| Basic Information | |
|---|---|
| Family ID | F025186 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 203 |
| Average Sequence Length | 42 residues |
| Representative Sequence | ARTYGPPGLEADIEFCAQVDLLDNVPRFSRMVGNAAEIVA |
| Number of Associated Samples | 168 |
| Number of Associated Scaffolds | 203 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.50 % |
| % of genes near scaffold ends (potentially truncated) | 98.52 % |
| % of genes from short scaffolds (< 2000 bps) | 93.60 % |
| Associated GOLD sequencing projects | 165 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (80.788 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (21.675 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.690 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.158 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 11.76% β-sheet: 16.18% Coil/Unstructured: 72.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 203 Family Scaffolds |
|---|---|---|
| PF00817 | IMS | 11.33 |
| PF04075 | F420H2_quin_red | 9.36 |
| PF00903 | Glyoxalase | 5.42 |
| PF01551 | Peptidase_M23 | 5.42 |
| PF01019 | G_glu_transpept | 3.94 |
| PF07883 | Cupin_2 | 2.96 |
| PF13519 | VWA_2 | 2.46 |
| PF03737 | RraA-like | 2.46 |
| PF02537 | CRCB | 1.97 |
| PF12681 | Glyoxalase_2 | 1.97 |
| PF08031 | BBE | 1.97 |
| PF12697 | Abhydrolase_6 | 1.48 |
| PF11950 | DUF3467 | 1.48 |
| PF07690 | MFS_1 | 1.48 |
| PF03807 | F420_oxidored | 1.48 |
| PF04020 | Phage_holin_4_2 | 1.48 |
| PF00248 | Aldo_ket_red | 0.99 |
| PF02581 | TMP-TENI | 0.99 |
| PF07732 | Cu-oxidase_3 | 0.99 |
| PF07584 | BatA | 0.99 |
| PF04029 | 2-ph_phosp | 0.99 |
| PF03372 | Exo_endo_phos | 0.49 |
| PF13411 | MerR_1 | 0.49 |
| PF00875 | DNA_photolyase | 0.49 |
| PF02811 | PHP | 0.49 |
| PF00990 | GGDEF | 0.49 |
| PF13751 | DDE_Tnp_1_6 | 0.49 |
| PF13508 | Acetyltransf_7 | 0.49 |
| PF00999 | Na_H_Exchanger | 0.49 |
| PF02518 | HATPase_c | 0.49 |
| PF08241 | Methyltransf_11 | 0.49 |
| PF00781 | DAGK_cat | 0.49 |
| PF02641 | DUF190 | 0.49 |
| PF00089 | Trypsin | 0.49 |
| PF03952 | Enolase_N | 0.49 |
| PF13185 | GAF_2 | 0.49 |
| PF05974 | DUF892 | 0.49 |
| PF13302 | Acetyltransf_3 | 0.49 |
| PF02615 | Ldh_2 | 0.49 |
| PF12796 | Ank_2 | 0.49 |
| PF14079 | DUF4260 | 0.49 |
| PF01636 | APH | 0.49 |
| PF13578 | Methyltransf_24 | 0.49 |
| PF09278 | MerR-DNA-bind | 0.49 |
| PF03734 | YkuD | 0.49 |
| PF13462 | Thioredoxin_4 | 0.49 |
| PF00583 | Acetyltransf_1 | 0.49 |
| PF01177 | Asp_Glu_race | 0.49 |
| PF13432 | TPR_16 | 0.49 |
| PF00196 | GerE | 0.49 |
| PF00201 | UDPGT | 0.49 |
| COG ID | Name | Functional Category | % Frequency in 203 Family Scaffolds |
|---|---|---|---|
| COG0389 | Nucleotidyltransferase/DNA polymerase DinP involved in DNA repair | Replication, recombination and repair [L] | 11.33 |
| COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 3.94 |
| COG0684 | RNA degradosome component RraA (regulator of RNase E activity) | Translation, ribosomal structure and biogenesis [J] | 2.46 |
| COG2045 | Phosphosulfolactate phosphohydrolase or related enzyme | Coenzyme transport and metabolism [H] | 1.97 |
| COG0239 | Fluoride ion exporter CrcB/FEX, affects chromosome condensation | Cell cycle control, cell division, chromosome partitioning [D] | 1.97 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 1.97 |
| COG1950 | Uncharacterized membrane protein YvlD, DUF360 family | Function unknown [S] | 1.48 |
| COG0352 | Thiamine monophosphate synthase | Coenzyme transport and metabolism [H] | 0.99 |
| COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 0.99 |
| COG1819 | UDP:flavonoid glycosyltransferase YjiC, YdhE family | Carbohydrate transport and metabolism [G] | 0.99 |
| COG1597 | Phosphatidylglycerol kinase, diacylglycerol kinase family | Lipid transport and metabolism [I] | 0.99 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.49 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.49 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.49 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.49 |
| COG3685 | Ferritin-like metal-binding protein YciE | Inorganic ion transport and metabolism [P] | 0.49 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.49 |
| COG2055 | Malate/lactate/ureidoglycolate dehydrogenase, LDH2 family | Energy production and conversion [C] | 0.49 |
| COG1993 | PII-like signaling protein | Signal transduction mechanisms [T] | 0.49 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.49 |
| COG0789 | DNA-binding transcriptional regulator, MerR family | Transcription [K] | 0.49 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.49 |
| COG0415 | Deoxyribodipyrimidine photolyase | Replication, recombination and repair [L] | 0.49 |
| COG0148 | Enolase | Carbohydrate transport and metabolism [G] | 0.49 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 80.79 % |
| Unclassified | root | N/A | 15.76 % |
| Polyangium | genus | Polyangium | 3.45 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2032320003|FACENCT_FZOFKYN02GQCQP | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 516 | Open in IMG/M |
| 2124908016|OU_2_1_1_newblercontig44768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 523 | Open in IMG/M |
| 2124908039|B3_v_NODE_105523_len_577_cov_9_315425 | Polyangium → Polyangium aurulentum | 627 | Open in IMG/M |
| 2140918024|NODE_331936_length_1158_cov_8.656304 | All Organisms → cellular organisms → Bacteria | 1208 | Open in IMG/M |
| 2189573002|GZIGXIF01C2RQ2 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 517 | Open in IMG/M |
| 2228664022|INPgaii200_c0965865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 553 | Open in IMG/M |
| 3300000363|ICChiseqgaiiFebDRAFT_10710468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 680 | Open in IMG/M |
| 3300000891|JGI10214J12806_10056715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 632 | Open in IMG/M |
| 3300000953|JGI11615J12901_12921864 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300001535|A3PFW1_10268679 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300004153|Ga0063455_100483428 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300004463|Ga0063356_105482139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 545 | Open in IMG/M |
