NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F025589

Metagenome / Metatranscriptome Family F025589

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F025589
Family Type Metagenome / Metatranscriptome
Number of Sequences 201
Average Sequence Length 67 residues
Representative Sequence MIEIIGWIGAATMVAASFKMGKPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSIIGFTLSLIRK
Number of Associated Samples 159
Number of Associated Scaffolds 201

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 52.74 %
% of genes near scaffold ends (potentially truncated) 39.80 %
% of genes from short scaffolds (< 2000 bps) 84.08 %
Associated GOLD sequencing projects 144
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (48.259 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine
(19.403 % of family members)
Environment Ontology (ENVO) Unclassified
(63.682 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(84.080 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 84.85%    β-sheet: 0.00%    Coil/Unstructured: 15.15%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 201 Family Scaffolds
PF00145DNA_methylase 1.99
PF06067DUF932 1.49
PF00929RNase_T 1.00
PF03976PPK2 1.00
PF16778Phage_tail_APC 1.00
PF01844HNH 1.00
PF02675AdoMet_dc 0.50
PF00462Glutaredoxin 0.50
PF04860Phage_portal 0.50

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 201 Family Scaffolds
COG0270DNA-cytosine methylaseReplication, recombination and repair [L] 1.99
COG2326Polyphosphate kinase 2, PPK2 familyEnergy production and conversion [C] 1.00
COG1586S-adenosylmethionine decarboxylaseAmino acid transport and metabolism [E] 0.50


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms58.71 %
UnclassifiedrootN/A41.29 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2236876004|none_p0352336Not Available504Open in IMG/M
3300000101|DelMOSum2010_c10087564Not Available1347Open in IMG/M
3300000115|DelMOSum2011_c10026547All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium2637Open in IMG/M
3300000115|DelMOSum2011_c10033431All Organisms → Viruses → Predicted Viral2239Open in IMG/M
3300000115|DelMOSum2011_c10090637Not Available1031Open in IMG/M
3300000224|SI34jun09_10mDRAFT_1059999Not Available500Open in IMG/M
3300000225|SI34jun09_120mDRAFT_1018377All Organisms → Viruses → Predicted Viral1984Open in IMG/M
3300001348|JGI20154J14316_10048073All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon1849Open in IMG/M
3300001450|JGI24006J15134_10029753All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium2411Open in IMG/M
3300001450|JGI24006J15134_10033117All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium2246Open in IMG/M
3300001472|JGI24004J15324_10026048All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium1940Open in IMG/M
3300001589|JGI24005J15628_10075054All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium1208Open in IMG/M
3300001589|JGI24005J15628_10098000All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium991Open in IMG/M
3300002144|M2t2BS2_10235753Not Available566Open in IMG/M
3300002524|JGI24927J35514_1010594Not Available727Open in IMG/M
3300002524|JGI24927J35514_1013082Not Available646Open in IMG/M
3300002524|JGI24927J35514_1019443All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium522Open in IMG/M
3300003216|JGI26079J46598_1055079Not Available793Open in IMG/M
3300003263|JGI26117J46588_1018486All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium637Open in IMG/M
3300003263|JGI26117J46588_1028750All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium520Open in IMG/M
3300003264|JGI26119J46589_1004997All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium1673Open in IMG/M
3300003264|JGI26119J46589_1005487All Organisms → Viruses → Predicted Viral1582Open in IMG/M
3300003478|JGI26238J51125_1059300Not Available768Open in IMG/M
3300003500|JGI26242J51144_1061617All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium611Open in IMG/M
3300004448|Ga0065861_1069081Not Available1552Open in IMG/M
3300004461|Ga0066223_1192098Not Available620Open in IMG/M
3300005828|Ga0074475_10189374All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium679Open in IMG/M
3300005838|Ga0008649_10029845All Organisms → Viruses → Predicted Viral2572Open in IMG/M
3300005941|Ga0070743_10079715All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium1105Open in IMG/M
3300005941|Ga0070743_10122558All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium869Open in IMG/M
3300005942|Ga0070742_10004366All Organisms → cellular organisms → Bacteria → Proteobacteria3693Open in IMG/M
3300006165|Ga0075443_10018372Not Available2352Open in IMG/M
3300006352|Ga0075448_10043151All Organisms → cellular organisms → Bacteria → Proteobacteria1446Open in IMG/M
3300006735|Ga0098038_1181796All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium688Open in IMG/M
3300006789|Ga0098054_1137969Not Available903Open in IMG/M
3300006793|Ga0098055_1043849All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium1821Open in IMG/M
3300006793|Ga0098055_1299502All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium601Open in IMG/M
3300006803|Ga0075467_10179047All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium1195Open in IMG/M
3300006920|Ga0070748_1343727All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium527Open in IMG/M
3300006921|Ga0098060_1047412All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium1276Open in IMG/M
3300006924|Ga0098051_1106109All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium752Open in IMG/M
3300007231|Ga0075469_10093961All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium847Open in IMG/M
3300007546|Ga0102874_1203004Not Available607Open in IMG/M
3300007547|Ga0102875_1157961All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium710Open in IMG/M
3300007551|Ga0102881_1008231All Organisms → cellular organisms → Bacteria2961Open in IMG/M
3300007554|Ga0102820_1087308Not Available749Open in IMG/M
3300007558|Ga0102822_1035144All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium1196Open in IMG/M
3300007558|Ga0102822_1039850All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon1119Open in IMG/M
3300007558|Ga0102822_1110037Not Available649Open in IMG/M
3300007558|Ga0102822_1161987All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium530Open in IMG/M
3300007618|Ga0102896_1201036Not Available627Open in IMG/M
3300007637|Ga0102906_1052319Not Available1175Open in IMG/M
3300007651|Ga0102900_1126227All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium560Open in IMG/M
3300007653|Ga0102868_1010015All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium1929Open in IMG/M
3300007661|Ga0102866_1209608Not Available503Open in IMG/M
3300007667|Ga0102910_1078118Not Available763Open in IMG/M
3300007692|Ga0102823_1180178Not Available563Open in IMG/M
3300007716|Ga0102867_1075885All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium890Open in IMG/M
3300007863|Ga0105744_1048999All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp.1043Open in IMG/M
3300007863|Ga0105744_1092279All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium747Open in IMG/M
3300007863|Ga0105744_1139703All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium603Open in IMG/M
3300007956|Ga0105741_1012840All Organisms → Viruses → Predicted Viral2136Open in IMG/M
