| Basic Information | |
|---|---|
| Family ID | F025088 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 203 |
| Average Sequence Length | 37 residues |
| Representative Sequence | MICPVEIASDMSALRAARVGDHAKHGLLPEGRDGAGNE |
| Number of Associated Samples | 173 |
| Number of Associated Scaffolds | 203 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 29.70 % |
| % of genes near scaffold ends (potentially truncated) | 98.52 % |
| % of genes from short scaffolds (< 2000 bps) | 74.38 % |
| Associated GOLD sequencing projects | 166 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (73.399 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (13.301 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.167 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.695 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.33% β-sheet: 0.00% Coil/Unstructured: 66.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 203 Family Scaffolds |
|---|---|---|
| PF00069 | Pkinase | 1.97 |
| PF13620 | CarboxypepD_reg | 1.97 |
| PF01740 | STAS | 1.48 |
| PF12728 | HTH_17 | 1.48 |
| PF07883 | Cupin_2 | 0.99 |
| PF00990 | GGDEF | 0.99 |
| PF04226 | Transgly_assoc | 0.99 |
| PF09286 | Pro-kuma_activ | 0.99 |
| PF01408 | GFO_IDH_MocA | 0.99 |
| PF00440 | TetR_N | 0.99 |
| PF07228 | SpoIIE | 0.99 |
| PF00762 | Ferrochelatase | 0.99 |
| PF01850 | PIN | 0.99 |
| PF14559 | TPR_19 | 0.99 |
| PF00294 | PfkB | 0.49 |
| PF13485 | Peptidase_MA_2 | 0.49 |
| PF01380 | SIS | 0.49 |
| PF00326 | Peptidase_S9 | 0.49 |
| PF04185 | Phosphoesterase | 0.49 |
| PF07690 | MFS_1 | 0.49 |
| PF13575 | DUF4135 | 0.49 |
| PF00753 | Lactamase_B | 0.49 |
| PF03714 | PUD | 0.49 |
| PF13181 | TPR_8 | 0.49 |
| PF01011 | PQQ | 0.49 |
| PF00754 | F5_F8_type_C | 0.49 |
| PF02954 | HTH_8 | 0.49 |
| PF11154 | DUF2934 | 0.49 |
| PF00486 | Trans_reg_C | 0.49 |
| PF13646 | HEAT_2 | 0.49 |
| PF07168 | Ureide_permease | 0.49 |
| PF01230 | HIT | 0.49 |
| PF01435 | Peptidase_M48 | 0.49 |
| PF00132 | Hexapep | 0.49 |
| PF13229 | Beta_helix | 0.49 |
| PF16491 | Peptidase_M48_N | 0.49 |
| PF01261 | AP_endonuc_2 | 0.49 |
| PF13463 | HTH_27 | 0.49 |
| PF01551 | Peptidase_M23 | 0.49 |
| PF13145 | Rotamase_2 | 0.49 |
| PF13581 | HATPase_c_2 | 0.49 |
| PF03950 | tRNA-synt_1c_C | 0.49 |
| PF01609 | DDE_Tnp_1 | 0.49 |
| PF04134 | DCC1-like | 0.49 |
| PF02801 | Ketoacyl-synt_C | 0.49 |
| PF13589 | HATPase_c_3 | 0.49 |
| PF01478 | Peptidase_A24 | 0.49 |
| PF00034 | Cytochrom_C | 0.49 |
| PF05016 | ParE_toxin | 0.49 |
| PF13231 | PMT_2 | 0.49 |
| PF02910 | Succ_DH_flav_C | 0.49 |
| PF00078 | RVT_1 | 0.49 |
| PF13474 | SnoaL_3 | 0.49 |
| PF01152 | Bac_globin | 0.49 |
| PF00550 | PP-binding | 0.49 |
| PF03358 | FMN_red | 0.49 |
| PF01370 | Epimerase | 0.49 |
| PF07927 | HicA_toxin | 0.49 |
| PF02652 | Lactate_perm | 0.49 |
| PF00004 | AAA | 0.49 |
| PF01590 | GAF | 0.49 |
| PF00144 | Beta-lactamase | 0.49 |
| PF13522 | GATase_6 | 0.49 |
| PF13624 | SurA_N_3 | 0.49 |
| PF13610 | DDE_Tnp_IS240 | 0.49 |
| PF00196 | GerE | 0.49 |
| PF00582 | Usp | 0.49 |
| PF03840 | SecG | 0.49 |
| PF07729 | FCD | 0.49 |
| PF07963 | N_methyl | 0.49 |
| PF00083 | Sugar_tr | 0.49 |
| PF03400 | DDE_Tnp_IS1 | 0.49 |
| PF12142 | PPO1_DWL | 0.49 |
| PF13505 | OMP_b-brl | 0.49 |
| PF05345 | He_PIG | 0.49 |
| PF02452 | PemK_toxin | 0.49 |
| PF14833 | NAD_binding_11 | 0.49 |
| PF14312 | FG-GAP_2 | 0.49 |
| PF00313 | CSD | 0.49 |
| PF01715 | IPPT | 0.49 |
| PF00378 | ECH_1 | 0.49 |
| PF02463 | SMC_N | 0.49 |
| PF01229 | Glyco_hydro_39 | 0.49 |
| PF01095 | Pectinesterase | 0.49 |
| COG ID | Name | Functional Category | % Frequency in 203 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 7.88 |
| COG0276 | Protoheme ferro-lyase (ferrochelatase) | Coenzyme transport and metabolism [H] | 0.99 |
| COG4934 | Serine protease, subtilase family | Posttranslational modification, protein turnover, chaperones [O] | 0.99 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.99 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.49 |
| COG0008 | Glutamyl- or glutaminyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.49 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.49 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.49 |
| COG4677 | Pectin methylesterase and related acyl-CoA thioesterases | Carbohydrate transport and metabolism [G] | 0.49 |
| COG3664 | Beta-xylosidase | Carbohydrate transport and metabolism [G] | 0.49 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.49 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.49 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.49 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.49 |
| COG3011 | Predicted thiol-disulfide oxidoreductase YuxK, DCC family | General function prediction only [R] | 0.49 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.49 |
| COG2346 | Truncated hemoglobin YjbI | Inorganic ion transport and metabolism [P] | 0.49 |
| COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 0.49 |
| COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.49 |
| COG1802 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.49 |
| COG1724 | Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase family | General function prediction only [R] | 0.49 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.49 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.49 |
| COG1662 | Transposase and inactivated derivatives, IS1 family | Mobilome: prophages, transposons [X] | 0.49 |
| COG1620 | L-lactate permease | Energy production and conversion [C] | 0.49 |
| COG1314 | Protein translocase subunit SecG | Intracellular trafficking, secretion, and vesicular transport [U] | 0.49 |
| COG0324 | tRNA A37 N6-isopentenylltransferase MiaA | Translation, ribosomal structure and biogenesis [J] | 0.49 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.40 % |
| Unclassified | root | N/A | 26.60 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000156|NODE_c0692673 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3529 | Open in IMG/M |