| 3300004480|Ga0062592_101667531 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300005093|Ga0062594_102458379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 571 | Open in IMG/M |
| 3300005178|Ga0066688_11019520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 503 | Open in IMG/M |
| 3300005329|Ga0070683_101167547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 740 | Open in IMG/M |
| 3300005332|Ga0066388_108301800 | Not Available | 518 | Open in IMG/M |
| 3300005345|Ga0070692_10673842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 693 | Open in IMG/M |
| 3300005345|Ga0070692_10718776 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 674 | Open in IMG/M |
| 3300005365|Ga0070688_101096541 | Not Available | 636 | Open in IMG/M |
| 3300005439|Ga0070711_101495112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 589 | Open in IMG/M |
| 3300005457|Ga0070662_101318215 | Not Available | 621 | Open in IMG/M |
| 3300005467|Ga0070706_102077519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 514 | Open in IMG/M |
| 3300005545|Ga0070695_101258011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 610 | Open in IMG/M |
| 3300005552|Ga0066701_10315800 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300005553|Ga0066695_10117759 | All Organisms → cellular organisms → Bacteria | 1639 | Open in IMG/M |
| 3300005556|Ga0066707_10333324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 993 | Open in IMG/M |
| 3300005558|Ga0066698_10423644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria → Kutzneria albida → Kutzneria albida DSM 43870 | 912 | Open in IMG/M |
| 3300005568|Ga0066703_10436294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 786 | Open in IMG/M |
| 3300005576|Ga0066708_10113617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 1625 | Open in IMG/M |
| 3300005587|Ga0066654_10734868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 555 | Open in IMG/M |
| 3300005598|Ga0066706_10933244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 674 | Open in IMG/M |
| 3300005616|Ga0068852_102800276 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300005764|Ga0066903_103873868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 803 | Open in IMG/M |
| 3300005764|Ga0066903_108509714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 523 | Open in IMG/M |
| 3300005937|Ga0081455_10724575 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300006031|Ga0066651_10613925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 579 | Open in IMG/M |
| 3300006032|Ga0066696_11042277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 520 | Open in IMG/M |
| 3300006046|Ga0066652_101603347 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300006048|Ga0075363_100407680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 799 | Open in IMG/M |
| 3300006049|Ga0075417_10263103 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300006579|Ga0074054_12122323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 755 | Open in IMG/M |
| 3300006755|Ga0079222_11657073 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300006797|Ga0066659_11351906 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300006847|Ga0075431_100460113 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1267 | Open in IMG/M |
| 3300006852|Ga0075433_10913645 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300006881|Ga0068865_100527874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 988 | Open in IMG/M |
| 3300006914|Ga0075436_101139208 | Not Available | 588 | Open in IMG/M |
| 3300009012|Ga0066710_102421398 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 761 | Open in IMG/M |
| 3300009088|Ga0099830_11079355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 666 | Open in IMG/M |
| 3300009094|Ga0111539_12221133 | Not Available | 637 | Open in IMG/M |
| 3300009098|Ga0105245_10047487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3838 | Open in IMG/M |
| 3300009137|Ga0066709_102551404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 687 | Open in IMG/M |
| 3300009148|Ga0105243_11810519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 642 | Open in IMG/M |
| 3300009649|Ga0105855_1196984 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300009789|Ga0126307_10759091 | Not Available | 783 | Open in IMG/M |
| 3300009789|Ga0126307_10826556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 748 | Open in IMG/M |
| 3300009792|Ga0126374_10195587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1274 | Open in IMG/M |
| 3300009840|Ga0126313_10839794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 748 | Open in IMG/M |
| 3300010036|Ga0126305_10177481 | All Organisms → cellular organisms → Bacteria | 1340 | Open in IMG/M |
| 3300010036|Ga0126305_10351669 | Not Available | 965 | Open in IMG/M |
| 3300010036|Ga0126305_10617611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 729 | Open in IMG/M |
| 3300010037|Ga0126304_10225691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1229 | Open in IMG/M |
| 3300010038|Ga0126315_10798346 | Not Available | 622 | Open in IMG/M |
| 3300010043|Ga0126380_12242368 | Not Available | 506 | Open in IMG/M |
| 3300010045|Ga0126311_11110198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 651 | Open in IMG/M |
| 3300010046|Ga0126384_12035978 | Not Available | 550 | Open in IMG/M |
| 3300010047|Ga0126382_11519931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 617 | Open in IMG/M |
| 3300010303|Ga0134082_10385517 | Not Available | 598 | Open in IMG/M |
| 3300010364|Ga0134066_10292411 | Not Available | 581 | Open in IMG/M |
| 3300010371|Ga0134125_12959389 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 515 | Open in IMG/M |
| 3300010379|Ga0136449_101349115 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
| 3300011106|Ga0151489_1507892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 872 | Open in IMG/M |
| 3300011107|Ga0151490_1659897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1166 | Open in IMG/M |
| 3300011992|Ga0120146_1052604 | Polyangium → Polyangium aurulentum | 675 | Open in IMG/M |
| 3300011994|Ga0120157_1099714 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300012091|Ga0136625_1081179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1145 | Open in IMG/M |