3300007962|Ga0102907_1043741All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium1224Open in IMG/M
3300007974|Ga0105747_1357643All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium500Open in IMG/M
3300007981|Ga0102904_1075042Not Available779Open in IMG/M
3300007992|Ga0105748_10142924Not Available977Open in IMG/M
3300007992|Ga0105748_10549373Not Available507Open in IMG/M
3300008052|Ga0102893_1091755All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium905Open in IMG/M
3300008950|Ga0102891_1048457All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon1320Open in IMG/M
3300008950|Ga0102891_1098290Not Available884Open in IMG/M
3300008995|Ga0102888_1012875All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium1532Open in IMG/M
3300009024|Ga0102811_1379008Not Available534Open in IMG/M
3300009049|Ga0102911_1112929Not Available776Open in IMG/M
3300009050|Ga0102909_1012638All Organisms → cellular organisms → Bacteria2236Open in IMG/M
3300009052|Ga0102886_1099526Not Available884Open in IMG/M
3300009059|Ga0102830_1104546All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium838Open in IMG/M
3300009071|Ga0115566_10141002All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium1512Open in IMG/M
3300009080|Ga0102815_10825903Not Available528Open in IMG/M
3300009086|Ga0102812_10066293All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium1998Open in IMG/M
3300009420|Ga0114994_10305357Not Available1060Open in IMG/M
3300009420|Ga0114994_10492991Not Available808Open in IMG/M
3300009428|Ga0114915_1138494Not Available698Open in IMG/M
3300009428|Ga0114915_1147921Not Available669Open in IMG/M
3300009436|Ga0115008_11321122Not Available552Open in IMG/M
3300009441|Ga0115007_10214132Not Available1243Open in IMG/M
3300009495|Ga0115571_1338460Not Available595Open in IMG/M
3300009544|Ga0115006_10863670Not Available799Open in IMG/M
3300010150|Ga0098056_1283491Not Available547Open in IMG/M
3300010309|Ga0102890_1025905All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium1145Open in IMG/M
3300011252|Ga0151674_1021471All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium1360Open in IMG/M
3300012953|Ga0163179_10447463All Organisms → Viruses → Predicted Viral1058Open in IMG/M
3300013010|Ga0129327_10036748Not Available2497Open in IMG/M
3300017697|Ga0180120_10025588Not Available2748Open in IMG/M
3300017697|Ga0180120_10046034All Organisms → Viruses → Predicted Viral1976Open in IMG/M
3300017708|Ga0181369_1011889All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium2210Open in IMG/M
3300017710|Ga0181403_1063356Not Available770Open in IMG/M
3300017735|Ga0181431_1081404Not Available726Open in IMG/M
3300017743|Ga0181402_1158068Not Available572Open in IMG/M
3300017748|Ga0181393_1187455All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium505Open in IMG/M
3300017757|Ga0181420_1085504All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium980Open in IMG/M
3300017757|Ga0181420_1243147Not Available513Open in IMG/M
3300017760|Ga0181408_1092218Not Available791Open in IMG/M
3300017765|Ga0181413_1139712All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium732Open in IMG/M
3300017765|Ga0181413_1217667All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium568Open in IMG/M
3300017765|Ga0181413_1245511Not Available528Open in IMG/M
3300017772|Ga0181430_1052897All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium1258Open in IMG/M
3300017773|Ga0181386_1049069All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium1360Open in IMG/M
3300017773|Ga0181386_1168803All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium665Open in IMG/M
3300017781|Ga0181423_1117851All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium1033Open in IMG/M
3300017782|Ga0181380_1116003Not Available922Open in IMG/M
3300017783|Ga0181379_1135500All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium885Open in IMG/M
3300017786|Ga0181424_10127179All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium1098Open in IMG/M
3300017786|Ga0181424_10308197All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium657Open in IMG/M
3300020165|Ga0206125_10003191Not Available16129Open in IMG/M
3300020165|Ga0206125_10366670All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium528Open in IMG/M
3300020335|Ga0211690_1088421Not Available672Open in IMG/M
3300020347|Ga0211504_1064166Not Available856Open in IMG/M
3300020352|Ga0211505_1068460All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium858Open in IMG/M
3300020382|Ga0211686_10055361All Organisms → cellular organisms → Bacteria → Proteobacteria1604Open in IMG/M
3300020385|Ga0211677_10357747Not Available574Open in IMG/M
3300020396|Ga0211687_10247394Not Available712Open in IMG/M
3300020469|Ga0211577_10475484All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium761Open in IMG/M
3300021085|Ga0206677_10006949All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes8512Open in IMG/M
3300021085|Ga0206677_10062602All Organisms → Viruses → Predicted Viral1875Open in IMG/M
3300021087|Ga0206683_10047548Not Available2442Open in IMG/M
3300021087|Ga0206683_10318171All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium791Open in IMG/M
3300021185|Ga0206682_10036078All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium2869Open in IMG/M
3300021185|Ga0206682_10053944All Organisms → Viruses → Predicted Viral2176Open in IMG/M
3300021185|Ga0206682_10123482All Organisms → cellular organisms → Bacteria1251Open in IMG/M
3300021389|Ga0213868_10167851All Organisms → Viruses → Predicted Viral1343Open in IMG/M
3300021957|Ga0222717_10017543All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes4839Open in IMG/M
3300021957|Ga0222717_10249053Not Available1032Open in IMG/M
3300021957|Ga0222717_10727722All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium504Open in IMG/M
3300021959|Ga0222716_10002680Not Available14430Open in IMG/M
3300021959|Ga0222716_10025330All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes4371Open in IMG/M
3300021959|Ga0222716_10768247All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium503Open in IMG/M
3300021960|Ga0222715_10204953All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium1177Open in IMG/M
3300021960|Ga0222715_10465313All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium677Open in IMG/M
3300022074|Ga0224906_1018804All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium2507Open in IMG/M
3300022178|Ga0196887_1046049All Organisms → Viruses → Predicted Viral1134Open in IMG/M
(restricted) 3300023109|Ga0233432_10128942Not Available1365Open in IMG/M
(restricted) 3300024261|Ga0233439_10252100All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium780Open in IMG/M
(restricted) 3300024264|Ga0233444_10056371All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium2299Open in IMG/M
3300024281|Ga0228610_1033673Not Available670Open in IMG/M
3300024343|Ga0244777_10790696Not Available561Open in IMG/M
3300024346|Ga0244775_10516600Not Available974Open in IMG/M
3300025084|Ga0208298_1007614All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium2844Open in IMG/M
3300025108|Ga0208793_1016802All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium2671Open in IMG/M
3300025120|Ga0209535_1011065All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes5066Open in IMG/M