| 3300000955|JGI1027J12803_109140902 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1609 | Open in IMG/M |
| 3300001399|JGI20178J14841_101146 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 653 | Open in IMG/M |
| 3300002914|JGI25617J43924_10140586 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 837 | Open in IMG/M |
| 3300004635|Ga0062388_102721898 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300005166|Ga0066674_10288440 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 772 | Open in IMG/M |
| 3300005167|Ga0066672_10400984 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300005181|Ga0066678_10388208 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 925 | Open in IMG/M |
| 3300005439|Ga0070711_100741287 | Not Available | 830 | Open in IMG/M |
| 3300005445|Ga0070708_101973825 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300005533|Ga0070734_10001019 | All Organisms → cellular organisms → Bacteria | 45548 | Open in IMG/M |
| 3300005537|Ga0070730_10016026 | All Organisms → cellular organisms → Bacteria | 5958 | Open in IMG/M |
| 3300005537|Ga0070730_10048774 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3069 | Open in IMG/M |
| 3300005552|Ga0066701_10005476 | All Organisms → cellular organisms → Bacteria | 5275 | Open in IMG/M |
| 3300005554|Ga0066661_10243063 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
| 3300005568|Ga0066703_10265111 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1041 | Open in IMG/M |
| 3300005575|Ga0066702_10336027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 919 | Open in IMG/M |
| 3300005576|Ga0066708_10667941 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 660 | Open in IMG/M |
| 3300005577|Ga0068857_101511835 | Not Available | 654 | Open in IMG/M |
| 3300005598|Ga0066706_10022093 | All Organisms → cellular organisms → Bacteria | 3890 | Open in IMG/M |
| 3300005598|Ga0066706_11408549 | Not Available | 525 | Open in IMG/M |
| 3300006028|Ga0070717_10060215 | All Organisms → cellular organisms → Bacteria | 3143 | Open in IMG/M |
| 3300006031|Ga0066651_10580241 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
| 3300006046|Ga0066652_100420691 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
| 3300006052|Ga0075029_100001904 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 11885 | Open in IMG/M |
| 3300006175|Ga0070712_100002159 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 12103 | Open in IMG/M |
| 3300006176|Ga0070765_100785995 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
| 3300006794|Ga0066658_10302899 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 854 | Open in IMG/M |
| 3300006795|Ga0075520_1436362 | Not Available | 521 | Open in IMG/M |
| 3300006797|Ga0066659_11287783 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300006800|Ga0066660_11239380 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300006854|Ga0075425_102059713 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 637 | Open in IMG/M |
| 3300006864|Ga0066797_1072362 | Not Available | 1208 | Open in IMG/M |
| 3300006871|Ga0075434_101613857 | Not Available | 657 | Open in IMG/M |
| 3300006881|Ga0068865_100723571 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300006904|Ga0075424_100568721 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
| 3300007788|Ga0099795_10049025 | Not Available | 1531 | Open in IMG/M |
| 3300009012|Ga0066710_101371779 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1096 | Open in IMG/M |
| 3300009012|Ga0066710_104093713 | Not Available | 545 | Open in IMG/M |
| 3300009038|Ga0099829_11394018 | Not Available | 579 | Open in IMG/M |
| 3300009088|Ga0099830_10792242 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300009088|Ga0099830_11568080 | Not Available | 549 | Open in IMG/M |
| 3300009089|Ga0099828_10742949 | Not Available | 880 | Open in IMG/M |
| 3300009098|Ga0105245_11441381 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300009628|Ga0116125_1104665 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 759 | Open in IMG/M |
| 3300009638|Ga0116113_1025070 | All Organisms → cellular organisms → Bacteria | 1326 | Open in IMG/M |
| 3300009638|Ga0116113_1028010 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1263 | Open in IMG/M |
| 3300009643|Ga0116110_1152271 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300009672|Ga0116215_1164090 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 984 | Open in IMG/M |
| 3300010048|Ga0126373_10001846 | All Organisms → cellular organisms → Bacteria | 15310 | Open in IMG/M |
| 3300010048|Ga0126373_11142874 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 845 | Open in IMG/M |
| 3300010048|Ga0126373_11437711 | Not Available | 755 | Open in IMG/M |
| 3300010329|Ga0134111_10320194 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 650 | Open in IMG/M |
| 3300010335|Ga0134063_10721819 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300010339|Ga0074046_10706546 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
| 3300010341|Ga0074045_10004841 | All Organisms → cellular organisms → Bacteria | 11839 | Open in IMG/M |
| 3300010343|Ga0074044_11022155 | Not Available | 542 | Open in IMG/M |
| 3300010361|Ga0126378_11094569 | Not Available | 898 | Open in IMG/M |
| 3300010379|Ga0136449_100623994 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1830 | Open in IMG/M |
| 3300012201|Ga0137365_11330035 | Not Available | 509 | Open in IMG/M |
| 3300012202|Ga0137363_10023842 | All Organisms → cellular organisms → Bacteria | 4145 | Open in IMG/M |
| 3300012204|Ga0137374_10093766 | All Organisms → cellular organisms → Bacteria | 2856 | Open in IMG/M |
| 3300012206|Ga0137380_10342499 | All Organisms → cellular organisms → Bacteria | 1334 | Open in IMG/M |
| 3300012208|Ga0137376_10855729 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 781 | Open in IMG/M |
| 3300012209|Ga0137379_10144909 | All Organisms → cellular organisms → Bacteria | 2282 | Open in IMG/M |
| 3300012209|Ga0137379_11460018 | Not Available | 586 | Open in IMG/M |
| 3300012353|Ga0137367_10036927 | All Organisms → cellular organisms → Bacteria | 3744 | Open in IMG/M |
