhizosphere | MHAPVRQVAFSAIRLGAMVALAMLLILGLLPAVLAVQAAST* |
| Ga0137312_10286482 | 3300011400 | Soil | MRQIAFSVFRVGAMVALAMLLILGLLPAVLAVQAATT* |
| Ga0137437_11694242 | 3300011442 | Soil | MHAPMRQLAFSVIRIGAMVALAMLLILGLLPAILAVQAAST* |
| Ga0120167_10944012 | 3300012001 | Permafrost | MHAPTRQIAFTAIRIGAMVALAMLLILGLLPAVLAVQAASS* |
| Ga0120163_11335821 | 3300012003 | Permafrost | MHAPMRQIAFSAIRIGALVALAMLLILGVLPAVLAVQAAS* |
| Ga0137374_104445092 | 3300012204 | Vadose Zone Soil | MHAPLRQILVPVLRSGAMVALAMMLILGLLPVILAVQAGRN* |
| Ga0150985_1080389041 | 3300012212 | Avena Fatua Rhizosphere | SQVAFSAARVGFMIALAMMLILGLLPAILSVQAATQ* |
| Ga0150985_1167251582 | 3300012212 | Avena Fatua Rhizosphere | RQVAFSAARIGFMVALAMMLILGLLPAILSVQAATQ* |
| Ga0150984_1161289722 | 3300012469 | Avena Fatua Rhizosphere | MNAPMRHIAFSAVRVGSMVALAMLLILGLLPAVLSVQAATP* |
| Ga0157281_10253522 | 3300012883 | Soil | MHAPVRQVAFSAIRVGAMVALAMMLILGLLPAVLAVQAAST* |
| Ga0157289_100452652 | 3300012903 | Soil | MHAPVSQVAFSAIRVGAMVALAMLLILGLLPAILAVQAAST* |
| Ga0157286_101164711 | 3300012908 | Soil | MHTPVRQVAFSAIRLGAMVALAMLLILGLLPAVLAVQAAST* |
| Ga0157290_104814561 | 3300012909 | Soil | MHAPVRQVAFSAVRLVAMVALAMLLILGLLPAVLAVQAAST* |
| Ga0157301_101330682 | 3300012911 | Soil | MHAPVRQLAFSAIRVGAMVALAMLLILGLLPAVLAVQAAST* |
| Ga0157302_100376553 | 3300012915 | Soil | MHAPVRQFAFSAIRVGAMVALAMLLILGLLPAVIAVQAATT* |
| Ga0164300_102182572 | 3300012951 | Soil | MHAPVRQVAYSAIRVGAMVALAMLLILGLLPAVLAVQAAST* |
| Ga0164300_102734262 | 3300012951 | Soil | MRQIAVSAIRIGAMVALAMLLILGLLPAILAVEAAGR* |
| Ga0164300_105817911 | 3300012951 | Soil | RHTGMHAPMRQLAFSTARIGLLVALAMMLILGLLPAILSVEAATQ* |
| Ga0164300_105891931 | 3300012951 | Soil | MHAPARQVAFSAIRLGAMVALAMLLILGLLPAVLAVQAANT* |
| Ga0164298_104635322 | 3300012955 | Soil | MHAPVRQVAYSAIRVGAMVAFAMLLILGLLPAVLAVQAAST* |
| Ga0164298_111356201 | 3300012955 | Soil | MRQIAVSAIRIGAMVALAMLLILGLLPAILAVEAASR* |
| Ga0164303_100651932 | 3300012957 | Soil | MRQVAFSAIRVGAMVAFAMLLILGLLPAVLAVQAAST* |
| Ga0164303_105537331 | 3300012957 | Soil | MDAPVRQIAVAVIRTGLMVGLAMLLILGLLPAVLAVQAASM* |
| Ga0164299_100675461 | 3300012958 | Soil | MHAPMRQVAFSAIRVGAMVAFAMLLILGLLPAVLAVQAAST* |
| Ga0164299_104595992 | 3300012958 | Soil | MHAPTRQLAFSVARIGVSVAVAMLLILGLLPAILAVQAAST* |
| Ga0164299_106084572 | 3300012958 | Soil | MHAPVRQVAYSAIRLGAMVALAMLLILGLLPAVLAVQAAST* |
| Ga0164301_108490212 | 3300012960 | Soil | MHAPMRQIAFSAIRTGALVALAMLLILGLLPAILAVQAAGK* |
| Ga0164309_103466003 | 3300012984 | Soil | MHAPMRQIAVSAIRIGAMVALAMLLILGLLPAILAVEAASR* |
| Ga0164308_113130731 | 3300012985 | Soil | MRQITFSAVRIGAMVALAMLLILGLLPAILSVQAASQ* |