| 3300012203|Ga0137399_11608065 | Polyangium → Polyangium aurulentum | 538 | Open in IMG/M |
| 3300012204|Ga0137374_10006103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 14323 | Open in IMG/M |
| 3300012204|Ga0137374_10488709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales | 958 | Open in IMG/M |
| 3300012208|Ga0137376_11421163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio harveyi group → Vibrio parahaemolyticus | 585 | Open in IMG/M |
| 3300012350|Ga0137372_10092655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2549 | Open in IMG/M |
| 3300012354|Ga0137366_10506124 | Not Available | 872 | Open in IMG/M |
| 3300012356|Ga0137371_10031384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4098 | Open in IMG/M |
| 3300012356|Ga0137371_10526901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 911 | Open in IMG/M |
| 3300012469|Ga0150984_101562536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 665 | Open in IMG/M |
| 3300012469|Ga0150984_109530754 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300012530|Ga0136635_10204368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 675 | Open in IMG/M |
| 3300012530|Ga0136635_10239303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 631 | Open in IMG/M |
| 3300012684|Ga0136614_10680843 | Not Available | 726 | Open in IMG/M |
| 3300012884|Ga0157300_1068834 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300012896|Ga0157303_10291510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. yr375 | 517 | Open in IMG/M |
| 3300012904|Ga0157282_10111136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 783 | Open in IMG/M |
| 3300012906|Ga0157295_10150144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 697 | Open in IMG/M |
| 3300012913|Ga0157298_10076722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. yr375 | 846 | Open in IMG/M |
| 3300012915|Ga0157302_10306729 | Not Available | 619 | Open in IMG/M |
| 3300012922|Ga0137394_10397063 | Polyangium → Polyangium aurulentum | 1176 | Open in IMG/M |
| 3300012931|Ga0153915_12348079 | Polyangium → Polyangium aurulentum | 624 | Open in IMG/M |
| 3300012955|Ga0164298_10248741 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
| 3300012957|Ga0164303_10489359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 784 | Open in IMG/M |
| 3300012960|Ga0164301_10024647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2761 | Open in IMG/M |
| 3300012960|Ga0164301_10107669 | All Organisms → cellular organisms → Bacteria | 1616 | Open in IMG/M |
| 3300012961|Ga0164302_10426119 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
| 3300012972|Ga0134077_10562638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 512 | Open in IMG/M |
| 3300012975|Ga0134110_10402012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 608 | Open in IMG/M |
| 3300012984|Ga0164309_10450715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 973 | Open in IMG/M |
| 3300012986|Ga0164304_10771605 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 738 | Open in IMG/M |
| 3300012988|Ga0164306_10355260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1087 | Open in IMG/M |
| 3300012988|Ga0164306_11334086 | Not Available | 607 | Open in IMG/M |
| 3300013308|Ga0157375_12051801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 680 | Open in IMG/M |
| 3300014325|Ga0163163_12079116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 628 | Open in IMG/M |
| 3300014820|Ga0120160_1025981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1192 | Open in IMG/M |
| 3300015372|Ga0132256_101127636 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
| 3300015372|Ga0132256_103390563 | Not Available | 536 | Open in IMG/M |
| 3300015373|Ga0132257_102343259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 692 | Open in IMG/M |
| 3300015374|Ga0132255_100403216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1991 | Open in IMG/M |
| 3300018028|Ga0184608_10189835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 898 | Open in IMG/M |
| 3300018028|Ga0184608_10480344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 533 | Open in IMG/M |
| 3300018032|Ga0187788_10326376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 628 | Open in IMG/M |
| 3300018032|Ga0187788_10437641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 555 | Open in IMG/M |
| 3300018067|Ga0184611_1196305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 718 | Open in IMG/M |
| 3300018072|Ga0184635_10032132 | All Organisms → cellular organisms → Bacteria | 1976 | Open in IMG/M |
| 3300018076|Ga0184609_10008782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3697 | Open in IMG/M |
| 3300018469|Ga0190270_10809196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 944 | Open in IMG/M |
| 3300019873|Ga0193700_1022236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1047 | Open in IMG/M |
| 3300019885|Ga0193747_1143019 | Not Available | 549 | Open in IMG/M |
| 3300020020|Ga0193738_1189218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 517 | Open in IMG/M |
| 3300021415|Ga0193694_1038343 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300021560|Ga0126371_12051997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 688 | Open in IMG/M |
| 3300022534|Ga0224452_1197282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 619 | Open in IMG/M |
| 3300022694|Ga0222623_10077442 | Not Available | 1290 | Open in IMG/M |
| 3300022694|Ga0222623_10263022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 665 | Open in IMG/M |
| 3300024055|Ga0247794_10059062 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1069 | Open in IMG/M |
| 3300024177|Ga0247686_1053222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 506 | Open in IMG/M |
| 3300025933|Ga0207706_10913526 | Not Available | 741 | Open in IMG/M |
| 3300025934|Ga0207686_10596736 | Not Available | 869 | Open in IMG/M |
| 3300025935|Ga0207709_11168586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 633 | Open in IMG/M |
| 3300026121|Ga0207683_11689534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 582 | Open in IMG/M |
| 3300026300|Ga0209027_1078598 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1216 | Open in IMG/M |
| 3300026301|Ga0209238_1267083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 512 | Open in IMG/M |