| 3300012354|Ga0137366_10056489 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3003 | Open in IMG/M |
| 3300012355|Ga0137369_10888925 | Not Available | 599 | Open in IMG/M |
| 3300012357|Ga0137384_10210565 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1626 | Open in IMG/M |
| 3300012359|Ga0137385_10178412 | Not Available | 1861 | Open in IMG/M |
| 3300012361|Ga0137360_11872074 | Not Available | 506 | Open in IMG/M |
| 3300012362|Ga0137361_10900359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Candidatus Methylospira → Candidatus Methylospira mobilis | 802 | Open in IMG/M |
| 3300012917|Ga0137395_10015370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4314 | Open in IMG/M |
| 3300012917|Ga0137395_10518232 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 859 | Open in IMG/M |
| 3300013308|Ga0157375_10024878 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5550 | Open in IMG/M |
| 3300014489|Ga0182018_10041697 | All Organisms → cellular organisms → Bacteria | 2851 | Open in IMG/M |
| 3300014489|Ga0182018_10151159 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1326 | Open in IMG/M |
| 3300014489|Ga0182018_10258075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 957 | Open in IMG/M |
| 3300014495|Ga0182015_10013264 | All Organisms → cellular organisms → Bacteria | 7223 | Open in IMG/M |
| 3300014495|Ga0182015_10053438 | All Organisms → cellular organisms → Bacteria | 2942 | Open in IMG/M |
| 3300014498|Ga0182019_10442637 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 892 | Open in IMG/M |
| 3300014501|Ga0182024_10353292 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1920 | Open in IMG/M |
| 3300014501|Ga0182024_10817478 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
| 3300014654|Ga0181525_10142436 | All Organisms → cellular organisms → Bacteria | 1315 | Open in IMG/M |
| 3300015264|Ga0137403_10619454 | Not Available | 946 | Open in IMG/M |
| 3300015371|Ga0132258_10252650 | All Organisms → cellular organisms → Bacteria | 4311 | Open in IMG/M |
| 3300016319|Ga0182033_11160537 | Not Available | 691 | Open in IMG/M |
| 3300016387|Ga0182040_10020319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Silvibacterium → Silvibacterium bohemicum | 3671 | Open in IMG/M |
| 3300016445|Ga0182038_10453144 | Not Available | 1086 | Open in IMG/M |
| 3300017933|Ga0187801_10392393 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
| 3300017935|Ga0187848_10453024 | Not Available | 526 | Open in IMG/M |
| 3300017943|Ga0187819_10142149 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1430 | Open in IMG/M |
| 3300017948|Ga0187847_10188926 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1123 | Open in IMG/M |
| 3300017955|Ga0187817_10768775 | Not Available | 615 | Open in IMG/M |
| 3300017973|Ga0187780_10735945 | Not Available | 712 | Open in IMG/M |
| 3300018007|Ga0187805_10139151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → [Polyangium] brachysporum | 1103 | Open in IMG/M |
| 3300018009|Ga0187884_10167289 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 919 | Open in IMG/M |
| 3300018009|Ga0187884_10260974 | Not Available | 704 | Open in IMG/M |
| 3300018020|Ga0187861_10334024 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 644 | Open in IMG/M |
| 3300018033|Ga0187867_10020230 | All Organisms → cellular organisms → Bacteria | 4299 | Open in IMG/M |
| 3300018038|Ga0187855_10078740 | All Organisms → cellular organisms → Bacteria | 2009 | Open in IMG/M |
| 3300018042|Ga0187871_10111082 | All Organisms → cellular organisms → Bacteria | 1572 | Open in IMG/M |
| 3300018086|Ga0187769_10981589 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300018468|Ga0066662_10987967 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 833 | Open in IMG/M |
| 3300018468|Ga0066662_11060663 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300018468|Ga0066662_11177126 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 774 | Open in IMG/M |
| 3300018482|Ga0066669_10664265 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 917 | Open in IMG/M |
| 3300018482|Ga0066669_10742915 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 866 | Open in IMG/M |
| 3300018482|Ga0066669_11372741 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 640 | Open in IMG/M |
| 3300019886|Ga0193727_1172882 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
| 3300019888|Ga0193751_1001304 | All Organisms → cellular organisms → Bacteria | 16235 | Open in IMG/M |
| 3300020581|Ga0210399_10425163 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1107 | Open in IMG/M |
| 3300020582|Ga0210395_10542409 | Not Available | 874 | Open in IMG/M |
| 3300020583|Ga0210401_10901582 | Not Available | 743 | Open in IMG/M |
| 3300021170|Ga0210400_10085682 | All Organisms → cellular organisms → Bacteria | 2480 | Open in IMG/M |
| 3300021402|Ga0210385_11159766 | Not Available | 593 | Open in IMG/M |
| 3300021418|Ga0193695_1080242 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300021420|Ga0210394_10698105 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 889 | Open in IMG/M |
| 3300021433|Ga0210391_10927069 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella | 679 | Open in IMG/M |
| 3300021474|Ga0210390_10527642 | Not Available | 993 | Open in IMG/M |
| 3300021474|Ga0210390_10880594 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300021476|Ga0187846_10295622 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 670 | Open in IMG/M |
| 3300021477|Ga0210398_10441001 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1061 | Open in IMG/M |
| 3300021479|Ga0210410_10703639 | Not Available | 892 | Open in IMG/M |
| 3300021559|Ga0210409_10636054 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 936 | Open in IMG/M |
| 3300022557|Ga0212123_10003634 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 31733 | Open in IMG/M |
| 3300023012|Ga0228597_111423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptococcaceae → Desulfofundulus → unclassified Desulfofundulus → Desulfofundulus sp. TPOSR | 530 | Open in IMG/M |