| Ga0164307_103140082 | 3300012987 | Soil | MRQIAFSAIRTGALVALAMLLILGLLPAILAVQAAGK* |
| Ga0164306_101153773 | 3300012988 | Soil | MHEPMRQLAFSTARIGLLVALAMMLILGLLPAILPVEAATQ* |
| Ga0164305_111647342 | 3300012989 | Soil | MNAPMRQIAFSTARIGLMVALAMLLILGLLPAILSVQAATQ* |
| Ga0157375_102912103 | 3300013308 | Miscanthus Rhizosphere | MRQLAFSTARIGLLVALAMMLILGPLPAILSVEAATQ* |
| Ga0120179_11131581 | 3300013763 | Permafrost | MHAPMRQIAFSAIRIGAMVALAMLLILGLLPAVLAVQAASS* |
| Ga0120181_10183842 | 3300013766 | Permafrost | MRQIAFSAIRIGAMVALAMLLILGLLPAVLAVQAASS* |
| Ga0120125_10536951 | 3300014056 | Permafrost | MHAPMRQIAFSAIRIGALIALAMVLILGLLPAVLAVQAAS* |
| Ga0075342_10678901 | 3300014320 | Natural And Restored Wetlands | MRQIAFSAIRTGILVALAMLLILGLLPAILAVQAAGL* |
| Ga0163163_116756391 | 3300014325 | Switchgrass Rhizosphere | MHAPVRQLAFSAIRVGAMVALAMLLILGLLPAILA |
| Ga0167632_10015422 | 3300015085 | Glacier Forefield Soil | MRQIAFTAIRIGAMVALAMLLILGLLPAVLAVQAASS* |
| Ga0167665_10138602 | 3300015163 | Glacier Forefield Soil | MRQIAFSVIRIGALVALAMLLILGLLPAVLAVQAART* |
| Ga0167659_10082943 | 3300015191 | Glacier Forefield Soil | MHAEMRQIAFSVIRIGALVALAMLLILGLLPAVLAVQAAST* |
| Ga0167646_10027137 | 3300015192 | Glacier Forefield Soil | MHAPMRQIAFSAVRVLALVGLAMLLILGLLPAVLAVEAASV* |
| Ga0167646_10345372 | 3300015192 | Glacier Forefield Soil | MYAPMRQIAFSAIRTGAMVALAMLLILGLLPAVLAVQAAST* |
| Ga0167646_10596982 | 3300015192 | Glacier Forefield Soil | MRPIAFSAVRTAAMIALAMLLILGLLPAILAIQTASV* |
| Ga0167646_10761012 | 3300015192 | Glacier Forefield Soil | MRQIAFSVIRIGTLVALAMLLILGLLPAVLAVQAAST* |
| Ga0167666_100118610 | 3300015194 | Glacier Forefield Soil | MHAEMRQIAFSVIRIGALVALAMLLILGLLPAVLAVQAART* |
| Ga0167647_10243072 | 3300015199 | Glacier Forefield Soil | MHAEMRQIAFSVIRIGTLVALAMLLILGLLPAVLAVQAAST* |
| Ga0167647_10717872 | 3300015199 | Glacier Forefield Soil | MQAPMRPIAFSAVRTAAMIALAMLLILGLLPAILAIQTASV* |
| Ga0132258_107135732 | 3300015371 | Arabidopsis Rhizosphere | MRQLTVSAVRIGFMVALAMLLILGLLPAVLAVQAASH* |
| Ga0132258_110733512 | 3300015371 | Arabidopsis Rhizosphere | MRQVAISAIRTGLLVAIAMLLILGLLPAVLAVQAATV* |
| Ga0132256_1027157061 | 3300015372 | Arabidopsis Rhizosphere | MHAPTRQLALSVARIGVSVAVAMLLILGLLPAILAVQAAST* |
| Ga0132256_1027734942 | 3300015372 | Arabidopsis Rhizosphere | MRQLALSVVRIGVAVAVAMLLILGLLPAILAVQAAST* |
| Ga0132257_1020495151 | 3300015373 | Arabidopsis Rhizosphere | MRQLAFSVVRIGVAVAVAMLLILGLLPAILAVQAAST* |
| Ga0132255_1033515821 | 3300015374 | Arabidopsis Rhizosphere | MRQLTVSAVRIGFMVALAMLLILGLLPAVLAVQAASN* |
| Ga0163161_110003511 | 3300017792 | Switchgrass Rhizosphere | MRQLAFSTARIGLLVALAMMLILGLLPAILSVEAATQ |