| 3300027727|Ga0209328_10188188 | Not Available | 624 | Open in IMG/M |
| 3300027765|Ga0209073_10206247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 749 | Open in IMG/M |
| 3300027821|Ga0209811_10441263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 505 | Open in IMG/M |
| 3300027873|Ga0209814_10243948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 779 | Open in IMG/M |
| 3300027880|Ga0209481_10053981 | Not Available | 1868 | Open in IMG/M |
| 3300028577|Ga0265318_10044040 | All Organisms → cellular organisms → Bacteria | 1690 | Open in IMG/M |
| 3300028596|Ga0247821_10678767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Jiangella | 671 | Open in IMG/M |
| 3300028597|Ga0247820_10919480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 621 | Open in IMG/M |
| 3300028716|Ga0307311_10265589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 512 | Open in IMG/M |
| 3300028716|Ga0307311_10272476 | Not Available | 506 | Open in IMG/M |
| 3300028717|Ga0307298_10005859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2971 | Open in IMG/M |
| 3300028717|Ga0307298_10094404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 847 | Open in IMG/M |
| 3300028722|Ga0307319_10064931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1152 | Open in IMG/M |
| 3300028722|Ga0307319_10213924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 632 | Open in IMG/M |
| 3300028744|Ga0307318_10079469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1099 | Open in IMG/M |
| 3300028768|Ga0307280_10037103 | Not Available | 1482 | Open in IMG/M |
| 3300028768|Ga0307280_10190998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 721 | Open in IMG/M |
| 3300028771|Ga0307320_10032591 | All Organisms → cellular organisms → Bacteria | 1900 | Open in IMG/M |
| 3300028771|Ga0307320_10107551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1063 | Open in IMG/M |
| 3300028771|Ga0307320_10455341 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300028803|Ga0307281_10153177 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300028814|Ga0307302_10025154 | All Organisms → cellular organisms → Bacteria | 2717 | Open in IMG/M |
| 3300028814|Ga0307302_10067420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1682 | Open in IMG/M |
| 3300028814|Ga0307302_10355685 | Not Available | 722 | Open in IMG/M |
| 3300028814|Ga0307302_10411212 | Not Available | 669 | Open in IMG/M |
| 3300028814|Ga0307302_10467280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 625 | Open in IMG/M |
| 3300028824|Ga0307310_10245707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 858 | Open in IMG/M |
| 3300028824|Ga0307310_10285199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 800 | Open in IMG/M |
| 3300028824|Ga0307310_10351744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 724 | Open in IMG/M |
| 3300028824|Ga0307310_10584792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 568 | Open in IMG/M |
| 3300028828|Ga0307312_10411054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 889 | Open in IMG/M |
| 3300028880|Ga0307300_10003357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4033 | Open in IMG/M |
| 3300028889|Ga0247827_10570766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 719 | Open in IMG/M |
| 3300030336|Ga0247826_10591230 | Not Available | 850 | Open in IMG/M |
| 3300031747|Ga0318502_10108500 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1546 | Open in IMG/M |
| 3300031748|Ga0318492_10153937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1161 | Open in IMG/M |
| 3300031793|Ga0318548_10110647 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1322 | Open in IMG/M |
| 3300031793|Ga0318548_10411718 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300031819|Ga0318568_10296081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1005 | Open in IMG/M |
| 3300031819|Ga0318568_10473980 | Polyangium → Polyangium aurulentum | 780 | Open in IMG/M |
| 3300031820|Ga0307473_10806681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 670 | Open in IMG/M |
| 3300031820|Ga0307473_11204840 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 563 | Open in IMG/M |
| 3300031897|Ga0318520_10051742 | All Organisms → cellular organisms → Bacteria | 2161 | Open in IMG/M |
| 3300031901|Ga0307406_10762961 | Not Available | 813 | Open in IMG/M |
| 3300031903|Ga0307407_11136991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 608 | Open in IMG/M |
| 3300031938|Ga0308175_100044697 | All Organisms → cellular organisms → Bacteria | 3786 | Open in IMG/M |
| 3300031938|Ga0308175_100825323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1016 | Open in IMG/M |
| 3300032002|Ga0307416_100739774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1075 | Open in IMG/M |
| 3300032002|Ga0307416_103235457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 545 | Open in IMG/M |
| 3300032010|Ga0318569_10414967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 628 | Open in IMG/M |
| 3300032060|Ga0318505_10476264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 589 | Open in IMG/M |
| 3300032064|Ga0318510_10291431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 678 | Open in IMG/M |
| 3300032068|Ga0318553_10435763 | Polyangium → Polyangium aurulentum | 687 | Open in IMG/M |
| 3300032089|Ga0318525_10275513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 864 | Open in IMG/M |
| 3300032782|Ga0335082_10734474 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300032828|Ga0335080_10618152 | All Organisms → cellular organisms → Bacteria | 1137 | Open in IMG/M |
| 3300032829|Ga0335070_10222099 | All Organisms → cellular organisms → Bacteria | 1868 | Open in IMG/M |
| 3300032954|Ga0335083_10310659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1381 | Open in IMG/M |
| 3300033550|Ga0247829_11732305 | Not Available | 515 | Open in IMG/M |
| 3300033551|Ga0247830_11595390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 522 | Open in IMG/M |