| 3300023088|Ga0224555_1011726 | All Organisms → cellular organisms → Bacteria | 5254 | Open in IMG/M |
| 3300023088|Ga0224555_1097013 | Not Available | 930 | Open in IMG/M |
| 3300024271|Ga0224564_1005977 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1928 | Open in IMG/M |
| 3300025419|Ga0208036_1052372 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 691 | Open in IMG/M |
| 3300025442|Ga0208034_1008236 | All Organisms → cellular organisms → Bacteria | 3782 | Open in IMG/M |
| 3300025448|Ga0208037_1052028 | Not Available | 786 | Open in IMG/M |
| 3300025579|Ga0207927_1123879 | Not Available | 563 | Open in IMG/M |
| 3300025627|Ga0208220_1091439 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 829 | Open in IMG/M |
| 3300025922|Ga0207646_10484374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Bradymonadales → Lujinxingiaceae → Lujinxingia → Lujinxingia litoralis | 1115 | Open in IMG/M |
| 3300025930|Ga0207701_10309046 | All Organisms → cellular organisms → Bacteria | 1372 | Open in IMG/M |
| 3300025939|Ga0207665_11319353 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
| 3300025941|Ga0207711_10868134 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300026023|Ga0207677_10900834 | Not Available | 797 | Open in IMG/M |
| 3300026304|Ga0209240_1091643 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1104 | Open in IMG/M |
| 3300026306|Ga0209468_1128714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_55_7 | 732 | Open in IMG/M |
| 3300026309|Ga0209055_1028194 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2602 | Open in IMG/M |
| 3300026326|Ga0209801_1025425 | All Organisms → cellular organisms → Bacteria | 2855 | Open in IMG/M |
| 3300026330|Ga0209473_1034815 | All Organisms → cellular organisms → Bacteria | 2258 | Open in IMG/M |
| 3300026331|Ga0209267_1005249 | All Organisms → cellular organisms → Bacteria | 7720 | Open in IMG/M |
| 3300026334|Ga0209377_1156792 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300026360|Ga0257173_1053271 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300026532|Ga0209160_1126086 | All Organisms → cellular organisms → Bacteria | 1245 | Open in IMG/M |
| 3300026538|Ga0209056_10087857 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2589 | Open in IMG/M |
| 3300026538|Ga0209056_10141963 | Not Available | 1859 | Open in IMG/M |
| 3300026538|Ga0209056_10567497 | Not Available | 575 | Open in IMG/M |
| 3300026548|Ga0209161_10037796 | All Organisms → cellular organisms → Bacteria | 3266 | Open in IMG/M |
| 3300026551|Ga0209648_10396833 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 908 | Open in IMG/M |
| 3300027370|Ga0209010_1091568 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 518 | Open in IMG/M |
| 3300027545|Ga0209008_1154898 | Not Available | 503 | Open in IMG/M |
| 3300027548|Ga0209523_1005001 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2229 | Open in IMG/M |
| 3300027676|Ga0209333_1031299 | Not Available | 1487 | Open in IMG/M |
| 3300027826|Ga0209060_10001760 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 22257 | Open in IMG/M |
| 3300027826|Ga0209060_10001884 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 21055 | Open in IMG/M |
| 3300027826|Ga0209060_10005601 | All Organisms → cellular organisms → Bacteria | 8953 | Open in IMG/M |
| 3300027842|Ga0209580_10175187 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| 3300027853|Ga0209274_10035456 | All Organisms → cellular organisms → Bacteria | 2327 | Open in IMG/M |
| 3300027857|Ga0209166_10000894 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 27750 | Open in IMG/M |
| 3300027857|Ga0209166_10284381 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 872 | Open in IMG/M |
| 3300027895|Ga0209624_10566737 | Not Available | 754 | Open in IMG/M |
| 3300028047|Ga0209526_10885773 | Not Available | 544 | Open in IMG/M |
| 3300028381|Ga0268264_10022407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Gloeobacteria → Gloeobacterales → Gloeobacteraceae → Gloeobacter → Gloeobacter kilaueensis | 5159 | Open in IMG/M |
| 3300028792|Ga0307504_10476760 | Not Available | 504 | Open in IMG/M |
| 3300029922|Ga0311363_11042220 | Not Available | 711 | Open in IMG/M |
| 3300029951|Ga0311371_12318132 | Not Available | 554 | Open in IMG/M |
| 3300029955|Ga0311342_10357508 | All Organisms → cellular organisms → Bacteria | 1292 | Open in IMG/M |
| 3300029980|Ga0302298_10344317 | Not Available | 500 | Open in IMG/M |
| 3300030020|Ga0311344_11344906 | Not Available | 528 | Open in IMG/M |
| 3300030339|Ga0311360_10137489 | All Organisms → cellular organisms → Bacteria | 2021 | Open in IMG/M |
| 3300030878|Ga0265770_1148414 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300031241|Ga0265325_10066007 | Not Available | 1826 | Open in IMG/M |
| 3300031344|Ga0265316_10128423 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1910 | Open in IMG/M |
| 3300031545|Ga0318541_10866371 | Not Available | 504 | Open in IMG/M |
| 3300031708|Ga0310686_116211273 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
| 3300031711|Ga0265314_10181744 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1260 | Open in IMG/M |
| 3300031715|Ga0307476_10270042 | Not Available | 1244 | Open in IMG/M |
| 3300031753|Ga0307477_10297967 | Not Available | 1113 | Open in IMG/M |
| 3300031912|Ga0306921_10220359 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Silvibacterium → Silvibacterium bohemicum | 2223 | Open in IMG/M |
| 3300032160|Ga0311301_10202690 | All Organisms → cellular organisms → Bacteria | 3395 | Open in IMG/M |
| 3300032160|Ga0311301_11778308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter | 736 | Open in IMG/M |
| 3300032205|Ga0307472_100295041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1299 | Open in IMG/M |
| 3300032205|Ga0307472_101409115 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 676 | Open in IMG/M |
| 3300032805|Ga0335078_10239600 | All Organisms → cellular organisms → Bacteria | 2484 | Open in IMG/M |