3300025138|Ga0209634_1001996Not Available14505Open in IMG/M
3300025276|Ga0208814_1035500All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon1548Open in IMG/M
3300025665|Ga0209360_1097957All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium872Open in IMG/M
3300025665|Ga0209360_1203453Not Available516Open in IMG/M
3300025676|Ga0209657_1022511All Organisms → Viruses → Predicted Viral2599Open in IMG/M
3300025870|Ga0209666_1193151All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon881Open in IMG/M
3300027081|Ga0208954_1018287All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium955Open in IMG/M
3300027188|Ga0208921_1030889Not Available805Open in IMG/M
3300027192|Ga0208673_1038569Not Available783Open in IMG/M
3300027216|Ga0208677_1018656All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium952Open in IMG/M
3300027220|Ga0208927_1068924Not Available602Open in IMG/M
3300027234|Ga0208170_1050120Not Available836Open in IMG/M
3300027243|Ga0208174_1037572Not Available612Open in IMG/M
3300027245|Ga0208445_1017671Not Available731Open in IMG/M
3300027249|Ga0208175_1006883All Organisms → cellular organisms → Bacteria → Proteobacteria1287Open in IMG/M
3300027280|Ga0208972_1094755All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium523Open in IMG/M
3300027413|Ga0208950_1124639Not Available513Open in IMG/M
3300027668|Ga0209482_1025997All Organisms → cellular organisms → Bacteria → Proteobacteria2436Open in IMG/M
3300027672|Ga0209383_1015463All Organisms → cellular organisms → Bacteria → Proteobacteria3429Open in IMG/M
3300027810|Ga0209302_10303892Not Available737Open in IMG/M
3300027813|Ga0209090_10246664Not Available904Open in IMG/M
3300028129|Ga0228634_1063318Not Available899Open in IMG/M
3300028196|Ga0257114_1116463All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium1067Open in IMG/M
3300030725|Ga0308128_1022214Not Available750Open in IMG/M
3300031140|Ga0308024_1084356Not Available797Open in IMG/M
3300031142|Ga0308022_1025876All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon1883Open in IMG/M
3300031519|Ga0307488_10343564Not Available943Open in IMG/M
3300031519|Ga0307488_10346687Not Available938Open in IMG/M
3300031519|Ga0307488_10378594All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon882Open in IMG/M
3300031588|Ga0302137_1205579Not Available680Open in IMG/M
3300031596|Ga0302134_10045295Not Available2022Open in IMG/M
3300031597|Ga0302116_1042687All Organisms → cellular organisms → Bacteria → Proteobacteria1746Open in IMG/M
3300031599|Ga0308007_10084946All Organisms → cellular organisms → Bacteria → Proteobacteria1172Open in IMG/M
3300031602|Ga0307993_1015623All Organisms → cellular organisms → Bacteria → Proteobacteria1921Open in IMG/M
3300031608|Ga0307999_1023026All Organisms → cellular organisms → Bacteria → Proteobacteria1535Open in IMG/M
3300031608|Ga0307999_1083342Not Available743Open in IMG/M
3300031612|Ga0308009_10010346All Organisms → cellular organisms → Bacteria → Proteobacteria3879Open in IMG/M
3300031637|Ga0302138_10053702All Organisms → Viruses → Predicted Viral1555Open in IMG/M
3300031639|Ga0302117_10306547Not Available615Open in IMG/M
3300031656|Ga0308005_10173818Not Available574Open in IMG/M
3300031658|Ga0307984_1065930Not Available1101Open in IMG/M
3300031687|Ga0308008_1073751All Organisms → cellular organisms → Bacteria → Proteobacteria802Open in IMG/M
3300031757|Ga0315328_10188576All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium1205Open in IMG/M
3300031757|Ga0315328_10546787Not Available664Open in IMG/M
3300031766|Ga0315322_10123528All Organisms → Viruses → Predicted Viral1855Open in IMG/M
3300031773|Ga0315332_10626695All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium667Open in IMG/M
3300031774|Ga0315331_10594015All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium793Open in IMG/M
3300032032|Ga0315327_10345161All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium933Open in IMG/M
3300032032|Ga0315327_10410830Not Available846Open in IMG/M
3300032073|Ga0315315_11399168All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium610Open in IMG/M
3300032088|Ga0315321_10739885All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium565Open in IMG/M
3300032088|Ga0315321_10755442All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium557Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine19.40%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine14.93%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine9.95%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater9.45%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater8.46%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine5.47%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine4.98%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water3.98%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water3.48%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean1.49%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater1.49%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater1.49%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine1.49%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.49%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous1.99%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine1.99%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine1.99%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.50%
MarineEnvironmental → Aquatic → Marine → Inlet → Unclassified → Marine0.50%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.50%
Marine EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine0.50%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.50%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.50%
MarineEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine0.50%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.00%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine1.00%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater1.00%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2236876004Estuarine microbial communities from Columbia River, sample from South Channel ETM site, GS313-0p1-ETM-15mEnvironmentalOpen in IMG/M
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300000115Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011EnvironmentalOpen in IMG/M
3300000224Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 34 06/16/09 10mEnvironmentalOpen in IMG/M
3300000225Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 34 06/16/09 120mEnvironmentalOpen in IMG/M
3300001348Pelagic Microbial community sample from North Sea - COGITO 998_met_04EnvironmentalOpen in IMG/M
3300001450Marine viral communities from the Pacific Ocean - LP-53EnvironmentalOpen in IMG/M
3300001472Marine viral communities from the Pacific Ocean - LP-32EnvironmentalOpen in IMG/M
3300001589Marine viral communities from the Pacific Ocean - LP-40EnvironmentalOpen in IMG/M
3300002144Marine microbial communities from the Baltic Sea, analyzing arctic terrigenous carbon compounds - M2t2BS2 (113f)EnvironmentalOpen in IMG/M
3300002524Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - C0912_C49A8_35EnvironmentalOpen in IMG/M
3300003216Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNAEnvironmentalOpen in IMG/M
