| Basic Information | |
|---|---|
| Family ID | F024918 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 204 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MEHELKRIADALELVIQMVKKDQEETRARFEERWDKEDKEAAQ |
| Number of Associated Samples | 149 |
| Number of Associated Scaffolds | 204 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 63.55 % |
| % of genes near scaffold ends (potentially truncated) | 47.55 % |
| % of genes from short scaffolds (< 2000 bps) | 97.06 % |
| Associated GOLD sequencing projects | 130 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (76.961 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (34.314 % of family members) |
| Environment Ontology (ENVO) | Unclassified (85.784 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (89.706 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 57.75% β-sheet: 0.00% Coil/Unstructured: 42.25% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 204 Family Scaffolds |
|---|---|---|
| PF03592 | Terminase_2 | 0.49 |
| COG ID | Name | Functional Category | % Frequency in 204 Family Scaffolds |
|---|---|---|---|
| COG3728 | Phage terminase, small subunit | Mobilome: prophages, transposons [X] | 0.49 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 76.96 % |
| All Organisms | root | All Organisms | 23.04 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10170013 | Not Available | 770 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10203469 | Not Available | 662 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10216001 | Not Available | 630 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10229607 | Not Available | 599 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10259365 | Not Available | 542 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10272975 | Not Available | 519 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10104044 | Not Available | 923 | Open in IMG/M |
| 3300001355|JGI20158J14315_10185660 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 604 | Open in IMG/M |
| 3300001450|JGI24006J15134_10123666 | Not Available | 889 | Open in IMG/M |
| 3300001450|JGI24006J15134_10158942 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 731 | Open in IMG/M |
| 3300001460|JGI24003J15210_10060006 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 1228 | Open in IMG/M |
| 3300001460|JGI24003J15210_10154354 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 583 | Open in IMG/M |
| 3300001460|JGI24003J15210_10159844 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 567 | Open in IMG/M |
| 3300001460|JGI24003J15210_10182616 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 507 | Open in IMG/M |
| 3300001472|JGI24004J15324_10126342 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 620 | Open in IMG/M |
| 3300001589|JGI24005J15628_10163842 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 660 | Open in IMG/M |
| 3300001589|JGI24005J15628_10182815 | Not Available | 604 | Open in IMG/M |
| 3300001720|JGI24513J20088_1011513 | Not Available | 1077 | Open in IMG/M |
| 3300001720|JGI24513J20088_1018054 | Not Available | 789 | Open in IMG/M |
| 3300002483|JGI25132J35274_1013726 | Not Available | 1974 | Open in IMG/M |
| 3300002930|Water_103709 | Not Available | 2460 | Open in IMG/M |
| 3300004277|Ga0066611_10294131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter → Rhodanobacter spathiphylli | 540 | Open in IMG/M |
| 3300004941|Ga0068514_1041196 | Not Available | 555 | Open in IMG/M |
| 3300006026|Ga0075478_10181628 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus | 647 | Open in IMG/M |
| 3300006027|Ga0075462_10058485 | Not Available | 1219 | Open in IMG/M |
| 3300006735|Ga0098038_1081551 | Not Available | 1133 | Open in IMG/M |
| 3300006735|Ga0098038_1103602 | Not Available | 979 | Open in IMG/M |
| 3300006735|Ga0098038_1127039 | Not Available | 863 | Open in IMG/M |
| 3300006735|Ga0098038_1176265 | All Organisms → Viruses | 702 | Open in IMG/M |
| 3300006735|Ga0098038_1296104 | Not Available | 503 | Open in IMG/M |
| 3300006737|Ga0098037_1197995 | Not Available | 658 | Open in IMG/M |
| 3300006737|Ga0098037_1301337 | Not Available | 506 | Open in IMG/M |