| Ga0190266_100145202 | 3300017965 | Soil | MRQIAFSAVRLGAMVALAMLLILGILPAILSVQAASQ |
| Ga0190266_113290962 | 3300017965 | Soil | MHAPMRQIAFSAFRVGAMVALALLLILGLLPAVLAVQAAST |
| Ga0184608_102916701 | 3300018028 | Groundwater Sediment | MHAPMRQIASSAIRTGAMVALAMLLILGLFPAILAVQAAGK |
| Ga0184626_101520072 | 3300018053 | Groundwater Sediment | MHAPMRQIAFSVIRIGALVALAMLLILGLLPAILAVQAASK |
| Ga0184635_100691992 | 3300018072 | Groundwater Sediment | MRQIAFSAFRVGAMVALAMLLILGLLPAVLAVQAATT |
| Ga0184624_104925332 | 3300018073 | Groundwater Sediment | MHAPVRQVAFSAIRLGAMVALAMLLILGLLPAVLAVQAAST |
| Ga0184632_101929112 | 3300018075 | Groundwater Sediment | MRQIAFSVIRIGALVALAMLLILGLLPAILAVQAASK |
| Ga0184625_102429342 | 3300018081 | Groundwater Sediment | MRQIAFSAFRVGAMVALAMLLILGLLPAVLAVQAAST |
| Ga0184628_104685571 | 3300018083 | Groundwater Sediment | MHAPTRQLAFSVARIGVSVAVAMLLILGLLPAILAVQAAST |
| Ga0184629_100579243 | 3300018084 | Groundwater Sediment | LTGMHAPMRQLAFSVIRIGAMVALAMLLILGLLPAILAVQAASK |
| Ga0184629_105851351 | 3300018084 | Groundwater Sediment | MHAPMRQIAFSAIRVGAMVALAMLLILGLLPAVLAVQAATT |
| Ga0190275_106476562 | 3300018432 | Soil | MHAPMRQVAFSAFRVGAMVALAMGLILGLLPAVLAVQAAST |
| Ga0190270_132127412 | 3300018469 | Soil | MRQIAFSAFRVGAMVALAMGLILGLLPAVLAVQAAST |
| Ga0190270_134092491 | 3300018469 | Soil | MEAPMRQIAFSAVRLGAMVALAMLLILGILPAILSVQAASQ |
| Ga0190274_110914901 | 3300018476 | Soil | MNAPMRQIAFSAFRVGAMVALAMGLILGLLPAVLAVQAAST |
| Ga0190271_118757451 | 3300018481 | Soil | MNAPMRQIAFSAFRVGAMVALALGLILGLLPAVLAVQAAST |
| Ga0173481_101335222 | 3300019356 | Soil | MHAPVRQVAFSAIRVGAMVALAMLLILGLLPAILAVQAAST |
| Ga0173482_103151542 | 3300019361 | Soil | MHAPVRQVAFSAIRVGAMVALAMLLILGLLPAVLAVQAAST |
| Ga0193741_11806501 | 3300019884 | Soil | MHAPMRQIAFSAFRVGAMVALAMGLILGLLPAVLAVQAAST |
| Ga0193696_11011121 | 3300020016 | Soil | MHAPVRQVAFSAIQLGAMVALAMLLILGLLPAVLAVQATST |
| Ga0210379_100066755 | 3300021081 | Groundwater Sediment | MHAPMRQLAFSVIRIGAMVALAMLLILGLLPAILAVQAASK |
| Ga0210380_101372112 | 3300021082 | Groundwater Sediment | MRQLAFSVIRISVMVAVAMLLILGLLPAVLAVQAAST |
| Ga0210380_101560452 | 3300021082 | Groundwater Sediment | MHAPTRQIAFSVVRVGAMVALAMLLILGLLPAILSVQAASQ |
| Ga0247746_10595551 | 3300022886 | Soil | MHAPVSQVAFSAIRVGAMVALAMLLILGLLPAVLAVQAAST |
| Ga0247791_10697601 | 3300023062 | Soil | LTDMHAPVSQVAFSAIRVGAMVALAMLLILGLLPAVLAVQAAST |
| Ga0247789_10563891 | 3300023266 | Soil | MHAPVRQLAFSAIRVGAMVALAMLLILGLLPAVLAVQAAST |
| Ga0207697_103398672 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MHAPVRQVAFSALRVGAMVALAMLLILGLLPAVLAVQAAST |
| Ga0207642_106225932 | 3300025899 | Miscanthus Rhizosphere | MHAPTRQVAISAVRTALLVAVAMLLILGLLPAVLAVQAASH |