3300003263Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_48_BLW_10EnvironmentalOpen in IMG/M
3300003264Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_54_BLW_10EnvironmentalOpen in IMG/M
3300003478Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_100m_DNAEnvironmentalOpen in IMG/M
3300003500Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S4LV_100m_DNAEnvironmentalOpen in IMG/M
3300004448Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300004461Marine viral communities from Newfoundland, Canada BC-2EnvironmentalOpen in IMG/M
3300005828Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.182_BBIEnvironmentalOpen in IMG/M
3300005838Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_130m_DNAEnvironmentalOpen in IMG/M
3300005941Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697EnvironmentalOpen in IMG/M
3300005942Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757EnvironmentalOpen in IMG/M
3300006165Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNAEnvironmentalOpen in IMG/M
3300006352Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNAEnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300006921Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaGEnvironmentalOpen in IMG/M
3300006924Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaGEnvironmentalOpen in IMG/M
3300007231Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007546Estuarine microbial communities from the Columbia River estuary - metaG 1547A-02EnvironmentalOpen in IMG/M
3300007547Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02EnvironmentalOpen in IMG/M
3300007551Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3EnvironmentalOpen in IMG/M
3300007554Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709EnvironmentalOpen in IMG/M
3300007558Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.733EnvironmentalOpen in IMG/M
3300007618Estuarine microbial communities from the Columbia River estuary - metaG 1554A-02EnvironmentalOpen in IMG/M
3300007637Estuarine microbial communities from the Columbia River estuary - metaG 1556A-02EnvironmentalOpen in IMG/M
3300007651Estuarine microbial communities from the Columbia River estuary - metaG 1555C-3EnvironmentalOpen in IMG/M
3300007653Estuarine microbial communities from the Columbia River estuary - metaG 1546C-3EnvironmentalOpen in IMG/M
3300007661Estuarine microbial communities from the Columbia River estuary - metaG 1546A-3EnvironmentalOpen in IMG/M
3300007667Estuarine microbial communities from the Columbia River estuary - metaG 1558A-3EnvironmentalOpen in IMG/M
3300007692Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743EnvironmentalOpen in IMG/M
3300007716Estuarine microbial communities from the Columbia River estuary - metaG 1546B-3EnvironmentalOpen in IMG/M
3300007863Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459B_0.2umEnvironmentalOpen in IMG/M
3300007956Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459A_0.2umEnvironmentalOpen in IMG/M
3300007962Estuarine microbial communities from the Columbia River estuary - metaG 1556B-02EnvironmentalOpen in IMG/M
3300007974Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2umEnvironmentalOpen in IMG/M
3300007981Estuarine microbial communities from the Columbia River estuary - metaG 1556A-3EnvironmentalOpen in IMG/M
3300007992Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2umEnvironmentalOpen in IMG/M
3300008052Estuarine microbial communities from the Columbia River estuary - metaG 1553A-02EnvironmentalOpen in IMG/M
3300008950Estuarine microbial communities from the Columbia River estuary - metaG 1552A-02EnvironmentalOpen in IMG/M
3300008995Estuarine microbial communities from the Columbia River estuary - metaG 1551A-3EnvironmentalOpen in IMG/M
3300009024Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705EnvironmentalOpen in IMG/M
3300009049Estuarine microbial communities from the Columbia River estuary - metaG 1558A-02EnvironmentalOpen in IMG/M
3300009050Estuarine microbial communities from the Columbia River estuary - metaG 1557A-02EnvironmentalOpen in IMG/M
3300009052Estuarine microbial communities from the Columbia River estuary - metaG 1550A-02EnvironmentalOpen in IMG/M
3300009059Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703EnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009080Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759EnvironmentalOpen in IMG/M
3300009086Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713EnvironmentalOpen in IMG/M
3300009420Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152EnvironmentalOpen in IMG/M
3300009428Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009495Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531EnvironmentalOpen in IMG/M
3300009544Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M MetagenomeEnvironmentalOpen in IMG/M
3300010150Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaGEnvironmentalOpen in IMG/M
3300010309Estuarine microbial communities from the Columbia River estuary - metaG 1552A-3EnvironmentalOpen in IMG/M
3300011252Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, permeateEnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300013010Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNAEnvironmentalOpen in IMG/M
3300017697Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)EnvironmentalOpen in IMG/M
3300017708Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaGEnvironmentalOpen in IMG/M
3300017710Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28EnvironmentalOpen in IMG/M
3300017735Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21EnvironmentalOpen in IMG/M
3300017743Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17EnvironmentalOpen in IMG/M
3300017748Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21EnvironmentalOpen in IMG/M
3300017757Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22EnvironmentalOpen in IMG/M
3300017760Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16EnvironmentalOpen in IMG/M
3300017765Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28EnvironmentalOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300017773Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24EnvironmentalOpen in IMG/M
3300017781Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017783Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10EnvironmentalOpen in IMG/M
3300017786Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18EnvironmentalOpen in IMG/M
3300020165Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1EnvironmentalOpen in IMG/M
3300020335Marine microbial communities from Tara Oceans - TARA_B100000768 (ERX556030-ERR599035)EnvironmentalOpen in IMG/M
3300020347Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994)EnvironmentalOpen in IMG/M
3300020352Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556084-ERR599144)EnvironmentalOpen in IMG/M
3300020382Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX556058-ERR599059)EnvironmentalOpen in IMG/M
3300020385Marine microbial communities from Tara Oceans - TARA_B100001059 (ERX556045-ERR598965)EnvironmentalOpen in IMG/M
3300020396Marine microbial communities from Tara Oceans - TARA_B100000767 (ERX555915-ERR599122)EnvironmentalOpen in IMG/M
3300020469Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052)EnvironmentalOpen in IMG/M