| 3300034354|Ga0364943_0306181 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 602 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 21.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.40% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.42% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 4.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.43% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.45% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.46% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.46% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.46% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.97% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.97% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.97% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.97% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.97% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.97% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.48% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.99% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.99% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.99% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.99% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.99% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.99% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.99% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.99% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.49% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.49% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.49% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.49% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.49% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.49% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.49% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.49% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.49% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.49% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.49% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.49% |
| Environmental → Unclassified → Unclassified → Unclassified → Unclassified → | 0.49% | |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.49% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.49% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.49% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.49% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.49% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.49% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.49% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.49% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.49% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2032320003 | Soil microbial communities from sample at FACE Site 4 Nevada Test Site Crust CO2- | Environmental | Open in IMG/M |
| 2124908016 | Sample 642 | Environmental | Open in IMG/M |
| 2124908039 | Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Bog Site B4 | Environmental | Open in IMG/M |
| 2140918024 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_all | Environmental | Open in IMG/M |
| 2189573002 | Grass soil microbial communities from Rothamsted Park, UK - FE1 (NaCl 30g/L 5ml) | Environmental | Open in IMG/M |
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300001535 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006048 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009649 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-059 | Environmental | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011106 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011107 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300011992 | Permafrost microbial communities from Nunavut, Canada - A23_65cm_12M | Environmental | Open in IMG/M |
| 3300011994 | Permafrost microbial communities from Nunavut, Canada - A7_65cm_12M | Environmental | Open in IMG/M |
| 3300012091 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ483 (23.06) | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012530 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ85 (21.06) | Environmental | Open in IMG/M |
| 3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
| 3300012884 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 | Environmental | Open in IMG/M |
| 3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
| 3300012904 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1 | Environmental | Open in IMG/M |
| 3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
| 3300012913 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2 | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014820 | Permafrost microbial communities from Nunavut, Canada - A15_80cm_0.25M | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300019873 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s1 | Environmental | Open in IMG/M |
| 3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
| 3300020020 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1 | Environmental | Open in IMG/M |
| 3300021415 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s1 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
| 3300024177 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK27 | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Host-Associated | Open in IMG/M |
| 3300028596 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14 | Environmental | Open in IMG/M |
| 3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FACENCTA_4900060 | 2032320003 | Soil | ALSGLNARTYGAPGLEEDIRFCAREDVLDVVPRLARVEGGAAEIVA |
| OU_02049010 | 2124908016 | YGPPGLEEDIAWCSQVSVLDIVPRFTRMLGSVAEVTR | |
| B3_v_00963200 | 2124908039 | Soil | YGPPGLEADIEFCAQVDLLDTVPRFSRMIGTAAEIRSES |
| B_all_v_01773750 | 2140918024 | Soil | GPPGLEADIEFCAQVDLLDTVPRFSRMIGTAAEIRSES |
| FE1_01765950 | 2189573002 | Grass Soil | VPLDGLNARTYGPSGLEEDIAYCAQEDLLTAVPEVTEATGVAAEIMLR |
| INPgaii200_09658651 | 2228664022 | Soil | ALDGLEARTYGPPGLEEDIAYCAQEDRLDVVPVLTGMEGAAAEIMLR |
| ICChiseqgaiiFebDRAFT_107104682 | 3300000363 | Soil | RTYGPPGLEDDIAFCARENALDVVPRLTGRVGPAVEIGLG* |
| JGI10214J12806_100567151 | 3300000891 | Soil | RTYGPPGLEEDIAFCARESVLDVVPRLVGAVGGAAEIMLR* |
| JGI11615J12901_129218641 | 3300000953 | Soil | ARTYGPPGLEEDIAFCAQVNVLEVVPRLARMLDGAAEITLEARTAR* |
| A3PFW1_102686791 | 3300001535 | Permafrost | AYEALNARTYGPAGLEEDILFCSRESVLPVVPRFAGMAGAAAEIGP* |
| Ga0063455_1004834281 | 3300004153 | Soil | RTYGPPGLEADVEYCARENILQTVPRFARMVGAAAEITA* |