| Ga0207646_102448831 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VHAPIQPVAASVLRAGILVALAMLLILGLLPAVLAAEASRS |
| Ga0207687_103144692 | 3300025927 | Miscanthus Rhizosphere | MHAPTRQVAISAVRTALLVAVAMLLILGLLPAVLAVQAASM |
| Ga0207644_113472311 | 3300025931 | Switchgrass Rhizosphere | MHAPARQVAFSAIRVGAMVALAMLLILGLLPAVLAVQAAST |
| Ga0207706_102824702 | 3300025933 | Corn Rhizosphere | MNAPTRQVAISAVRTALLVAVAMLLILGLLPAVLAVQAASM |
| Ga0207706_109530841 | 3300025933 | Corn Rhizosphere | MHAPMRQLTVSAVRIGFMVALAMLLILGLLPAVLAVQAASM |
| Ga0210126_1052302 | 3300025946 | Natural And Restored Wetlands | MRQIAFSAIRTGILVALAMLLILGLLPAILAVQAAGL |
| Ga0207668_104286532 | 3300025972 | Switchgrass Rhizosphere | MHAPMRQIAFSAFRVGAMVALAMLLILGLLPAVLAVQAAST |
| Ga0207703_102913641 | 3300026035 | Switchgrass Rhizosphere | MHAPVRQFAFSAIRVGAIVALAMMLILGLLPAVLAVQAAST |
| Ga0207702_111018502 | 3300026078 | Corn Rhizosphere | MHAPMRQVAFSAIRVGAMLALAMLLILGLLPAVLAVQAAST |
| Ga0207683_101930672 | 3300026121 | Miscanthus Rhizosphere | MHAPVRQFAFSAIRVGAMVALAMLLILGLLPAVLAVQAAST |
| Ga0209974_102387731 | 3300027876 | Arabidopsis Thaliana Rhizosphere | MHAPMRQVAFSAIRVGAMVALAMLLILGLLPAVLAVQAAST |
| Ga0307322_101120512 | 3300028710 | Soil | MHAPMRQVAFSAVRVGAMVALAMLLILGLLPAVLAVQAAST |
| Ga0307298_100509411 | 3300028717 | Soil | MHAPMRQVAYSAIRLGAMVALAMLLILGLLPAVLAVQAAST |
| Ga0307317_100399442 | 3300028720 | Soil | MRQVAFSAIRVGAMVALAMLLILGLLPAVIAVQAAST |
| Ga0307280_100165202 | 3300028768 | Soil | MRQVALSTIRVGAMVALAMLLILGLLPAVLAVQAAST |
| Ga0307280_100921932 | 3300028768 | Soil | MRQVAFSAIRVGAMVALAMLLILGLLPAVLAVQAAST |
| Ga0307282_103065701 | 3300028784 | Soil | MHAPMRQVAFSAIRVGAMVALAMLLILGLLPAVIAVQAATT |
| Ga0307283_101399781 | 3300028790 | Soil | MHAPMRQVALSTIRVGAMVALAMLLILGLLPAVLAVQAAST |
| Ga0307503_101192062 | 3300028802 | Soil | MHAPVRQAAFSAIRLGAMVALAMLLILGLLPAVLAVQAAST |
| Ga0307281_100010863 | 3300028803 | Soil | MRQIAFSAIRLGAMVALAMGLILGLLPAVLAVQAATT |
| Ga0307281_100022352 | 3300028803 | Soil | MHAPMRQIAFSAIRTGVLVALAMLLILGLLPAILAVQAAGS |
| Ga0307281_100096802 | 3300028803 | Soil | MHAPMRQIAFSAIRIGVMIALAMLLILGLLPAILAVQAAST |
| Ga0307281_100590312 | 3300028803 | Soil | MQSPVRQVAFSAIRVAAMIALALLLILGLLPAVLAVQAAST |
| Ga0307296_102435262 | 3300028819 | Soil | RLTGMHAPMRQIASSAIRTGAMVALAMLLILGLFPAILAVQAAGK |
| Ga0307286_101690072 | 3300028876 | Soil | MHAPMRQVAFSAIRVWAMVALAMLLILGLLPAVIAVQAAST |
| Ga0307304_102776321 | 3300028885 | Soil | MHAPVRQTAFSAIRLGAMVALALLLILGLLPAVLAVQAAST |
| Ga0302299_100947062 | 3300030010 | Fen | MHAPMRQLALSVVRIGAMVGFALLLILGLLPAILSVESAAI |