3300021085Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015EnvironmentalOpen in IMG/M
3300021087Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015EnvironmentalOpen in IMG/M
3300021185Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015EnvironmentalOpen in IMG/M
3300021389Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300021960Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9DEnvironmentalOpen in IMG/M
3300022074Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2)EnvironmentalOpen in IMG/M
3300022178Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3)EnvironmentalOpen in IMG/M
3300023109 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MGEnvironmentalOpen in IMG/M
3300024261 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_100_MGEnvironmentalOpen in IMG/M
3300024264 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MGEnvironmentalOpen in IMG/M
3300024281Seawater microbial communities from Monterey Bay, California, United States - 11DEnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025084Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025108Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025276Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes)EnvironmentalOpen in IMG/M
3300025665Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_130m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025676Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_100m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025870Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027081Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - C0912_C33A6_35 (SPAdes)EnvironmentalOpen in IMG/M
3300027188Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709 (SPAdes)EnvironmentalOpen in IMG/M
3300027192Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715 (SPAdes)EnvironmentalOpen in IMG/M
3300027216Estuarine microbial communities from the Columbia River estuary - metaG 1546A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027220Estuarine microbial communities from the Columbia River estuary - metaG 1546C-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027234Estuarine microbial communities from the Columbia River estuary - metaG 1550A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027243Estuarine microbial communities from the Columbia River estuary - metaG 1556A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027245Estuarine microbial communities from the Columbia River estuary - metaG 1556B-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027249Estuarine microbial communities from the Columbia River estuary - metaG 1557A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027280Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_48_BLW_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027413Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_54_BLW_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027668Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027672Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027813Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes)EnvironmentalOpen in IMG/M
3300028129Seawater microbial communities from Monterey Bay, California, United States - 42DEnvironmentalOpen in IMG/M
3300028196Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10mEnvironmentalOpen in IMG/M
3300030725Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1298_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031140Marine microbial communities from water near the shore, Antarctic Ocean - #420EnvironmentalOpen in IMG/M
3300031142Marine microbial communities from water near the shore, Antarctic Ocean - #353EnvironmentalOpen in IMG/M
3300031519Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2EnvironmentalOpen in IMG/M
3300031588Marine microbial communities from Western Arctic Ocean, Canada - CBN3_SCMEnvironmentalOpen in IMG/M
3300031596Marine microbial communities from Western Arctic Ocean, Canada - CB9_SCMEnvironmentalOpen in IMG/M
3300031597Marine microbial communities from Western Arctic Ocean, Canada - AG5_SCMEnvironmentalOpen in IMG/M
3300031599Marine microbial communities from water near the shore, Antarctic Ocean - #71EnvironmentalOpen in IMG/M
3300031602Marine microbial communities from Ellis Fjord, Antarctic Ocean - #260EnvironmentalOpen in IMG/M
3300031608Marine microbial communities from water near the shore, Antarctic Ocean - #1EnvironmentalOpen in IMG/M
3300031612Marine microbial communities from water near the shore, Antarctic Ocean - #127EnvironmentalOpen in IMG/M
3300031637Marine microbial communities from Western Arctic Ocean, Canada - CBN3_32.1EnvironmentalOpen in IMG/M
3300031639Marine microbial communities from Western Arctic Ocean, Canada - AG5_32.2EnvironmentalOpen in IMG/M
3300031656Marine microbial communities from water near the shore, Antarctic Ocean - #67EnvironmentalOpen in IMG/M
3300031658Marine microbial communities from Ellis Fjord, Antarctic Ocean - #78EnvironmentalOpen in IMG/M
3300031687Marine microbial communities from water near the shore, Antarctic Ocean - #125EnvironmentalOpen in IMG/M
3300031757Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 32315EnvironmentalOpen in IMG/M
3300031766Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515EnvironmentalOpen in IMG/M
3300031773Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 34915EnvironmentalOpen in IMG/M
3300031774Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915EnvironmentalOpen in IMG/M
3300032032Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 32315EnvironmentalOpen in IMG/M
3300032073Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416EnvironmentalOpen in IMG/M
3300032088Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
none_035233622236876004Marine EstuarineMIEIIGWIGAATMVGASFKMTKPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSIIGFTLSLIRNNRDEYFKIWDLDGTVI
DelMOSum2010_1008756443300000101MarineMIEIIGWIGAATMVGASFKMTKPLGLXMAIVGLSLLTIQAYSNETYNLLTLNLCSIIGFTLSLIRK
DelMOSum2011_1002654753300000115MarineVIEAIGWIGAAVMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSIIGSTWRGL*
DelMOSum2011_1003343143300000115MarineVIEVIGWIGAAIMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSIIGFTLSLMRKAK*
DelMOSum2011_1009063723300000115MarineVIEVIGWMGAAVMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSIIGFTLSLMRKAK*
SI34jun09_10mDRAFT_105999913300000224MarineMIEIIGWIGAATMVGASFKMTKPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSIIGFTLSL
SI34jun09_120mDRAFT_101837753300000225MarineRVIALACGWIGATIMVIASFNMRKPLGLKMAILALLLLSIQAYSNATYNLLALNLCSVLGFALSLYKGDEK*
JGI20154J14316_1004807353300001348Pelagic MarineSRGYCSVIISLIGWVGAAIMVAASFNMASPSGLLMAIVGLALLTIQAAHNRTMNLVILNISSIIGFTYALYI*
JGI24006J15134_1002975333300001450MarineMIELIGWIGAVTMVGASFKMSEPLGLKMAIVGLSLLSIQAYDTETYNLLALNICSIIGFTLSLIRNNK*
JGI24006J15134_1003311753300001450MarineMIELIGWIGAVTMVGASFKMSEPLGLKMAIVGLSLLSIQAYDTETYNLLALNICSIIGF
JGI24004J15324_1002604823300001472MarineMIELIGWIGAVTMVGASFKMSEPLGLXMAIVGXSLLSIQAYDTXTYNLLALNICSIIGFTLSLIRNNK*
JGI24005J15628_1007505433300001589MarineLNHWRNIMIELIGWIGAVTMVGASFKMSEPLGLKMAIVGLSLLSIQAYDTETYNLLALNICSIIGFSISLIRKEK*
JGI24005J15628_1009800023300001589MarineMIELIGWIGAVTMVGASFKMSEPLGLKMAIVGXSLLSIQAYDTETYNLLALNICSIIGFTNSLIRXXK*