| 3300032892|Ga0335081_10000753 | All Organisms → cellular organisms → Bacteria | 53234 | Open in IMG/M |
| 3300032892|Ga0335081_10062468 | All Organisms → cellular organisms → Bacteria | 5759 | Open in IMG/M |
| 3300032892|Ga0335081_10917507 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
| 3300032892|Ga0335081_12202744 | Not Available | 580 | Open in IMG/M |
| 3300032893|Ga0335069_10376349 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1671 | Open in IMG/M |
| 3300032896|Ga0335075_10220713 | Not Available | 2231 | Open in IMG/M |
| 3300032898|Ga0335072_10597754 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
| 3300033134|Ga0335073_10111116 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3526 | Open in IMG/M |
| 3300033158|Ga0335077_10373929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Phormidesmis → Phormidesmis priestleyi | 1538 | Open in IMG/M |
| 3300033412|Ga0310810_11161468 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 632 | Open in IMG/M |
| 3300033823|Ga0334837_085195 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 685 | Open in IMG/M |
| 3300034199|Ga0370514_074974 | Not Available | 857 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 13.30% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.90% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.42% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.93% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.43% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.94% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.45% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.96% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 2.46% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.97% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.97% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.97% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.97% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.97% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.97% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.48% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.48% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.48% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.48% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.99% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.99% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.99% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.99% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.99% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.49% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.49% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.49% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.49% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.49% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.49% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.49% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.49% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.49% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.49% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.49% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.49% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.49% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.49% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.49% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.49% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.49% |
| Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.49% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001399 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-072012 | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006795 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006864 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
| 3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
| 3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021418 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2 | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300023012 | Spruce litter microbial communities from Bohemian Forest, Czech Republic - CLU4 | Environmental | Open in IMG/M |
| 3300023088 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 30-34 | Environmental | Open in IMG/M |
| 3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
| 3300025419 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025442 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025448 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025579 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025627 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026360 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-B | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027370 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029952 | II_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029955 | II_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029980 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_3 | Environmental | Open in IMG/M |
| 3300030020 | II_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030339 | III_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
| 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Host-Associated | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033823 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 S3 30-34 | Environmental | Open in IMG/M |
| 3300034199 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| NODE_06926732 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | MICPVEIARDMSALRAARVGDHAEHGLLPEGRDGAGDESTRCDVAG |
| JGI1027J12803_1091409025 | 3300000955 | Soil | MICPVEIASDMSALRAVRMRDHAEHGSLSEGRDGAG |
| JGI20178J14841_1011461 | 3300001399 | Arctic Peat Soil | MICPVEIASDLSAFQAARVGEHGRHVGLLEGRGGAGNEDT |
| JGI25617J43924_101405861 | 3300002914 | Grasslands Soil | MICPVEIASEVSAWQAARVGEHGRHVLLHAGRDGADDEGTGSY |
| Ga0062388_1027218981 | 3300004635 | Bog Forest Soil | MICPVEIAREVSALRAARVGDHAKHGVLLEGRDGAGDESAGSD |