| Ga0307380_100465366 | 3300031539 | Soil | MHAQKRQIALSAARVGLLVALAMLLILDLLPATLAAQAATR |
| Ga0318555_101501342 | 3300031640 | Soil | MHQHAPVRQVAISAIRTGLLVAIAMLLILGLLPAILAVQAAGM |
| Ga0318496_105618401 | 3300031713 | Soil | MHQHAPVRQVAVSAIRTRLLVAIAMLLILGLLPAILAVQAAGM |
| Ga0307468_1014210502 | 3300031740 | Hardwood Forest Soil | MRQLAFSVVRIGVAVAVAMLLILGLLPAILAVQAAST |
| Ga0318568_104269912 | 3300031819 | Soil | MHQHAPVRQVAVSAIRTGLLVAIAMLLILGLLPAILAVQAAGM |
| Ga0310893_104752002 | 3300031892 | Soil | MRQLAFSVVRVGFMVAIAMLLILGLLPAVLAVQAAST |
| Ga0310900_109170952 | 3300031908 | Soil | MHAPTRQIAISAVRTALLVAVAMLLILGLLPAVLAVQAASM |
| Ga0311367_102666132 | 3300031918 | Fen | MRQLALSVVRIGAMVGFALLLILGLLPAILSVESAAI |
| Ga0310912_105113621 | 3300031941 | Soil | RQVAISAIRTGLLVAIAMLLILGLLPAILAVQAAGM |
| Ga0326597_100380671 | 3300031965 | Soil | MHAPMRQIAFSAIRVGAMVAFAMLLILGLLPAILAAQAASM |
| Ga0326597_118348371 | 3300031965 | Soil | MHAPMRQIAFSAIRIGAMVALAMLLILGLLPAILAV |
| Ga0315278_102914601 | 3300031997 | Sediment | MLQVAFSAIRIGAMIALAMLLILGLLPATLAMQAAST |
| Ga0310903_108070481 | 3300032000 | Soil | MHAPMHAPTRQIAISAVRTALLVAVAMLLILGLLPAVLAVQAAST |
| Ga0310890_115058332 | 3300032075 | Soil | MRQLAFSVVRVGFMVAMAMLLILGLLPAVLAVQAAST |
| Ga0315292_109383862 | 3300032143 | Sediment | MLQVAFSAIRIGAMIALAMLLILGLLPTILAMQAAST |
| Ga0315283_105496862 | 3300032164 | Sediment | MHEPMRQIAFSAIRIGAMVALSMLLILGLLPAILAVQTASW |
| Ga0315268_112880121 | 3300032173 | Sediment | NDMHAPLLQIAFSAIRTGVMVAIAMLLILGLLPAILAAST |
| Ga0315271_106474992 | 3300032256 | Sediment | MRSIAFSAVRTGVLVALAMLLILGLLPAILAFQAAST |
| Ga0315271_106747932 | 3300032256 | Sediment | MRSIAFSAVRTGALVALAMLLILGLLPAILAFQAAST |
| Ga0315270_101363062 | 3300032275 | Sediment | MHAPLLQIAFSAIRTGVMVAIAMLLILGLLPAILAAST |
| Ga0310914_116801781 | 3300033289 | Soil | PMHQHPPVRQVAISAIRTGLLVAIAMLLILGLLPAILAVQAAGM |
| Ga0310914_117604632 | 3300033289 | Soil | MHAPMHQHAPVRQVAISAIRTGLLVAIAMLLILGLLPA |
| Ga0370486_035027_139_264 | 3300034126 | Untreated Peat Soil | MHAPRNRVVSSIIRTGAMVALAVLLILGLLPAILAAQAGRT |
| Ga0364925_0339384_445_558 | 3300034147 | Sediment | MRQLAFSAIRIGAMVALAMLLILGLLPAILAVQAAST |
| Ga0364933_084754_43_168 | 3300034150 | Sediment | MHAPMRQVAYSAIRVGAMIALAMLLILGLLPAVLAVQAAST |
| Ga0364933_089934_216_341 | 3300034150 | Sediment | MHAPMRQLAFSVIRIGAMVALAMLLILGLLPAVLAGQAAST |
| Ga0364931_0338726_235_360 | 3300034176 | Sediment | MHAPMRQIAFSAIRIGAMVALAMLLILGLLPAILAVQAAST |
| Ga0370501_0177591_103_228 | 3300034195 | Untreated Peat Soil | MHAPMRQIAFIAVRTGVLIALAMLLILGLLPAILSVQAASR |
| Ga0364941_079704_137_262 | 3300034417 | Sediment | MPAPTRQIAFSVLRIGIMVAFAMLLILGILPAVLAVEAASN |
| ⦗Top⦘ |