| Ga0063356_1054821391 | 3300004463 | Arabidopsis Thaliana Rhizosphere | YGPPGLEEDIAFCSQVSVLETVPHLVGLVGPAAEIRASS* |
| Ga0062592_1016675311 | 3300004480 | Soil | EALLARTYGPPGLEEDILFCSRESVLPVVPRFARMTGPAAEILS* |
| Ga0062594_1024583791 | 3300005093 | Soil | PNALDGLNARTYGPPGLEDDLVFCARESVLEAVPRFAGMRGPAAEITLSPR* |
| Ga0066688_110195202 | 3300005178 | Soil | LNARTYGPPGLEDDIAFCARESVLDVVPQLVGRIGPAAEIALA* |
| Ga0070683_1011675472 | 3300005329 | Corn Rhizosphere | LNARTYGPPGLEDDLVFCARESVLEAVPRFAGMRGPAAEITLSPR* |
| Ga0066388_1083018002 | 3300005332 | Tropical Forest Soil | ARTYGPPGLEEDIAWCSQVSVLDVVPRLSRMLDRVAEVTL* |
| Ga0070692_106738423 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | ARTYGPPGLEEDIAFCAQVGVLDIVPRLRRMVDGAAEITTD* |
| Ga0070692_107187762 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | DPLDGINARTYGPPGLEEDIAFCARASVLEVVPRLVGMRGPAAEITL* |
| Ga0070688_1010965411 | 3300005365 | Switchgrass Rhizosphere | TALLARTYGPPGLEEDILFCSRESVLPVVPRLAAVTDGAAEIVA* |
| Ga0070711_1014951122 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | IDGINARTYGPPGLEEDIAWCSQVSVLDVVPRFTRMLESAAEVTL* |
| Ga0070662_1013182152 | 3300005457 | Corn Rhizosphere | ARTYGPPGLEQDIAWVSQDNLLDVVPRLSRMVDGAAEIVA* |
| Ga0070706_1020775191 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | RTYGPPGLEEDILFCSRESVLPVVPRLSGMVGVAAEIVP* |
| Ga0070695_1012580112 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | RTYGPPGLEEDIAFCARENVLEVVPRLAGMVGSAAEITIS* |
| Ga0066701_103158001 | 3300005552 | Soil | GPPGLEADIEFCSHESAIDVVPRFRRMVGSAAEITQ* |
| Ga0066695_101177594 | 3300005553 | Soil | INARTYGPPGLEDDIAWCSQVDTLDVVPRFSRMAGAAAEVTL* |
| Ga0066707_103333242 | 3300005556 | Soil | ARTYGPPGLEDDIAFCAREDVLDVVPRLAGMHGTAAEIRA* |
| Ga0066698_104236442 | 3300005558 | Soil | YGPPGLEADIEFCAQENLLETVPRFAQMAGPAAEIVA* |
| Ga0066703_104362941 | 3300005568 | Soil | SAGLNARTYGPPGLEEDIAFCAREDVLDAVPRVVGMHGTAAEISL* |
| Ga0066708_101136171 | 3300005576 | Soil | AAAGLNARTYGPPGLEEDIAFCAREDALDVVPRLSVMVGTAAEIRV* |
| Ga0066654_107348681 | 3300005587 | Soil | LNARTYGPPGLEADIEFCSRENTLDTVPRFGRMVGRAAEIVA* |
| Ga0066706_109332442 | 3300005598 | Soil | YGPPGLEEDIAFCAQVSVLDVVPRLARMIDGAAEITS* |
| Ga0068852_1028002762 | 3300005616 | Corn Rhizosphere | YGPPGLEEDILFCSRESVLPVVPRFARMTGPAAEIVA* |
| Ga0066903_1038738681 | 3300005764 | Tropical Forest Soil | RTYGPPGLEADIAYCARENLLETVPRFARMHGSAAEITVLSG* |
| Ga0066903_1085097142 | 3300005764 | Tropical Forest Soil | LAGLTARTYGPPGLEEDIAFCSQVSVLDTVPRLVGLVGPAADIRAS* |
| Ga0081455_107245753 | 3300005937 | Tabebuia Heterophylla Rhizosphere | YADPVDGINARTYGPPGLEEDIAFVARVNALDVVPRLTGMVGGAAEIAL* |
| Ga0066651_106139252 | 3300006031 | Soil | TYGPPGLEDDIAWCSQVDTLDVVPRFSQMVGAAVEITL* |
| Ga0066696_110422772 | 3300006032 | Soil | TYGPPGLEEDIAFCVRESLLDVVPRVARVLPRAVEITG* |
| Ga0066652_1016033471 | 3300006046 | Soil | NARTYGPPGLEADIEWCARESVLDVVPRLAGVADSAAEIVG* |
| Ga0075363_1004076802 | 3300006048 | Populus Endosphere | ARTYGPAGLEEDIAFCARESVLDVVPHLVGAVGGAAEIMLR* |
| Ga0075417_102631031 | 3300006049 | Populus Rhizosphere | PAGLEEDIAYCAQEDRLDVVPELTGMEGAAAEIMLR* |
| Ga0074054_121223231 | 3300006579 | Soil | YGPPGLEEDITFCAQVSVLDVVPRLGRMVDGAAEITAR* |
| Ga0079222_116570733 | 3300006755 | Agricultural Soil | RTYGPPGLEADIEFCAQVDALRTVPRFARLVGPAAEIVA* |
| Ga0066659_113519061 | 3300006797 | Soil | TYGPPGLEADIEFCAQVDVLDAVPRLAGMIGGAAEIRLA* |
| Ga0075431_1004601132 | 3300006847 | Populus Rhizosphere | AFPQSIDGINARTYGPPGLEEDIAWVSQDNLLEVIPRFTRMVDGAAEIVASDGASPRT* |
| Ga0075433_109136453 | 3300006852 | Populus Rhizosphere | LLARTYGPPGLEEDILFCSRESVLPVVPRLAAVTDGAAEIVA* |
| Ga0068865_1005278743 | 3300006881 | Miscanthus Rhizosphere | LARTYGPPGLEEDIAFCAQVSALEVVPRLSRMVDGSAEITAR* |
| Ga0075436_1011392081 | 3300006914 | Populus Rhizosphere | RTYGPPGLEEDIAFCAQVSALEVVPRLSRMVDGSAEITAR* |
| Ga0066710_1024213982 | 3300009012 | Grasslands Soil | FPDAVAGLNARTYGPPGLEEDIAFCAREDVLDVVPRLAGMVGTAAEIRR |
| Ga0099830_110793552 | 3300009088 | Vadose Zone Soil | GPPGLEEDIAFCARENALAVVPRLAGMVGPAAEITAS* |
| Ga0111539_122211331 | 3300009094 | Populus Rhizosphere | PQSIDGINARTYGPPGLEEDIAWVSQDNLLEVIPRFTRMVDGAAEIVASDGASPRT* |
| Ga0105245_100474871 | 3300009098 | Miscanthus Rhizosphere | DAHDGLLARTYGPPGLEEDIAFCAQVGVLDIVPRLRRMVDGAAEITTD* |
| Ga0066709_1025514042 | 3300009137 | Grasslands Soil | HEGLLARTYGPPGLEEDIAFCAQVGILDVLPRLSRMVDGSAEITRGET* |
| Ga0105243_118105193 | 3300009148 | Miscanthus Rhizosphere | DPVDGINARTYGPPGLEDDLAFVARVDVLDVVPRLTGMVAGAAEIRA* |
| Ga0105855_11969841 | 3300009649 | Permafrost Soil | PPGLEADIEFCAQVDLLDTVPRFTRMIGSAAEIVA* |
| Ga0126307_107590911 | 3300009789 | Serpentine Soil | DGIMARTYGPTGLEADIEFCSQENTIDVVPRFSRMVDGAAEIVG* |
| Ga0126307_108265561 | 3300009789 | Serpentine Soil | INARTYGPPGLEADIEWCSQVDTVTTVPRFSRMVGPAAEIVSS* |
| Ga0126374_101955871 | 3300009792 | Tropical Forest Soil | INARTYGPPGLEEDIAFVAQVSLLDVVPRFSRMVGPAAEVIL* |
| Ga0126313_108397942 | 3300009840 | Serpentine Soil | AGAFPEAIDGIKARTYGPPGLEDDIAWVSQVDLLDVVPRFTGVVEGAAEIRL* |
| Ga0126305_101774812 | 3300010036 | Serpentine Soil | GPPGLEADVEFCARESVLEAVPRFAGMRGPAAEIVV* |
| Ga0126305_103516691 | 3300010036 | Serpentine Soil | TAWDGIMARTYGPTGLEADIEFCSQENTIDVVPRFSRMVDGAAEIVG* |
| Ga0126305_106176112 | 3300010036 | Serpentine Soil | YGPPGLEEDIAWVAQDNLLDVVPRLSRMVDGAAEIVA* |
| Ga0126304_102256913 | 3300010037 | Serpentine Soil | PRSIDGINARTYGPPGLEEDIAWVAQDNLLDVVPRLSRMVDGAAEIVA* |
| Ga0126315_107983462 | 3300010038 | Serpentine Soil | YGPPGLEADIEFCARVDALDVVPRFSRLVGTAAEIIL* |
| Ga0126380_122423681 | 3300010043 | Tropical Forest Soil | TYGPPGLEEDIAFCAQVSVLDVVPRLDRMVDGSAEIAAR* |
| Ga0126311_111101981 | 3300010045 | Serpentine Soil | YPEALEGLNARTYGPPGLEADIRFCARVDALDVVPRFSRLVGTAAEIVP* |
| Ga0126384_120359781 | 3300010046 | Tropical Forest Soil | DAHDGLLARTYGPPGLEEDIAFCAQVSVLDVVPRLDRMVDGSAEIAAR* |
| Ga0126382_115199311 | 3300010047 | Tropical Forest Soil | GLLARTYGPPGLEEDIAFCAQVSVLEVVPRLDRMVDGSAEIAAR* |
| Ga0134082_103855172 | 3300010303 | Grasslands Soil | RFPDPVDGINARTYGPPGLEEDIAWVAQVDLLDVVPRFAGMMGPAAEVSL* |
| Ga0134066_102924112 | 3300010364 | Grasslands Soil | VEGINARTYGPPGLEEDIAWVAQVDLLDVVPRFAGMMGPAAEVSL* |
| Ga0134125_129593891 | 3300010371 | Terrestrial Soil | LRARRYGPPGLEADVEYCSRENLLPTVPRLARMVGPAAEIVA* |
| Ga0136449_1013491152 | 3300010379 | Peatlands Soil | YGPPGLEADVEFCARVNMLETVPRYSRMIGPAAEIVA* |