| Ga0066674_102884402 | 3300005166 | Soil | MICPVQIASDMSALRAVRVGDHAKHGWLPEGRDGAGNESTG |
| Ga0066672_104009842 | 3300005167 | Soil | MCPVELAHEMSALQAVRVGDHAKHGLLLEGRHGAGDESTRSDFAS |
| Ga0066678_103882083 | 3300005181 | Soil | MICPVEIARDMSAFQAVRVRDHAKHGFLLEGRDGAGNESTGS |
| Ga0070711_1007412871 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MICPVEIARDLSAFRAVRVGDHAKHGFLLEDRDGAGDESTGSD |
| Ga0070708_1019738252 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MICPVALASDLSAWRAARVGDHAGHGKLLEGRDGAGHEGSGSDF |
| Ga0070734_100010191 | 3300005533 | Surface Soil | MICPVEIAGDMSALRAVRIGDHAEHGSVSEGRDGA |
| Ga0070730_100160268 | 3300005537 | Surface Soil | MICPVEIARDMSALRAARVGDHAEHGILPEGRDGA |
| Ga0070730_100487741 | 3300005537 | Surface Soil | MICPVEIADDMSALRAVRMRDHAEHGSLSEGRDGA |
| Ga0066701_100054768 | 3300005552 | Soil | MICPVVIARDLSAFLAVRVREHGRHVLLPEGRDGA |
| Ga0066661_102430631 | 3300005554 | Soil | MICPVELAGELSALRAARVGDHAEHGLLPEGRDGAG |
| Ga0066703_102651112 | 3300005568 | Soil | MICPVEIARDVSAFRAVRIRDHAKHGFLLEGRDGAGNESTG |
| Ga0066702_103360271 | 3300005575 | Soil | MICPVEIAREMSAIRAVRVGDHGRHVLLPEGRDGAG |
| Ga0066708_106679411 | 3300005576 | Soil | MICPVEIARDVSALQAARVGDHAKHDLLPEGRSGAG |
| Ga0068857_1015118351 | 3300005577 | Corn Rhizosphere | ICPVEIAHEMSALRAARVGDYAKHGFLPEGRDGAPDR* |
| Ga0066706_100220936 | 3300005598 | Soil | MVCPVEIARDVSALQAARVGDHAKHDLLPEGRSGAGDESTG |
| Ga0066706_114085492 | 3300005598 | Soil | MICPVEIARDMSAFQAVRVRDHAKHGFLLEGRDGAGNEST |
| Ga0070717_100602153 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MICPVEIARDMSAFQAVRVRDHAKHGFLLEGRDGAGNES |
| Ga0066651_105802412 | 3300006031 | Soil | MICPVEIARDMSAFQAVRVRDHAKHGFLLEGRDGA |
| Ga0066652_1004206911 | 3300006046 | Soil | MICPVELASDLSAWRAARVGDHAGHGFLHAGRDGAG |
| Ga0075029_10000190415 | 3300006052 | Watersheds | MICPVEIASEMSALRAARMGDHAEHGSLSEGRDGA |
| Ga0070712_10000215910 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MICPVEIARDLSAFRAVRVGDHAKHGFLLEDRDGAG |
| Ga0070765_1007859953 | 3300006176 | Soil | MICPVEIAREMSALRAVRVGDHGKHGVLLEGRDGA |
| Ga0066658_103028991 | 3300006794 | Soil | MICPVELAGELSALRAARVGDHAEHGLLPEGRDGAGD |
| Ga0075520_14363621 | 3300006795 | Arctic Peat Soil | MSVNVSICPVEIAGDLSAFQAARVGDHAKHGFLFEGRDGA |
| Ga0066659_112877832 | 3300006797 | Soil | MICPVVIARDLSAFLAVRVREHGRHVLLPEGGDGAG |
| Ga0066660_112393801 | 3300006800 | Soil | MICPLEIASDLSALRAARVADHGKHGGLLEGRDGAGD |
| Ga0075425_1020597131 | 3300006854 | Populus Rhizosphere | MICPDELASDLSAWRAARVGDHAGHGKLLEGRDGAG |
| Ga0066797_10723621 | 3300006864 | Soil | MICPFEIASDVSAWQAARVGEHGGHVLLHAGRDGADDEGT |
| Ga0075434_1016138571 | 3300006871 | Populus Rhizosphere | MICPVEIAQEMSALRAVRMREHAKHGLLPEGRDGAGD |
| Ga0068865_1007235712 | 3300006881 | Miscanthus Rhizosphere | MICPGELASEMSALQAARVGDHAKHGFLHEGRDGA |
| Ga0075424_1005687211 | 3300006904 | Populus Rhizosphere | MICPVEIAPDMSALRAVRMRDHAEHGSLSEGRDGAG |
| Ga0099795_100490253 | 3300007788 | Vadose Zone Soil | MICPVEIAREMSAFQAARVGEHAEHVLLHEGRDGAGDESAG |
| Ga0066710_1013717793 | 3300009012 | Grasslands Soil | MICPVELASDVSALQAARVGDHAEHGFLHEGRDGAGDE |
| Ga0066710_1040937131 | 3300009012 | Grasslands Soil | MICPVELASDVSALQAARVGDHAEHGFLHEGGDGAGDESTGGDANCDL |
| Ga0099829_113940181 | 3300009038 | Vadose Zone Soil | MICPVEIARDLSAFRAARVGEHAKHVLLPEGRSGAGD |
| Ga0099830_107922422 | 3300009088 | Vadose Zone Soil | MICPVEIARDMSAFRAVRIRDHAKHGFLFEGRDGAG |
| Ga0099830_115680802 | 3300009088 | Vadose Zone Soil | MICPVEIARDMSAFRAVRIRDHAKHGFLLEGRDGAG |
| Ga0099828_107429491 | 3300009089 | Vadose Zone Soil | MICPVEIARDLSAFRAARVGEHAKHVLLPEGRSGAG |
| Ga0105245_114413811 | 3300009098 | Miscanthus Rhizosphere | MICPGELASEMSALQAARVGDHAKHGFLHEGRDGAGD |
| Ga0116125_11046651 | 3300009628 | Peatland | MICPVEIASDMSAFRAVVGDHAKHELLHTSRHGAGDES |
| Ga0116113_10250702 | 3300009638 | Peatland | MICPVEIASDMSALRAARVGDHGKHGLLPEGRDGA |
| Ga0116113_10280101 | 3300009638 | Peatland | MICPVEIASDMSALRAARVGDHGKHGLLPEGRDGAGN |
| Ga0116110_11522713 | 3300009643 | Peatland | MICPVAIARDLSAFPAARVGDHAKHGFLLEGRDGAG |
| Ga0116215_11640901 | 3300009672 | Peatlands Soil | MICPVEIASDLSALQAARVGDHGRHGVLHAGRSGAGD |
| Ga0126373_1000184613 | 3300010048 | Tropical Forest Soil | MICPVEIAHDLSALRAVRVGDHGKHGFLLEDRDGAG |
| Ga0126373_111428741 | 3300010048 | Tropical Forest Soil | MICPVEIAHDLSALRAVRVGDHGKHGFLLEDRDGAGN |
| Ga0126373_114377112 | 3300010048 | Tropical Forest Soil | MICPVEIARDVSALRAVRVGDHGKHGFLFEDRDGAGNER |
| Ga0134111_103201942 | 3300010329 | Grasslands Soil | LKCPVFVASEMSAWRAARVGEHAKHGFLHAGRDGAEGS* |
| Ga0134063_107218192 | 3300010335 | Grasslands Soil | MICPLEIASDLSALRAARVADHGKHGWLLEGRDGAG |
| Ga0074046_107065461 | 3300010339 | Bog Forest Soil | MICPVEIASDLSALRAARVGDHAKHGGLLEGRDGAGDES |
| Ga0074045_100048411 | 3300010341 | Bog Forest Soil | MICPVEIAHEVSALRAVRVGDPGKHGFLLEGRDGAGDE |
| Ga0074044_110221551 | 3300010343 | Bog Forest Soil | MICPVEIASDLSALQAARVGEHGRHALLHAGRDGADD |
| Ga0126378_110945692 | 3300010361 | Tropical Forest Soil | MICPVEIAHEMSALRAARMREHGKHGLLPEGRDGAG |
| Ga0136449_1006239943 | 3300010379 | Peatlands Soil | MICPVEIAREMSAFRTARVGEHTEHVLLHEGRDGAGDEGTGSDFAG |
| Ga0137365_113300351 | 3300012201 | Vadose Zone Soil | MICPVEIARDLSAFQAARVGEHAGHVLLHEDRSGAGDEVQE |
| Ga0137363_100238425 | 3300012202 | Vadose Zone Soil | MICPVEIASDVSALRAARIGDHAKHGILLEGRDGAG |
| Ga0137374_100937661 | 3300012204 | Vadose Zone Soil | MICPVEIARDMSAFQAVRVRDHAKHGFLPEGRDGA |
| Ga0137380_103424991 | 3300012206 | Vadose Zone Soil | MICPVEIAGDMSALRAVRIGDHAEHGSLSEGRDGAGD |
| Ga0137376_108557293 | 3300012208 | Vadose Zone Soil | MICPVELASDLSAWRAARVGDHAGHGFLHAGRDGA |
| Ga0137379_101449091 | 3300012209 | Vadose Zone Soil | MICPVELASDVSAWRAARVGDHGEHGKLLEGRDGAGD |
| Ga0137379_114600182 | 3300012209 | Vadose Zone Soil | MICPVEIAGDLSALRAARVGDHVKHDLLPEGRSGA |
| Ga0137367_100369276 | 3300012353 | Vadose Zone Soil | MICPVEIARDMSAFQAVRVRDHAKHGFLPEGRDGAG |
| Ga0137366_100564891 | 3300012354 | Vadose Zone Soil | MICPVEIAGDMSALRAVRIGDHAEHGSLSEGRDGAG |
| Ga0137369_108889251 | 3300012355 | Vadose Zone Soil | MICPVEIARDMSAFQAVRVRDHAKHGFLPEGRDGAGNESTGSNL |