M2t2BS2_1023575313300002144MarineMIALACGWIGAAVMVAASFNMGKPLGLKMAIVGLLLLTIQAYSNETYNLLTLNLCSIIGFSLSLYKGMDK
JGI24927J35514_101059423300002524MarineVIEVIGWIGAAVMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSIIGFTLSLIRSSK*
JGI24927J35514_101308223300002524MarineMVAASFKMGQPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSIIGFTLSLIRK*
JGI24927J35514_101944323300002524MarineVIEVIGWVGAAVMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSIIGFTLSLIRASK*
JGI26079J46598_105507923300003216MarineMIEIIGWIGAATMVGASFKMTKPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSIIGFTLSLIRK*
JGI26117J46588_101848623300003263MarineMIEVIGWIGAAVMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSIIGFTLSLIRTSK*
JGI26117J46588_102875023300003263MarineRPKSSETIGAYSMIEIIGWIGAATMVAASFKMGQPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSIIGFTLSLIRK*
JGI26119J46589_100499753300003264MarineTIGAYSMIEIIGWIGAATMVAASFKMGQPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSIIGFTLSLIRK*
JGI26119J46589_100548723300003264MarineMIEIIGWIGAATMVAASFKMGQPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSIIGFTLSLIRK*
JGI26238J51125_105930033300003478MarineMIEVIGWIGAAVMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSIIGFT
JGI26242J51144_106161723300003500MarineMIEVIGWIGAAVMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSIIGFTLSLIRSSK*
Ga0065861_106908123300004448MarineMIEFIGWVGAATMVGASFNMRKPLGLKMAIVGLSMLTIQAYSNETYNLLTLNLCSIIGFSLSLYKGMDK*
Ga0066223_119209823300004461MarineMIEIIGWVGAATMVGASFNMRKPLGLKMAIVGLSMLTIQAYSNETYNLLTLNLCSIIGFSLSLYKGMDK*
Ga0074475_1018937413300005828Sediment (Intertidal)MIEVIGWIGAAVMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSIIGFTLSLIRASK*
Ga0008649_1002984533300005838MarineVIALACGWIGATIMVIASFNMRKPLGLKMAILALLLLSIQAYSNATYNLLALNLCSVLGFALSLYKGDEK*
Ga0070743_1007971533300005941EstuarineDEYIMIEVIGWIGAAIMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSIIGFTLSLIRASK*
Ga0070743_1012255823300005941EstuarineMIEIIGWIGAATMVAASFKMGQPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSMIGFTLSLIRK*
Ga0070742_1000436633300005942EstuarineVIEVIGWIGAAVMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSIIGFTLSLIRASK*
Ga0075443_1001837233300006165MarineMIALICGWIGAAVMVAASFNMTKPLGLMMAIGGLSLLTIQAYSNETYNLLTLNLCSIIGFSLSLYKGMNK*
Ga0075448_1004315133300006352MarineMIEFIGWVGAATMVGASFNMTKPLGLVMAIIGLSMLTIQAYSNETYNLLTLNLCSILGFSLSLYKGMNK*
Ga0098038_118179623300006735MarineMIELIGWVGAVTMVGASFKMSEPLGLKMAIVGLSLLSIQAYDSSTYNLLALNICSIIGFTKSLIRN*
Ga0098054_113796913300006789MarineMIEIIGWIGAATMVAASFKMGKPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSIIGF
Ga0098055_104384943300006793MarineMIEVIGWIGAAVMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSIIGFTLSLIRKAK*
Ga0098055_129950223300006793MarineMIEIIGWIGAATMVAASFKMGKPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSIIGFTLSLIRK*
Ga0075467_1017904723300006803AqueousMIEVIGWIGAAVMVAASFNMARPLGLKMAIIGLSLLTIQAYSTDTYNLIVLNLSSIIGFTLSLMRKAK*
Ga0070748_134372723300006920AqueousMIEIIGWIGAATMVGASFKMGQPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSIIGFTLSLIRK*
Ga0098060_104741233300006921MarineVIEVIGWIGAAVMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSIIGFTLSLMRKAK*
Ga0098051_110610923300006924MarineEIIGWIGAATMVAASFKMGQPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSIIGFTLSLIRK*
Ga0075469_1009396123300007231AqueousMIEVIGWIGAATMVGASFKMGKPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSIIGFTLSLIRK*
Ga0102874_120300423300007546EstuarineMIEIIGWIGAATMVGASFKMTKPLGLKMAIVALSLLTIQAYSNETYNLLTLNLCSIIGFTLSLIRK*
Ga0102875_115796123300007547EstuarineLTLIGFALYNQGLTTEVYYMIEIIGWIGAATMVGASFKMTKPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSIIGFTLSLIRK*
Ga0102881_100823163300007551EstuarineMIEVIGWIGAAVMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSIIGFTLSLMRKAK*
Ga0102820_108730823300007554EstuarineYNQGLTTEVYYMIEIIGWIGAATMVGASFKMTKPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSIIGFTLSLIRK*
Ga0102822_103514433300007558EstuarineVIEIIGWIGAATMVAASFKMGQPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSIIGFTLSLIRK*
Ga0102822_103985013300007558EstuarineYMIEIIGWIGAATMVGASFKMTKPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSIIGFTLSLIRK*
Ga0102822_111003723300007558EstuarineEVYYMIEIIGWIGAATMVGASFKMTKPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSIIGFTLSLIRK*
Ga0102822_116198723300007558EstuarineAVMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSIIGFTLSLIRASK*
Ga0102896_120103623300007618EstuarineLGKALYNQGLTTEVYYMIEIIGWIGAATMVGASFKMTKPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSIIGFTLSLIRK*
Ga0102906_105231943300007637EstuarineVIEVIGWIGAAVMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSIIGFTLSLIRA
Ga0102900_112622723300007651EstuarineLTTEVYYMIEIIGWIGAATMVGASFKMTKPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSIIGFTLSLIRK*
Ga0102868_101001533300007653EstuarineMIEVIGWIGAAIMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSIIGFILSLIRASK*
Ga0102866_120960813300007661EstuarineMIEIIGWIGAATMVAASFKMGQPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSII
Ga0102910_107811813300007667EstuarineVIEVIGWIGAAVMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSIIGFTLSLI
Ga0102823_118017823300007692EstuarineMIEIIGWIGAATMVAASFKMGQPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSIIGFTLSLIR
Ga0102867_107588513300007716EstuarineMIEVIGWIGAAIMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSIIGFTLSLIRTSK*
Ga0105744_104899913300007863Estuary WaterIMIELIGWIGAVTMVGASFKMSEPLGLKMAIVGLALLSIQAYDTETYNLLALNICSIIGFSISLIRKEK*
Ga0105744_109227923300007863Estuary WaterVIEVIGWVGAAVMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSIIGFTLSLIRSSK*
Ga0105744_113970313300007863Estuary WaterNIMIELIGWIGAVTMVGASFKMSEPLGLKMAIVGLSLLSIQAYDTETYNLLALNICSIIGFTNSLIRKEK*
Ga0105741_101284033300007956Estuary WaterMIELIGWIGAVTMVGASFKMSEPLGLKMAIVGLSLLSIQAYDTETYNLLALNICSIIGFTNSLIRKEK*
Ga0102907_104374133300007962EstuarineMIEVIGWVGAAIMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSIIGFTLSLMRKAK*
Ga0105747_135764313300007974Estuary WaterIGAATMVAASFKMGQPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSIIGFTLSLIRK*
Ga0102904_107504213300007981EstuarineVIEVIGWVGAAVMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSII
Ga0105748_1014292423300007992Estuary WaterMIEVIGWIGAAVMVAASFNMARPLGLKMAIVGLSLLTIQAYSLDTYNLIVLNLSSIIGFTLSLI
Ga0105748_1054937323300007992Estuary WaterMIELIGWIGAVTMVGASFKMSEPLGLKLAIVGLALLSIQAYDTATYNLLALNICSIIGFSISLIRK
Ga0102893_109175523300008052EstuarineVIEVIGWVGAAIMVAASFSMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSIIGFTLSIIRSSK*
Ga0102891_104845713300008950EstuarineALYNQGLTTEVYYMIEIIGWIGAATMVGASFKMTKPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSIIGFTLSLIRK*
Ga0102891_109829033300008950EstuarineDEYIMIEVIGWIGAAVMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSIIGFTLSLIRASK*
Ga0102888_101287533300008995EstuarineMIEVIGWIGAAIMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSIIGFTLSLIRASK*
Ga0102811_137900823300009024EstuarineVIEVIGWIGAAVMVAASFNMARPLGLKMAIVGLSLLNIQAYSSDTYNLIVLNLSSIIGFTLSLI
Ga0102911_111292933300009049EstuarineAATMVGASFKMTKPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSIIGFTLSLIRK*
Ga0102909_101263873300009050EstuarineVIEVIGWVGAAIMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSIIGFTLSLIRASK*
Ga0102886_109952633300009052EstuarineMIEIIGWIGAATMVVASFKMTKPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSIIGFTLSLIRK*
Ga0102830_110454613300009059EstuarineAYSMIEIIGWIGAATMVAASFKMGQPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSIIGFTLSLIRK*
Ga0115566_1014100243300009071Pelagic MarineMIEIIGWIGAATMVGASFKMGKPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSIIGFTLSLIRK*
Ga0102815_1082590323300009080EstuarineMIEVIGWIGAAVMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSIIGFTLSLIRS
Ga0102812_1006629313300009086EstuarineYRMIEIIGWIGAATMVAASFKMGQPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSIIGFTLSLIRK*
Ga0114994_1030535723300009420MarineMIEIIGWVGAATMVGASFKMTKPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSIIGFSLSLIRK*
Ga0114994_1049299123300009420MarineMIALACGWIGAAIMVAASFNMGKPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSIIGFSLSLYKGMDK*
Ga0114915_113849423300009428Deep OceanMIEFIGWVGAATMVGASFNMTKPLGLVMAIIGLSMLTIQAYSNETYNLLTLNLCSI
Ga0114915_114792123300009428Deep OceanMIEFIGWIGAATMVGASFNMTKPLGLMMAIIGLSLLTIQAYSNETYNLLTLNLCSILGFSLSLYKGLDK*
Ga0115008_1132112213300009436MarineMIALACGWIGAAVMVAASFNMGKPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSILGFSLSLYKGMD
Ga0115007_1021413223300009441MarineMIEFIGWVGAATMVGASFNMTKPLGLMMAIIGLSMLTIQAYSNETYNLLTLNLCSILGFSLSLYKGMDK*
Ga0115571_133846013300009495Pelagic MarineMIEIIGWIGAATMVGASFKMGKPLGLKMAIVGFSLLTIQADSNETYHLLTLNLCSIIGFTLSLIRK*
Ga0115006_1086367023300009544MarineMIEFIGWVGAATMVGASFNMTKPLGLMMAIIGLSMLTIQAYSNETYNLLTLNLCSILGFSLSLYKGMDR*
Ga0098056_128349113300010150MarineMIAFIGWLGALTMVGASFNMTTDFGMILAIIGLGLLTIQAIHNRTNNLILLNLCSIIGFITSLIG*
Ga0102890_102590523300010309EstuarineMIEISGWIGAATMVAASFKMGQPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSIIGFTLSLIRK*
Ga0151674_102147123300011252MarineMIELIGWIGAVTMVGASFKMSEPLGLKMAIVGLALLSIQAYDTETYNLLTLNICSIIGFTNSLIRKEK*
Ga0163179_1044746323300012953SeawaterMIELIGWIGAVTMVVASFKMSEPLGLKMAIVGLSLLSIQAYDNAIYNLLTLNICSIIGFTNSLIRKKK*
Ga0129327_1003674823300013010Freshwater To Marine Saline GradientVIEVIGWVGAAVMVAASFNMARPLGLKMAIIGLSLLTIQAYSSDTYNLIVLNLSSIIGFTLSLMRKAK*
Ga0180120_1002558833300017697Freshwater To Marine Saline GradientVIEVIGWVGAAVMVAASFNMARPLGLKMAIIGLSLLTIQAYSSDTYNLIVLNLSSIIGFTLSLMRKAK
Ga0180120_1004603443300017697Freshwater To Marine Saline GradientVIEVIGWIGAAIMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSIIGFTLSLMRKAK
Ga0181369_101188933300017708MarineMIELIGWVGAVTMVGASFKMSEPLGLKMAIIGLSLLSIQAYDSSTYNLLALNICSIIGFSLSLIRNKK
Ga0181403_106335633300017710SeawaterMIELIGWIGAVTMVGASFKMSEPLGLKMAIVGLSLLSIQAYDSSTYNLLALNICSIIGFTNSLIRKEK
Ga0181431_108140423300017735SeawaterMIELIGWIGAVTMVGASFKMSEPLGLKMAIVGLALLSIQAYDTATYNLLALNICSIIGFTNSLIRKEK
Ga0181402_115806813300017743SeawaterMIELIGWIGAVTMVGSSFKMSEPLGLKMAIVGLSLLSIQAYNTETYNLLALNICSIIGFTNSLIRKEK
Ga0181393_118745523300017748SeawaterGAYRMIEIIGWIGAATMVAASFKMGQPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSIIGFTLSLIRK
Ga0181420_108550423300017757SeawaterVIEVIGWVGAAVMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSIIGFTLSLIRTSK
Ga0181420_124314713300017757SeawaterVIEIIGWIGAATMVAASFKMGQPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSIIGF
Ga0181408_109221823300017760SeawaterMIGLIGWIGAVTMVGASFKMSEPLGLKMAIVGLSLLSIQAYDTATYNLLALNICSIIGFTNSLIRKEK
Ga0181413_113971213300017765SeawaterAVTMVGASFKMSEPLGLKMAIVGLALLSIQAYDTATYNLLALNICSIIGFTNSLIRKEK
Ga0181413_121766713300017765SeawaterAVTMVGASFKMSEPLGLKMAIVGLALLSIQAYDTATYNLLALNICSIIGFSISLIRKEK
Ga0181413_124551123300017765SeawaterMIELIGWIGAVSMVGASFKMSEPLCLKMAIVGLSLLSIQAYDTATYNLLALNICSIIGFTNSLIRKEK
Ga0181430_105289733300017772SeawaterVMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSIIGFTLSLIRASK
Ga0181386_104906933300017773SeawaterMIELIGWIGAVTMVGASFKMSEPLGLKMAIVGLSLLSIQAYDTATYNKLALNICSIIGFSISLIRKEK
Ga0181386_116880313300017773SeawaterTMVGASFKMSEPLGLKMAIVGLALLSIQAYDTATYNLLALNICSIIGFSISLIRKEK
Ga0181423_111785133300017781SeawaterWIGAATMVAASFKMGQPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSIIGFTLSLIRK
Ga0181380_111600333300017782SeawaterMIAFIGWLGALTMVGASFNMTTDFGMILAIIGLGLLTIQAIHNRTNNLILLNLCSIIGFITSLIG
Ga0181379_113550023300017783SeawaterMIELIGWIGAVTMVGASFKMSEPLGLKMAIVVLALLSIQAYDTATYNLLALNICSIIGFSISLIRKEK
Ga0181424_1012717933300017786SeawaterGAAVMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSIIGFTLSLIRASK
Ga0181424_1030819723300017786SeawaterMIGLIGWIGAVTMVGSSFKMSEPLGLKMAIVGLSLLSIQAYNTETYNLLALNICSIIGFTNSLIRKEK
Ga0206125_1000319133300020165SeawaterMIEAIGWIGAAVMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSIIGFTLSLMRKGK
Ga0206125_1036667023300020165SeawaterMIEIIGWIGAATMVGASFKMGKPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSIIGFTLSLIRK
Ga0211690_108842123300020335MarineMVGASFNMTKPLGLMMAIIGLSLLTIQAYSNETYNLLTLNLCSILGFSLSLYKGLDK
Ga0211504_106416623300020347MarineMIEIIGWIGAATMVGASFKMGQPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSIIGFTLSLIRK
Ga0211505_106846023300020352MarineVIEVIGWIGAAVMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSIIGFTLSLIRKAK
Ga0211686_1005536133300020382MarineMIEFIGWVGAATMVGASFNMTKPLGLVMAIIGLSMLTIQAYSNETYNLLTLNLCSILGFSLSLYKGMNK
Ga0211677_1035774713300020385MarineVIEVIGWIGAAVMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSIIGFTLSLIRASK
Ga0211687_1024739423300020396MarineGWIGAATMVGASFNMTKPLGLMMAIIGLSLLTIQAYSNETYNLLTLNLCSILGFSLSLYKGLDK
Ga0211577_1047548423300020469MarineMIGLIGWIGAVTMVGASFKMSEPLGLKMAIVGLALLSIQAYDTATYNLLALNICSIIGFSISLIRKEK
Ga0206677_1000694953300021085SeawaterMIEIIGWIGAATMVAASFKMGQPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSIIGFTLSLIRK
Ga0206677_1006260233300021085SeawaterMIEIIGWIGAATMVAASFKMGQPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSMIGFTLSLIRK
Ga0206683_1004754833300021087SeawaterMIEVIGWIGAAIMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSIIGFTLSLIRTSK
Ga0206683_1031817123300021087SeawaterVIEVIGWVGAAVMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSIIGFTLSLIRASK
Ga0206682_1003607863300021185SeawaterVIEVIGWIGAAVMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSIIGFTLSLIRTSK
Ga0206682_1005394413300021185SeawaterSGVLRVIEVIGWIGAAVMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSIIGFTLSLIRASK
Ga0206682_1012348243300021185SeawaterVIEIIGWIGAATMVAASFKMGQPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSIIGFTLSLIRK
Ga0213868_1016785133300021389SeawaterMIEVIGWIGAATMVGASFKMGKPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSIIGFTLSLIRK
Ga0222717_1001754393300021957Estuarine WaterMIEIIGWIGAATMVAASFKMGQPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSMIG
Ga0222717_1024905323300021957Estuarine WaterMIEVIGWIGAAVMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSIIGFTLSLIRASK
Ga0222717_1072772223300021957Estuarine WaterMIEVIGWIGAAVMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSIIGFTLSLMRKAK
Ga0222716_10002680163300021959Estuarine WaterVIEVIGWIGAAVMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSIIGFTLSLIRSSK
Ga0222716_1002533013300021959Estuarine WaterMIEIIGWIGAATMVAASFKMGQPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSMI
Ga0222716_1076824723300021959Estuarine WaterPIEQHIVIEVIGWIGAAVMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSIIGFTLSLIRTSK
Ga0222715_1020495333300021960Estuarine WaterMVAASFKMGQPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSIIGFTLSLIRK
Ga0222715_1046531323300021960Estuarine WaterKGNRPKSSETIGAYSMIEIIGWIGAATMVAASFKMGQPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSMIGFTLSLIRK
Ga0224906_101880433300022074SeawaterMIELIGWIGAVTMVGASFKMSEPLGLKMAIVGLALLSIQAYDTATYNLLALNICSIIGFSISLIRKEK
Ga0196887_104604923300022178AqueousMIEVIGWVGAAVMVAASFNMARPLGLKMAIIGLSLLTIQAYSSDTYNLIVLNLSSIIGFTLSLMRKAK
(restricted) Ga0233432_1012894253300023109SeawaterVIEVIGWVGAAVMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSIIGFTLSLIRSSK
(restricted) Ga0233439_1025210023300024261SeawaterVIEVIGWVGAAIMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSIIGFTLSLIRASK
(restricted) Ga0233444_1005637133300024264SeawaterMIEIIGWIGAAIMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSIIGFTLSLIRASK
Ga0228610_103367313300024281SeawaterVIEVIGWIGAAVMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSIIGFTLSL
Ga0244777_1079069613300024343EstuarineMIEIIGWIGAATMVAASFKMGQPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSMIGFTLSL
Ga0244775_1051660013300024346EstuarineMIEVIGWIGAAVMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSIIGFTLSLMR
Ga0208298_100761463300025084MarineVIEVIGWIGAAVMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSIIGFTLSLMRKAK
Ga0208793_101680233300025108MarineMIEIIGWIGAATMVAASFKMGKPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSIIGFTLSLIRK
Ga0209535_101106593300025120MarineMIELIGWIGAVTMVGASFKMSEPLGLKMAIVGLSLLSIQAYDTETYNLLALNICSIIGFTLSLIRNNK
Ga0209634_1001996113300025138MarineMIELIGWIGAVTMVGASFKMSEPLGLKMAIVGLSLLSIQAYDTETYNLLALNICSIIGFTNSLIRKEK
Ga0208814_103550033300025276Deep OceanMIEFIGWIGAATMVGASFNMTKPLGLVMAIIGLSMLTIQAYSNETYNLLTLNLCSIIGFSLSLYKGMNK
Ga0209360_109795723300025665MarineMIEVIGWIGAAVMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSIIGFTLSLIRSSK
Ga0209360_120345313300025665MarineMIEIIGWIGAATMVGASFKMTKPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSIIGFT
Ga0209657_102251133300025676MarineVIALACGWIGATIMVIASFNMRKPLGLKMAILALLLLSIQAYSNATYNLLALNLCSVLGFALSLYKGDEK
Ga0209666_119315133300025870MarineVYYMIEIIGWIGAATMVGASFKMTKPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSIIGFTLSLIRK
Ga0208954_101828733300027081MarineGWIGAAVMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSIIGFTLSLIRTSK
Ga0208921_103088933300027188EstuarineTEVYYMIEIIGWIGAATMVGASFKMTKPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSIIGFTLSLIRK
Ga0208673_103856933300027192EstuarineIGAATMVAASFKMGQPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSIIGFTLSLIRK
Ga0208677_101865633300027216EstuarineVIEVIGWVGAAVMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSIIGFTLSLMRKAK
Ga0208927_106892423300027220EstuarineMIEVIGWIGAAIMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSIIGFTLSLIRASK
Ga0208170_105012013300027234EstuarineNQGLTTEVYYMIEIIGWIGAATMVGASFKMTKPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSIIGFTLSLIRK
Ga0208174_103757213300027243EstuarineMIEVIGWIGAAVMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSIIGFTLSLIRAS
Ga0208445_101767113300027245EstuarineMIEIIGWIGAATMVGASFKMTKPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSIIGFTLSLIRASK
Ga0208175_100688333300027249EstuarineMIEVIGWIGAAIMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSIIGFTLSLIRSSK
Ga0208972_109475523300027280MarineMIEVIGWIGAAVMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSIIGFTLSLIRTSK
Ga0208950_112463923300027413MarineMIEVIGWIGAAIMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSIIGFTLSLIR
Ga0209482_102599733300027668MarineMIALICGWIGAAVMVAASFNMTKPLGLMMAIGGLSLLTIQAYSNETYNLLTLNLCSIIGFSLSLYKGMNK
Ga0209383_101546353300027672MarineMVAASFNMTKPLGLMMAIGGLSLLTIQAYSNETYNLLTLNLCSIIGFSLSLYKGMNK
Ga0209302_1030389213300027810MarineMIEFIGWVGAATMVGASFNMTKPLGLMMAIIGLSMLTIQAYSNETYNLLTLNLCSILGFSLSLY
Ga0209090_1024666433300027813MarineIIGWVGAATMVGASFKMTKPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSIIGFSLSLIRK
Ga0228634_106331813300028129SeawaterFYSGVLRVIEVIGWIGAAVMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSIIGFTLSLIRASK
Ga0257114_111646323300028196MarineMIEIIGWIGAAVMVAASFNMAKPLGLKMALVGLSLLTVQAYDNETYNLIVLNLSSIIGFSLSLIRKKSS
Ga0308128_102221413300030725MarineMIEFIGWVGAATMVGASFNMGKPLGLKMAIIGLSLLTIQAYSNETYNLLTLNLCSILGFSLSLSKVWTNE
Ga0308024_108435613300031140MarineMIALICGWIGAAVMVAASFNMTKPLGLMMAIGGLCLLTIQAYSNETYNLLTLNLCSIIGFSLSLYKGMNK
Ga0308022_102587633300031142MarineMIEIIGWIGAATMVGASFKMSQPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSIIGFSLSLWNAPKVLLTTKDFK
Ga0307488_1034356423300031519Sackhole BrineMIEFIGWVGAATMVGASFNMGKPLGLKMAIIGLSMLTIQAYSNETYNLLTLNLCSILGFSLSLYKGMDK
Ga0307488_1034668723300031519Sackhole BrineMLKLINTIGWIGAAVMVAASFNMASPSGLIMAIVGLALLTIQAAHNRTMNLVILNISSIIGFTYALYI
Ga0307488_1037859433300031519Sackhole BrineMIEIIGWVGAATMVGASFKMTKPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSIIGFSLSLIRK
Ga0302137_120557913300031588MarineMIALACGWIGAAIMVAASFNMGKPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSIIG
Ga0302134_1004529543300031596MarineMIALACGWIGAAIMVAASFNMGKPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSIIGFSLSLYK
Ga0302116_104268723300031597MarineMIALACGWIGAAIMVAASFNMGKPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSIIGFSLSLYKGMDK
Ga0308007_1008494613300031599MarineIGWVGAATMVGASFNMTKPLGLVMAIIGLSMLTIQAYSNETYNLLTLNLCSILGFSLSLYKGMNK
Ga0307993_101562323300031602MarineMIALVCGWIGAAVMVAASFNMTKPLGLMMAIGGLCLLTIQAYSNETYNLLTLNLCSIIGFSLSLYKGMNK
Ga0307999_102302613300031608MarineATMVGASFNMTKPLGLVMAIIGLSMLTIQAYSNETYNLLTLNLCSILGFSLSLYKGMNK
Ga0307999_108334213300031608MarineMIEFIGWVGAATMVGASFNMTKRLGLVMAIIGLSMLTIQAYSNETYNLLTLNLCSILGFSLSLY
Ga0308009_1001034643300031612MarineMVAASFNMTKPLGLMMAIGGLCLLTIQAYSNETYNLLTLNLCSIIGFSLSLYKGMNK
Ga0302138_1005370233300031637MarineMIEIIGWVGAATMVGASFKMTKPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSIIGFTLSLIRK
Ga0302117_1030654713300031639MarineMIALACGWIGAAIMVAASFNMGKPLGLKMAIVGLSLLTIQAYSNETYNLLTLNLCSIIGF
Ga0308005_1017381813300031656MarineMIALICGWIGAAIMVAASFNMTKPLGLMMAIGGLCLLTIQAFSNETYNLLTLNLCSIIGFSL
Ga0307984_106593013300031658MarineMIEFIGWIGAATMVGASFKMSQPLGLKMAIIGLSMLTIQAYSNETYNLLTLNLCSILGFSLSLYKGMNK
Ga0308008_107375113300031687MarineVMVAASFNMTKPLGLMMAIGGLCLLTIQAYSNETYNLLTLNLCSIIGFSLSLYKGMNK
Ga0315328_1018857643300031757SeawaterVIEVIGWIGAAVMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIALNLSSIIGFTLSLMRKGK
Ga0315328_1054678713300031757SeawaterMIEVIGWIGAAIMVAASFNMARPLGLKMAVVGLSLLTIQAYSSDTYNLIVLNLSSIIGFT
Ga0315322_1012352813300031766SeawaterAVMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSIIGFTLSLIRASK
Ga0315332_1062669523300031773SeawaterMIEVIGWIGAAIMVAASFNMARPLGLKMAVVGLSLLTIQAYSSDTYNLIALNLSSIIGFTLSLMRKGK
Ga0315331_1059401523300031774SeawaterMIELIGWIGAVTMVGASFKMSEPLGLKMAIVGLSLLSIQAYDTATYNLLALNICSIIGFTNSLIRKEK
Ga0315327_1034516123300032032SeawaterMIEVIGWIGAAIMVAASFNMARPLGLKMAVVGLSLLTIQAYSSDTYNLIVLNLSSIIGFTLSLMRKAK
Ga0315327_1041083033300032032SeawaterVIEVIGWVGAAVMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSIIGFT
Ga0315315_1139916823300032073SeawaterMIELIGWIGAVTMVGASFKMSEPLGLKMAIVGLSLLSIQAYDTATYNLLALNICSIIGFSISLIRKEK
Ga0315321_1073988523300032088SeawaterVIEIIGWIGAAVMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSIIGFTLSLIRTSK
Ga0315321_1075544213300032088SeawaterAVMVAASFNMARPLGLKMAIVGLSLLTIQAYSSDTYNLIVLNLSSIIGFTLSLMRKAK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.