| Ga0151489_15078922 | 3300011106 | Soil | EAFNARTYGPPGLEEDIAFCARENVLDVVPRLVGMVGSAAEIRDS* |
| Ga0151490_16598972 | 3300011107 | Soil | FNARTYGPPGLEEDIAFCARENVLDVVPRLVGMVGSAAEIRDS* |
| Ga0120146_10526041 | 3300011992 | Permafrost | ALEGLNARTYGPPGLEADIEFCAQVDLLDTVPRFARMVGSAAEIVA* |
| Ga0120157_10997141 | 3300011994 | Permafrost | YGPPGLEEDIAWVSQVDLLDVVPRFTRLIDGAAEIRL* |
| Ga0136625_10811793 | 3300012091 | Polar Desert Sand | DARAGLTARSYGPPGLEEDIAWCARENALVVVPRLGGMEGSAAEIVVS* |
| Ga0137399_116080652 | 3300012203 | Vadose Zone Soil | ARTYGPPGLEAEFEFCAQRDLLDVAPHLSRMIGTTAEIRREQ* |
| Ga0137374_100061031 | 3300012204 | Vadose Zone Soil | LNARTYGPPGLEDDIAFCSRESVLDVVPRLVGMVGVRPRK* |
| Ga0137374_104887092 | 3300012204 | Vadose Zone Soil | DGINARTYGPPGLEEDIAWCSRESVLTVVPRFSGMVGTAAEILA* |
| Ga0137374_111659831 | 3300012204 | Vadose Zone Soil | GLEEDIAFCAQISVLHVVPRLSRMVDGAAEITAR* |
| Ga0137376_114211632 | 3300012208 | Vadose Zone Soil | TARTYGPPGLDEDIRFCARDSVLDVVPCFVGMEGPAAAIRTVS* |
| Ga0137372_100926555 | 3300012350 | Vadose Zone Soil | NARTYGPSSLEADIEYCAQVDMLETVQRFARVVASDGEIVA* |
| Ga0137366_105061241 | 3300012354 | Vadose Zone Soil | RRSGLDADIAYCARVSTLDVVGRFSRMVGTAAEVVAA* |
| Ga0137371_100313841 | 3300012356 | Vadose Zone Soil | ARTYGPPGLEDDIAWCSQVDTLDVVPRFSRMAGAAAEVTL* |
| Ga0137371_105269011 | 3300012356 | Vadose Zone Soil | ARTYGPPGLEDDIAWCSQVDVLDVVPRFSQMVGAAAEVTL* |
| Ga0150984_1015625361 | 3300012469 | Avena Fatua Rhizosphere | EGLNARTCGPPGLEADIEFCSRENTLDTVPRFGRMVGRAAEISA* |
| Ga0150984_1095307541 | 3300012469 | Avena Fatua Rhizosphere | PGLEEDIRFCAQVDLLATVPRFSRMVGAAAEIVA* |
| Ga0136635_102043682 | 3300012530 | Polar Desert Sand | LNARAYGPPGLEEDIKFCVQEHTIDVVPRFSRMIAGAAEIFGACDPRE |
| Ga0136635_102393031 | 3300012530 | Polar Desert Sand | LSALDGQLARTHGPPGLEEDIKFCVQEHTIDVVPRFSRMIAGAAEIFGACDPRE |
| Ga0136614_106808431 | 3300012684 | Polar Desert Sand | ARTYGPPGLEEDIAFCARESVLAVVPRFVGMQGNAAEIGL* |
| Ga0157300_10688342 | 3300012884 | Soil | NARTYGPPGLEEDIEFCARANVLDVVPRLAGMVEGAAEITL* |
| Ga0157303_102915101 | 3300012896 | Soil | INARTYGPPGLEQDIAWVSQDNLLDVVPRLSRMVDGAAEIVA* |
| Ga0157282_101111361 | 3300012904 | Soil | LNARTYGPPGLEDDLVFCARESVLEAVPRFAGMRGPAAEIVL* |
| Ga0157295_101501441 | 3300012906 | Soil | LARTYGPPGLEDDIAFCAQVSVLDVVPRLSRMVDGAAEITLEARTAR* |
| Ga0157298_100767221 | 3300012913 | Soil | SIDGINARTYGPPGLEQDIAWVSQDNLLDVVPRLSHMVDGAAEIVA* |
| Ga0157302_103067291 | 3300012915 | Soil | YGPPGLEEDIAWCAQVSLHDIVPHFSRMVGPAAEVVL* |
| Ga0137394_103970634 | 3300012922 | Vadose Zone Soil | EGLNARTYGPPGLEADIEFCAQVDLLDVAPVLSRMIGTAAEIRRER* |
| Ga0153915_123480791 | 3300012931 | Freshwater Wetlands | RTYGPPGLEWDIEFCAQVDLLETVPRFARMVGPAAEIVATTDARTEE* |
| Ga0164298_102487411 | 3300012955 | Soil | PGLEADVEFCAQVDTLTTVPRFSRMVGAAAEIVDGGGPT* |
| Ga0164303_104893591 | 3300012957 | Soil | DAHDGLLARTYGPPGLEEDIAFCAQVGVLDVVPRLGRMVDGSAEITAR* |
| Ga0164301_100246471 | 3300012960 | Soil | LDAFNARTYGPSGLEQDIAICARVNLLDVVPRLVGMVGPAAEIRDS* |
| Ga0164301_101076691 | 3300012960 | Soil | EALLARTYGPPGLEEDILFCSRESVLPVVPRFARMTGPAAEIVP* |
| Ga0164302_104261191 | 3300012961 | Soil | ARTYGPPGLEADVEFCAQVDLLGTVPRLARMVGNAAEIVA* |
| Ga0134077_105626381 | 3300012972 | Grasslands Soil | HEGLLARTYGPPGLEDDIAFCAQVSALDAVPRLSRMVDGSAEITTR* |
| Ga0134110_104020122 | 3300012975 | Grasslands Soil | FPSALAGLNARTYGPPGLEADIEFCAQENLLETVPRFAQMAGPAAEIVA* |
| Ga0164309_104507151 | 3300012984 | Soil | TYGPPGLEADIEFCAQVDLLQTVPRFSRMVGRAAEIVA* |
| Ga0164304_107716053 | 3300012986 | Soil | LLARTYGPPGLEEDIAFCAQVGVLDVVPRLGRMVDGSAEITAR* |
| Ga0164306_103552601 | 3300012988 | Soil | ARTYGPPGLEADIEFCAQVDLLDNVPRFSRMVGNAAEIVA* |
| Ga0164306_113340861 | 3300012988 | Soil | GLLARTYGPPGLEEDIAFCAQVSVLDVVPRLSRMVDGSAEIAAR* |
| Ga0157375_120518011 | 3300013308 | Miscanthus Rhizosphere | NSLDGLNARTYGPPGLEEDIAFCARENVLDTAPRVTGRVGPAVEIGLG* |
| Ga0163163_120791162 | 3300014325 | Switchgrass Rhizosphere | ALLARTYGPPGLEEDILFCSRESVLPVVPRLAGVDDGAAEIVA* |
| Ga0120160_10259811 | 3300014820 | Permafrost | GLEADIEFCAQVDLLDVAPVLSRMIGKAAEIRRQP* |
| Ga0132256_1011276361 | 3300015372 | Arabidopsis Rhizosphere | ARTYGPPGLEAEVEFCAQVDLLQTVPRLARMVGNAAEIVA* |
| Ga0132256_1033905632 | 3300015372 | Arabidopsis Rhizosphere | PHSVDGINARTYGPPGLEEDIAWVSQDNLLNVVPRLSRMVDGAAEIVA* |
| Ga0132257_1023432591 | 3300015373 | Arabidopsis Rhizosphere | IDGLNARTYGPSGLEEDIAFCARENVLDVVPRVTGRVGPALEIGLG* |
| Ga0132255_1004032161 | 3300015374 | Arabidopsis Rhizosphere | IDGLNARTYGPPGLEEDIAFCARENVLDVVPRVTGRVGPALEIGLG* |
| Ga0184608_101898353 | 3300018028 | Groundwater Sediment | GPPGLEDDIAFCAQVSVLDVVPRLSRMVDGSAEITAR |
| Ga0184608_104803441 | 3300018028 | Groundwater Sediment | EALLARTYGPPGLEKDIAFCAQVDVLDVVPRFERMHGRAAEITKL |
| Ga0187788_103263761 | 3300018032 | Tropical Peatland | RTYGPPGLEDDIAYCAQVDLLDVVPELTGVEGPAAEIVRR |
| Ga0187788_104376411 | 3300018032 | Tropical Peatland | RTYGPPGLEADIEYCAREDALRTVPRFARLHGPAAEVVA |
| Ga0184611_11963053 | 3300018067 | Groundwater Sediment | DAHEGLLARTYGPPGLEEDIAFCAQVSVLDVVPRLSRMIDGSAEITAR |
| Ga0184635_100321321 | 3300018072 | Groundwater Sediment | EALLARTYGPPGLEKDIAFCAQVDVLDVVPRFERMHGRAAEISS |
| Ga0184609_100087825 | 3300018076 | Groundwater Sediment | RTYGPPGLEEDIRFCARESVLDVVPRFAGMHEAAAEIRSAS |
| Ga0190270_108091962 | 3300018469 | Soil | ARTYGPPGLEADIEFCSQEDTIDAVPRFSRMVDGAAEIVAS |
| Ga0193700_10222361 | 3300019873 | Soil | PGLEEDIAFCAQVSVLDVVPRLSRMVDGSAEITAR |
| Ga0193747_11430192 | 3300019885 | Soil | TYGPPGLDEDIRFCAQESILDVVPRFSGMVGSAAEITL |
| Ga0193738_11892181 | 3300020020 | Soil | GPPGLEEDIKFCAQENTIDVVPRFSRMADGAAEIVR |
| Ga0193694_10383431 | 3300021415 | Soil | GLNARTYGPPGLEADVEFCAQVDVLHTVPRLARMVGNAAEIVA |
| Ga0126371_120519971 | 3300021560 | Tropical Forest Soil | DGLNARTYGPPGLEADIAFCAQVDLLDVVPRFSQMVGRAAEITAA |
| Ga0224452_11972822 | 3300022534 | Groundwater Sediment | PPGLEEDIAFCAQVSVLDVVPRLNRMVDGGAEITA |
| Ga0222623_100774424 | 3300022694 | Groundwater Sediment | ARTYGPPGLEDDIAFCAQVSVLDVVPRLSRMVDGSAEITAR |
| Ga0222623_102630221 | 3300022694 | Groundwater Sediment | ARTYGPPGLEEDIAFCARESVLTAVPRFAGMRGAAAEVVL |
| Ga0247794_100590623 | 3300024055 | Soil | GINARTYGPPGLEEDIAWCSQVSVLDVVPRLSQMRGAVAEVTGG |
| Ga0247686_10532222 | 3300024177 | Soil | TYGPPGLEEDIAFCSQVVVLDVVPRFSRMVGPAAEIVL |