| Ga0137384_102105651 | 3300012357 | Vadose Zone Soil | MICPVEIARDLSAFQAARVGEDAEHVLLPEGRDGAGDESAGSDF |
| Ga0137385_101784121 | 3300012359 | Vadose Zone Soil | MICPVELASDLSAFQAVGVRDHGRHGLLFENRDGAGNEDT |
| Ga0137360_118720742 | 3300012361 | Vadose Zone Soil | MICRVELATDLSALQAVRVGDHGKHVLLLEGRDGAGYE |
| Ga0137361_109003592 | 3300012362 | Vadose Zone Soil | MICPVEIASEVSAWQAARVGEHGRHVLLHAGRDGADDEGT |
| Ga0137395_100153701 | 3300012917 | Vadose Zone Soil | MICPVEIAHDMSALRAVRIGDHAKHGSLSEGRDGAGN |
| Ga0137395_105182322 | 3300012917 | Vadose Zone Soil | MICPVEIASDLSALQAARVGEHGRHVLLHAGRDGADDEST |
| Ga0157375_100248781 | 3300013308 | Miscanthus Rhizosphere | MICPVEIAHDMSALRAVRMGDHAEHGSLSEGRDGAGN |
| Ga0182018_100416973 | 3300014489 | Palsa | MICPVELAHDMSALRAARIGDHAKHGILLEGRDGAG |
| Ga0182018_101511591 | 3300014489 | Palsa | MICPVEIAHDMSALRAVRMGDHAEHGSLSEGRDGAGD |
| Ga0182018_102580751 | 3300014489 | Palsa | MICPVELAHDMSALRAARIGDHAKHGILLEGRDGA |
| Ga0182015_100132641 | 3300014495 | Palsa | MICPVEIASDMSALQAVRIGDHAEHGSLSEGRDGA |
| Ga0182015_100534386 | 3300014495 | Palsa | MICPAELASEVSAAGGVVGEHGRHVLLHEGRSGASD |
| Ga0182019_104426372 | 3300014498 | Fen | MICPVEIAHDMSALRAVRIGDHAEHGSLSEGRDGAG |
| Ga0182024_103532921 | 3300014501 | Permafrost | MICPVEIAHDMSALRAVRIGDHAEHGSLSEGRDGA |
| Ga0182024_108174783 | 3300014501 | Permafrost | MICPVEIASDMSAWQAAGVGEHGRHVLLHAGRDGAD |
| Ga0181525_101424361 | 3300014654 | Bog | MICPVEIASDMSALRAVRVGEHAKHVHLHEGRSRAGD |
| Ga0137403_106194541 | 3300015264 | Vadose Zone Soil | MICPVEIAGDLSAFGAARVGDHAKHVLLPEGCSGAGDES |
| Ga0132258_102526501 | 3300015371 | Arabidopsis Rhizosphere | MICPVEIAHDMSALRAVRIRDHAEHGSLSEGRNGAGDESTGRDVAGD |
| Ga0182033_111605371 | 3300016319 | Soil | MICPVEIARDMSALRAARVDHAKHGFLPEGRDGAGDE |
| Ga0182040_100203191 | 3300016387 | Soil | MICPVEIARDMSALRAARVGDHGKHGLLLEGRDGA |
| Ga0182038_104531443 | 3300016445 | Soil | MICPVQLASEMSAQRAVRVGDHAKHGILLEGRSGAG |
| Ga0187801_103923932 | 3300017933 | Freshwater Sediment | MICPVDVAGDLSALRAARVGDHGRHGLLLEGRGGA |
| Ga0187848_104530241 | 3300017935 | Peatland | MICPVEIAHEMSALQAVRVGDHAKHGFLLEGRRGAGD |
| Ga0187819_101421492 | 3300017943 | Freshwater Sediment | MICPVRLAGDVSALQAVKVGDHAGHDLLHEGRDGAGD |
| Ga0187847_101889263 | 3300017948 | Peatland | MICPVEIASDMSALRAARVGDHGKHGLLPEGRDGAG |
| Ga0187817_107687751 | 3300017955 | Freshwater Sediment | MICPVGLAGDVSALQAVKVGDHAGHDLLHEGRDGAGD |
| Ga0187780_107359451 | 3300017973 | Tropical Peatland | MICPVEIADDMSALRAVRVRDHAKHGSLSEGRDGAGDESAG |
| Ga0187805_101391511 | 3300018007 | Freshwater Sediment | MCPVELASEMSALRAARVGDHAEHGLLHEGRGGAGDESTGS |
| Ga0187884_101672892 | 3300018009 | Peatland | MICPVELAHDMSALRAARVGDHAKHGLLLEGRDGAGD |
| Ga0187884_102609741 | 3300018009 | Peatland | MICPVEIAHEMSALRAVRMGDHAEHGNLSEGRDGAGD |
| Ga0187861_103340241 | 3300018020 | Peatland | MICPVEIASDMSALQAAGVGDHGRHDLLHAGRDGAD |
| Ga0187867_100202301 | 3300018033 | Peatland | MICPVELAHEMSAFQAVRVGDHAEHGFLLEDRHGAG |
| Ga0187855_100787402 | 3300018038 | Peatland | MICPVELAHEMSAFQAVRVGDHAEHGFLLEDRHGAGYE |
| Ga0187871_101110821 | 3300018042 | Peatland | MICPVELAHEMSAFQAVRVGDHAEHGFLLEDRHGAGY |
| Ga0187769_109815891 | 3300018086 | Tropical Peatland | MICAVEIASGLSAWRAARVGDHGWHGELLEGRDGAGH |
| Ga0066662_109879671 | 3300018468 | Grasslands Soil | MICPVEIARDLSAFLAVRVGEHGRHVLLPEGRDGAGD |
| Ga0066662_110606631 | 3300018468 | Grasslands Soil | MICPVEIAREMSAIRAVRVGDHGRHVLLPEGRDGAGD |
| Ga0066662_111771261 | 3300018468 | Grasslands Soil | MICPVVIARDLSAFLAVRVREHGRHVLLPEGRDGAG |
| Ga0066669_106642652 | 3300018482 | Grasslands Soil | MICPVEIARDVSALQAARVGDHAKHDLLPEGRSGAGD |
| Ga0066669_107429151 | 3300018482 | Grasslands Soil | MICPVELASDLSAWRAARVGDHAGHGFLHAGRDGAGD |
| Ga0066669_113727412 | 3300018482 | Grasslands Soil | MICPVELASDLSALRAARVGDHAKHGFLLEGRDGAG |
| Ga0193727_11728822 | 3300019886 | Soil | MICPVEIAGDLSAFQAARVGDHAKHVLLPEGRSGAGDE |
| Ga0193751_10013041 | 3300019888 | Soil | MICPVEIASEVTALQAARVGEHGRYVFLHAGRDGADDE |
| Ga0210399_104251631 | 3300020581 | Soil | MICPVEIASDMSALRAVRIGDHAEHGILSEGRDGAGDE |
| Ga0210395_105424091 | 3300020582 | Soil | MICPVELAHDMSALRAARIGDHAKHGILLEGRDGAGDE |
| Ga0210401_109015821 | 3300020583 | Soil | MICPVEIASDMSALQAARVGDHGRHGVLHAGRSGASN |
| Ga0210400_100856823 | 3300021170 | Soil | MICPVEIAGDMSALRAVRIGDHAEHGSLSEGRDGAGDE |
| Ga0210385_111597661 | 3300021402 | Soil | MICPVEIASDMSAFRAVVGDHGEHELLHTSRHGAGNEG |
| Ga0193695_10802423 | 3300021418 | Soil | MICPVEIAHDLSAFRAARVGDHAKHDLLPEGRSGAGD |
| Ga0210394_106981051 | 3300021420 | Soil | MICPVEIAHDMSALLAVRIGDHAEHGSLSEGRDGAGD |
| Ga0210391_109270692 | 3300021433 | Soil | MICPVELANDLSAKRAARIGDHASHGVLSEGRGGA |
| Ga0210390_105276421 | 3300021474 | Soil | MICPVELTHDMSALRAARIGDHAKHGILFEGRDGAGDE |
| Ga0210390_108805941 | 3300021474 | Soil | MICPVEIAHDMSALRAVRMRDHAEHGDLSEGRDGAGNE |
| Ga0187846_102956221 | 3300021476 | Biofilm | MICPVELARDLSAWRAVRVGDHGKHGKLLEGRDGAGDE |
| Ga0210398_104410012 | 3300021477 | Soil | MICPVELAHDMSALRAARVGDHAKHGILLEGRDGAD |
| Ga0210410_107036391 | 3300021479 | Soil | MICPVEIAHDMSALRAVRIGDHAEHGSLSEGRDGAGDE |
| Ga0210409_106360541 | 3300021559 | Soil | MICPVGLASDLSALRAARVGDHARQGKLLEGRDGAG |
| Ga0212123_1000363430 | 3300022557 | Iron-Sulfur Acid Spring | MICPVEIAHDMSALRAVRIGDHAEHGDLSEGRDGAGNE |
| Ga0228597_1114231 | 3300023012 | Plant Litter | MICPVEIASDMSAFRAVVGDHARHDLLHTSRHGAGDES |
| Ga0224555_10117261 | 3300023088 | Soil | MICPDEIASDVSALQAARVGEHGRHVLLHAGRDGADDE |
| Ga0224555_10970132 | 3300023088 | Soil | MICPDEIASDVSALQAARVGEHGRHVLLHAGRDGADD |
| Ga0224564_10059771 | 3300024271 | Soil | MICPVEIAGDMSALQAVRMGDHAKHGLLPEGRDGAGD |
| Ga0208036_10523721 | 3300025419 | Peatland | MICPVEIASEVSAWQAAVVGEHGRHVFLHAGRDGADDE |
| Ga0208034_10082365 | 3300025442 | Peatland | MICPVEIASEVSAWQAAVVGEHGRHVFLHAGRDGA |
| Ga0208037_10520283 | 3300025448 | Peatland | MICPVEIASDMSALQAAGVGDHGRHDLLHAGRDGADDG |
| Ga0207927_11238791 | 3300025579 | Arctic Peat Soil | MICPVEIASDLSALRAARVGDHAEHGGLLEGRDGAGDESAGS |
| Ga0208220_10914392 | 3300025627 | Arctic Peat Soil | MICPVEIARDMSALRAVRVGDHGKHGILLEGRDGAGNE |