| Ga0207706_109135261 | 3300025933 | Corn Rhizosphere | DAHSGLTARTYGPPGLEEDILFCSRESVLPVVPRLAAVTDGAAEIVA |
| Ga0207686_105967362 | 3300025934 | Miscanthus Rhizosphere | SGLTARTYGPPGLEEDIRFCARESVLDAVPRFAGMHETAAEIRLA |
| Ga0207709_111685861 | 3300025935 | Miscanthus Rhizosphere | DPVDGINARTYGPPGLEDDLAFVARVDVLDVVPRLTGMVAGAAEIRA |
| Ga0207683_116895342 | 3300026121 | Miscanthus Rhizosphere | LEALNARTYGPPGLEEDIAFCARENVLDVVPRLAGMVGTAAEIRI |
| Ga0209027_10785981 | 3300026300 | Grasslands Soil | PNAIDGLNARTYGPPGLEADIEWCARESVLDVVPRLAGVVDAEETAVW |
| Ga0209238_12670832 | 3300026301 | Grasslands Soil | PPGLEADIEFCAQENLLETVPRFTQMIGSAAEIVA |
| Ga0209328_101881882 | 3300027727 | Forest Soil | PGLEDDLRWCTQENTLDVVPRFSRLVGAAAEIVAEGSPHSAK |
| Ga0209073_102062472 | 3300027765 | Agricultural Soil | TYGPPGLEGDIAFCAQEDLLDVVPRLTGGVGAAARIEL |
| Ga0209811_104412631 | 3300027821 | Surface Soil | RTYGPPGLEDDIAYCAQDDLLDVVPELTGAEGAAAEIMLT |
| Ga0209814_102439481 | 3300027873 | Populus Rhizosphere | YGPAGLEEDIAYCAQEDRLDVVPELTGMEGAAAEIMLR |
| Ga0209481_100539811 | 3300027880 | Populus Rhizosphere | TYGPPGLDADIEFCSQENTIDVVPRFSRMVESAAEIVR |
| Ga0265318_100440401 | 3300028577 | Rhizosphere | YGPPGLEADIAFCAQVDLLDVVPRFSRMVGPAAEITA |
| Ga0247821_106787672 | 3300028596 | Soil | AGLSARTYGPPGLEEDIRFCARESVLEVVPRFVGTEGPAAVVTA |
| Ga0247820_109194803 | 3300028597 | Soil | AYPDPVDGINARTYGPPGLEEDIAFVARVNVLDVVPRLTGMVAGAAEIRA |
| Ga0307311_102655891 | 3300028716 | Soil | LLARTYGPPGLEEDIAFCAQVSVLDVVPRLNRMVDGGAEITA |
| Ga0307311_102724761 | 3300028716 | Soil | GLLARTYGPPGLEDDIAFCAQVSVLDVVPRLSRMVDGSAEITAR |
| Ga0307298_100058595 | 3300028717 | Soil | GLLARTYGPPGLEDDIAFCAQVSVLDVVPRLSRMVDGSAEIMAR |
| Ga0307298_100944041 | 3300028717 | Soil | PDPHEGLLARTYGPPGLEEDIAFCAQVSVLDVVPRLNRMVDGGAEITA |
| Ga0307319_100649311 | 3300028722 | Soil | ARTYGPPGLEEDIAFCAQVDLLDVVPRFERMHGRAAEISS |
| Ga0307319_102139241 | 3300028722 | Soil | EGLNARTYGPAGLEEDIAFCARESVVDAVPRLVGMVGLAAEIALA |
| Ga0307318_100794692 | 3300028744 | Soil | FPTALDGLNARTYGPPGLEQDIAYCAQEDLLDVVPQLTEATGAAAEIMRR |
| Ga0307280_100371031 | 3300028768 | Soil | RTYGPPGLQEDIAWCGRESVLEVVPRFVRMAGRAAEVTL |
| Ga0307280_101909981 | 3300028768 | Soil | IDGINARTYGPPGLEEDIAWCSQVSVLDVVPRFSRMLGSVAEVTR |
| Ga0307320_100325911 | 3300028771 | Soil | YGPPGLEDDIRFCAQENVVDVVPRLNRMVDSAAEIVVGEVSA |
| Ga0307320_101075511 | 3300028771 | Soil | LARTYGPPGLEDDIAFCAQVSVLDVVPTLSQMVDGAAEITTG |
| Ga0307320_104553411 | 3300028771 | Soil | EALNARTYGPPGLEEDILFCSRESVLPVVPRFAGMAGVAAEIVP |
| Ga0307281_101531771 | 3300028803 | Soil | PSALDGLNARTYGPPGLEEDIAFCARESVLTAVPRFAGMQGAAAEVVV |
| Ga0307302_100251545 | 3300028814 | Soil | LARTYGPPGLEEDIAFCAQVDLLDVVPRFERMHGRAAEISS |
| Ga0307302_100674201 | 3300028814 | Soil | GPPGLEEDIAWCSQENLLNVVPRLSRMFGAAAEITL |
| Ga0307302_103556851 | 3300028814 | Soil | LARTYGPPGLEEDIRFCAQENTIAVVPRFTRMVDSAAEITL |
| Ga0307302_104112123 | 3300028814 | Soil | PPGLEEDILFCSRESVLPVVPRLAGVEDGAAEIVA |
| Ga0307302_104672802 | 3300028814 | Soil | PDSHEALLARTYGPPGLEEDIAFCAQVDLLDVVPRFERMHGRAAEITRREGT |
| Ga0307310_102457071 | 3300028824 | Soil | GLNARTYGPPGLEADIEFCAQVDLLDTVPRFSRMVGNAAEIVA |
| Ga0307310_102851991 | 3300028824 | Soil | NALDGLNARTYGPPGLEEDIAYCAQEDLLGAVPRLTGTVGAAAEIMLR |
| Ga0307310_103517441 | 3300028824 | Soil | GPPGLEDDIAFCAQVSVLDVVPRLSRMVDGSAEIMAR |
| Ga0307310_105847922 | 3300028824 | Soil | LARTYGPPGLEEDIAFCAQVSVLDVVPRLNRMVDGGAEITA |
| Ga0307312_104110542 | 3300028828 | Soil | LNARTYGPSGLEDDIAYCAQEDLLDVVPRLTGMVGAAAEIMLR |
| Ga0307300_100033571 | 3300028880 | Soil | EALLARTYGPPGLEEDIRFCAQEDTVDVVPRLNRMVDSAAEIVAG |
| Ga0247827_105611562 | 3300028889 | Soil | YGPPGLEEDIAFCAREGVLEVVPRLAGMRGPAAEITL |
| Ga0247827_105707662 | 3300028889 | Soil | TYGPPGLEEDIAWCAQESLLDVVPRFTRMVDAAAEIVA |
| Ga0247826_105912301 | 3300030336 | Soil | YGPPGLEEDILFCSRESVLPVVPRLAGVTDGAAEIVA |
| Ga0318502_101085001 | 3300031747 | Soil | RTYGPPGLEADIEYCAQVDLLATVPRFERMVGDAAEIVA |
| Ga0318492_101539374 | 3300031748 | Soil | LNARTYGPPGLEADIEYCAQVDLLATVPRFERMVGDAAEIVA |
| Ga0318548_101106471 | 3300031793 | Soil | LARTYGPPGLEADIAYCAQVDLLDTVPRFARMVGPAAEIVA |
| Ga0318548_104117181 | 3300031793 | Soil | LAGLNARAYGPPGLEADIEYCAQVDLLATVPRFERMVGDAAEIVA |
| Ga0318568_102960811 | 3300031819 | Soil | AFEARTYGPPGLEADIAYCARENLLETVPRFARMHGPAAEITVLSG |
| Ga0318568_104739803 | 3300031819 | Soil | TYGPPGLEADIAYCAQVDLLDTVPRFARMVGPAAEIVA |
| Ga0307473_108066812 | 3300031820 | Hardwood Forest Soil | TYGPPGLEEDIAFCAREDVLDVVPRLSGKIGAAAEITAVRAADRSPPP |
| Ga0307473_112048401 | 3300031820 | Hardwood Forest Soil | LEARTYGPPGLEEDIAYCAQEDRLDVVPVLTGVEGAAAEIMLR |
| Ga0318520_100517421 | 3300031897 | Soil | PGLEADIEFCAQIDLLDVGPRYARMVGPAAEIVKGASE |
| Ga0307406_107629612 | 3300031901 | Rhizosphere | NARTYGPPGLEEDVAWCSQVGVLDVVPRFSGMVGPAAEIVRAA |
| Ga0307407_111369911 | 3300031903 | Rhizosphere | PLAGLNARTYGPPGLEADIEFCARVDALEVVPRFSRLVGTAAEIVAAAL |
| Ga0308175_1000446976 | 3300031938 | Soil | NAIDGINARTYGPPGLEEDIAFCAQESVLEVVPRFSRMIGPAAEVVA |
| Ga0308175_1008253231 | 3300031938 | Soil | TVRAFPHALDAFNARTYGPPGLEEDIAYCAQEDLLDVVPRLTTTVGTAAEIEV |
| Ga0307416_1007397741 | 3300032002 | Rhizosphere | PGLEADIEFCARVDALEVVPRFSRLVGTAAEIVAAAL |
| Ga0307416_1032354571 | 3300032002 | Rhizosphere | GPPGLEEDIAFCAQVGILDVVPRLSRMVDGAAEVSS |
| Ga0318569_104149672 | 3300032010 | Soil | LEAFEARTYGPPGLEADIAYCARENLLETVPRFARMHGPAAEITVLSG |
| Ga0318505_104762642 | 3300032060 | Soil | RTYGPPGLEADLAFCAQVDLLDVVPRFSQMVGPAAEITAA |
| Ga0318510_102914312 | 3300032064 | Soil | TYGPPGLEADIAWCTQENLLVTVPRFVRMDGPAAEIRA |
| Ga0318553_104357632 | 3300032068 | Soil | AFVRVGPPGLEADIAYCAQVDLLDTVPRFARMVGPAAEIVA |
| Ga0318525_102755133 | 3300032089 | Soil | YGPPGLEADIAYCAQVDLLDTVPRFARMVGPAAEIVA |
| Ga0335082_107344742 | 3300032782 | Soil | LNARTYGPPGLEEDILFCSRESVVAVVPRLSRMVDVAAELVG |
| Ga0335080_106181523 | 3300032828 | Soil | DPVDGINARTYGPPGLEDDIAWVAQVDLLDVVPRFARMVGAAAEVAL |
| Ga0335070_102220991 | 3300032829 | Soil | DPLAGLNARTYGPPGLEADIEFCAQVDLLDAVPRFARMVGSAAEIVA |
| Ga0335083_103106591 | 3300032954 | Soil | GLNARTYGPPGLEADIEHCAQVDLLATVPRFARMVRRAAEIVA |
| Ga0247829_117323052 | 3300033550 | Soil | GPPGLEEDILFCSRESVLPVVPRLAGVTDGAAEIVA |
| Ga0247830_115953902 | 3300033551 | Soil | TYGPPGLEEDLAFCARESVLETVPRFAGMRGPAAEITL |
| Ga0364943_0306181_3_131 | 3300034354 | Sediment | LNARTYGPPGLEEDIAFCARESVLEAVPRFAGMQGDAAEIVL |
| ⦗Top⦘ |