| Ga0207646_104843743 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MICPVELASDLSAFRVVRVGDHGRHGFLLEGRHGA |
| Ga0207701_103090461 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MICPGELASEMSALQAARVGDHAKHGFLHEGRDGAGDENTGSD |
| Ga0207665_113193532 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MICPVALASDLSAWRAARVGDHAGHGKLLEDRDGAGHEG |
| Ga0207711_108681343 | 3300025941 | Switchgrass Rhizosphere | MICPGELASDMSALQAARVGDHAKHGFLHEGRDGAGDE |
| Ga0207677_109008342 | 3300026023 | Miscanthus Rhizosphere | MICPVEIARDMSALRAARIGDHAEHGLLPEGRDGAGD |
| Ga0209240_10916431 | 3300026304 | Grasslands Soil | MICPVEIARDLSALQAVRVGDHAKHGFLHEDRDGAGNE |
| Ga0209468_11287143 | 3300026306 | Soil | MICPLEIASDLSALRAARVADHGKHGWLLEGRDGAGDE |
| Ga0209055_10281941 | 3300026309 | Soil | MICPVVIARDLSAFLAVRVREHGRHVLLPEGRDGAGDE |
| Ga0209801_10254255 | 3300026326 | Soil | MICPVVIARDLSAFLAVRVREHGRHVLLPEGRDGAGDEST |
| Ga0209473_10348155 | 3300026330 | Soil | MICPVEIARDMSAFQAVRVRDHAKHGFLLEGRDGAGNE |
| Ga0209267_10052491 | 3300026331 | Soil | MICPVVIARDLSAFLAVRVREHGRHVLLPEGRDGAGD |
| Ga0209377_11567921 | 3300026334 | Soil | MICPVEIARDLSAFLAVRVGEHGRHVLLPEGRDGAGDESTGS |
| Ga0257173_10532711 | 3300026360 | Soil | MICPVEIARDLAAFQAVRVGEHAGHVLLHEGRSGAGDE |
| Ga0209160_11260863 | 3300026532 | Soil | MICPVELAGELSALRAARVGDHAEHGLLPEGRDGAGDE |
| Ga0209056_100878571 | 3300026538 | Soil | MICPVEIAGDMSAKRAAKVGDHAKHGLLPEGGDGAGDESTGRNVA |
| Ga0209056_101419631 | 3300026538 | Soil | MICPVEIAGDLSALRAARAGEHAKHVLLPEGRDGAGD |
| Ga0209056_105674971 | 3300026538 | Soil | MICPLEIASDLSALRAARVADHGKHGGLLEGRDGAGDE |
| Ga0209161_100377965 | 3300026548 | Soil | MICPVEIARDMSAFRAVRIRDHAKHGFLLEGRDGAGNE |
| Ga0209648_103968332 | 3300026551 | Grasslands Soil | MICPVEIASEVSALQAARVGDHGRHGVLHAGRSGASDE |
| Ga0209010_10915681 | 3300027370 | Forest Soil | MICPVQLAHDMSALRAARVGDHAKHGLLLEGRDGAGDES |
| Ga0209008_11548981 | 3300027545 | Forest Soil | MICPVRLASDLSALRAAKVGDHGQHDLLHEGRDGAGD |
| Ga0209523_10050014 | 3300027548 | Forest Soil | MICPVEIARDLSAFQAVRVGEHGRHVLLSEGRDGAGDEST |
| Ga0209333_10312991 | 3300027676 | Forest Soil | MICPVEMASDMSAFRAVVGDHARHDLLHTSRHGAGDESTG |
| Ga0209060_100017601 | 3300027826 | Surface Soil | MICPVEIAGDMSALRAVRIGDHAEHGSVSEGRDGAGD |
| Ga0209060_100018841 | 3300027826 | Surface Soil | MICPVEIAGDMSALRAVRIGDHAEHGSVSEGRDGAGDE |
| Ga0209060_1000560111 | 3300027826 | Surface Soil | MICPVEIAGDMSALRAVRIGDHAEHGSVSEGRDGAGDESTGR |
| Ga0209580_101751874 | 3300027842 | Surface Soil | MICPVEIASDMSALRAVRVGDHGKHGFLPEGRDGA |
| Ga0209274_100354562 | 3300027853 | Soil | MICPVEIASDMSAFRAVVGDHARHELLHTSRHGAGDE |
| Ga0209166_1000089425 | 3300027857 | Surface Soil | MICPVEIARDMSALRAARVGDHAEHGILPEGRDGAGDE |
| Ga0209166_102843811 | 3300027857 | Surface Soil | MICPVEIADDMSALRAVRMRDHAEHGSLSEGRDGAGDE |
| Ga0209624_105667371 | 3300027895 | Forest Soil | MICPVDIAREMSALRAVRVGDHGKHGDLLEGRDGAGNE |
| Ga0209526_108857732 | 3300028047 | Forest Soil | MICPAELASEMSAFEAAGVGEHPGHGLLHATKVQEV |
| Ga0268264_100224076 | 3300028381 | Switchgrass Rhizosphere | MICPVEIARDMSALRAARIGDHAEHGLLPEGRDGAGDE |
| Ga0307504_104767601 | 3300028792 | Soil | MICPVEIAHDLSAFRAARVGDHAKHDLLPEGRSGAGDESAG |
| Ga0311363_110422201 | 3300029922 | Fen | MICPVEIASEMSAFRAVRIGDHAKHGNLSEGRSGAGDE |
| Ga0311371_123181322 | 3300029951 | Palsa | MICPVEIASDRSALRAVRVGDHAEHGFLSEGRDGA |
| Ga0311346_104374932 | 3300029952 | Bog | MICPEDVANELSALRAAVLGDDAKHGCLDEGRGGAGDAG |
| Ga0311342_103575081 | 3300029955 | Bog | MICPVEIASEMSAFRAVRIGDHAKHGNLSEGRSGA |
| Ga0302298_103443171 | 3300029980 | Fen | MICPVEIASDLSAFQTARVGDHAEHGVLLEGRDGAGD |
| Ga0311344_113449061 | 3300030020 | Bog | MICPVEIASDMSALRAARVGDHAKHGLLPEGRDGAGNE |
| Ga0311360_101374893 | 3300030339 | Bog | MICPVEIASEVSALQAARVGEHGRHVFLHAGRDGAD |
| Ga0265770_11484141 | 3300030878 | Soil | MICPVEIAGDMSALRAVRIRGHAEHGSLSEGRDGAG |
| Ga0265325_100660071 | 3300031241 | Rhizosphere | MICPVEIASDMSALRAVRIGDPAVHGSLSEGRDGAGDES |
| Ga0265316_101284231 | 3300031344 | Rhizosphere | MICPVEIADDMSALRAVRIGDHAEHGSLSEGRDGAGDE |
| Ga0318541_108663711 | 3300031545 | Soil | MICPVEIARDMSALRAARVDHAKHGFLPEGRDGAGDES |
| Ga0310686_1162112732 | 3300031708 | Soil | MICPVEIARDVSALRAARVGDHAQHGWLLEGRDGAGDE |
| Ga0265314_101817443 | 3300031711 | Rhizosphere | MICPVEIARDMSAFLATRVGDHAEHDQLPEGRGGAGD |
| Ga0307476_102700421 | 3300031715 | Hardwood Forest Soil | MICPVEIARDMSALRAVRMGDHAEHGSLSEGRDGAGD |
| Ga0307477_102979672 | 3300031753 | Hardwood Forest Soil | MICPVEIARDMSALRAVRMGDHAEHGSLSEGRDGAG |
| Ga0306921_102203594 | 3300031912 | Soil | MICPVEIARDMSALRAARVGDHGKHGLLLEGRDGAG |
| Ga0311301_102026906 | 3300032160 | Peatlands Soil | MICPVGLARDLSALQAVKVGDHGQHDLLHEGRDGAGD |
| Ga0311301_117783081 | 3300032160 | Peatlands Soil | MICPVELASDMSALRAVRVGEHAKHGFLHEGRDGAGDE |
| Ga0307472_1002950413 | 3300032205 | Hardwood Forest Soil | MICPDELASDLSAWRAARVGDHAGHGKLLEGRDGAGHE |
| Ga0307472_1014091151 | 3300032205 | Hardwood Forest Soil | MICPVEIAGDLSALRAARAGEHAKHVLLPEGRDGAGDE |
| Ga0335078_102396001 | 3300032805 | Soil | MICPVEIAGDMSALRAARIRDHAEHGSLSEGRDGA |
| Ga0335081_100007531 | 3300032892 | Soil | MICPVEIASDMSALQAVRIRDHGEHGSLSEGRDGAGDE |
| Ga0335081_100624681 | 3300032892 | Soil | MICPVEIAGDMSALRAARIRDHAEHGSLSEGRDGAGDE |
| Ga0335081_109175071 | 3300032892 | Soil | MICPVAIALDMSALRAVRIRDHAEHGSLSEGRDGAGNE |
| Ga0335081_122027442 | 3300032892 | Soil | MICPVEIAGDMSALRAARIRDHAEHGSLSEGRDGAG |
| Ga0335069_103763491 | 3300032893 | Soil | MICPVEIASDMSALRAVRIGDHAEHGSLSEGRDGAGDE |
| Ga0335075_102207134 | 3300032896 | Soil | MICPVEIASDVSAERAARMGDHAGHGSVSEGRGGAGD |
| Ga0335072_105977541 | 3300032898 | Soil | MICPGEIASDVSAERAARMGDHAGHGSVSEGRGGAGDE |
| Ga0335073_101111161 | 3300033134 | Soil | MICPVEIARDMSALRAARIRDHAEDGSLSEGRDGAGDE |
| Ga0335077_103739291 | 3300033158 | Soil | MICPVEIARDMSALRAARVGDHAGHGSLSEGRDGAG |
| Ga0310810_111614681 | 3300033412 | Soil | MICPVEIAHEMSALRAARVGDHGKHGFLPEGRDGAGDE |
| Ga0334837_085195_3_107 | 3300033823 | Soil | MICPDEIASDVSALQAARVGEHGRHVLLHAGRDGA |
| Ga0370514_074974_1_114 | 3300034199 | Untreated Peat Soil | MICPVELARDMSACRAARVGDHAKHGLLLEGRRGAGDE |
| ⦗Top⦘ |