| 3300006752|Ga0098048_1096065 | Not Available | 898 | Open in IMG/M |
| 3300006802|Ga0070749_10300934 | Not Available | 899 | Open in IMG/M |
| 3300006802|Ga0070749_10437415 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 718 | Open in IMG/M |
| 3300006802|Ga0070749_10503239 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 660 | Open in IMG/M |
| 3300006803|Ga0075467_10351236 | Not Available | 775 | Open in IMG/M |
| 3300006803|Ga0075467_10478827 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 641 | Open in IMG/M |
| 3300006921|Ga0098060_1068655 | Not Available | 1027 | Open in IMG/M |
| 3300006921|Ga0098060_1140029 | Not Available | 673 | Open in IMG/M |
| 3300006921|Ga0098060_1197133 | Not Available | 551 | Open in IMG/M |
| 3300006922|Ga0098045_1137331 | Not Available | 567 | Open in IMG/M |
| 3300006925|Ga0098050_1129221 | Not Available | 640 | Open in IMG/M |
| 3300006928|Ga0098041_1228768 | Not Available | 594 | Open in IMG/M |
| 3300006929|Ga0098036_1135213 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300007229|Ga0075468_10077982 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 1078 | Open in IMG/M |
| 3300007231|Ga0075469_10122036 | Not Available | 721 | Open in IMG/M |
| 3300007234|Ga0075460_10192842 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 695 | Open in IMG/M |
| 3300007236|Ga0075463_10269639 | Not Available | 546 | Open in IMG/M |
| 3300007276|Ga0070747_1245271 | Not Available | 623 | Open in IMG/M |
| 3300007344|Ga0070745_1107323 | Not Available | 1087 | Open in IMG/M |
| 3300007344|Ga0070745_1300732 | Not Available | 571 | Open in IMG/M |
| 3300007540|Ga0099847_1111167 | Not Available | 829 | Open in IMG/M |
| 3300007542|Ga0099846_1063099 | Not Available | 1391 | Open in IMG/M |
| 3300007543|Ga0102853_1075014 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 614 | Open in IMG/M |
| 3300007863|Ga0105744_1190488 | Not Available | 515 | Open in IMG/M |
| 3300007960|Ga0099850_1273095 | Not Available | 647 | Open in IMG/M |
| 3300007963|Ga0110931_1022884 | Not Available | 1888 | Open in IMG/M |
| 3300007963|Ga0110931_1231256 | Not Available | 550 | Open in IMG/M |
| 3300007973|Ga0105746_1119325 | Not Available | 876 | Open in IMG/M |
| 3300007974|Ga0105747_1066283 | Not Available | 1087 | Open in IMG/M |
| 3300009058|Ga0102854_1229000 | Not Available | 533 | Open in IMG/M |
| 3300009077|Ga0115552_1424075 | Not Available | 524 | Open in IMG/M |
| 3300009193|Ga0115551_1274582 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 741 | Open in IMG/M |
| 3300009413|Ga0114902_1093710 | Not Available | 807 | Open in IMG/M |
| 3300009414|Ga0114909_1134170 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 660 | Open in IMG/M |
| 3300009414|Ga0114909_1168802 | Not Available | 571 | Open in IMG/M |
| 3300009418|Ga0114908_1248871 | Not Available | 539 | Open in IMG/M |
| 3300009433|Ga0115545_1229969 | Not Available | 626 | Open in IMG/M |
| 3300009433|Ga0115545_1278421 | Not Available | 558 | Open in IMG/M |
| 3300009435|Ga0115546_1260238 | Not Available | 594 | Open in IMG/M |
| 3300009481|Ga0114932_10755409 | Not Available | 564 | Open in IMG/M |
| 3300009505|Ga0115564_10399712 | Not Available | 672 | Open in IMG/M |
| 3300009544|Ga0115006_11991796 | Not Available | 534 | Open in IMG/M |
| 3300009550|Ga0115013_10377331 | Not Available | 898 | Open in IMG/M |
| 3300009604|Ga0114901_1119515 | Not Available | 813 | Open in IMG/M |
| 3300009677|Ga0115104_10359670 | Not Available | 573 | Open in IMG/M |
| 3300009790|Ga0115012_10789186 | Not Available | 768 | Open in IMG/M |
| 3300010148|Ga0098043_1064612 | Not Available | 1101 | Open in IMG/M |
| 3300010150|Ga0098056_1144897 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 803 | Open in IMG/M |
| 3300010153|Ga0098059_1361234 | Not Available | 550 | Open in IMG/M |
| 3300010368|Ga0129324_10319129 | Not Available | 608 | Open in IMG/M |
| 3300010430|Ga0118733_108380968 | Not Available | 534 | Open in IMG/M |
| 3300011261|Ga0151661_1193585 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 827 | Open in IMG/M |
| 3300012954|Ga0163111_11847349 | Not Available | 605 | Open in IMG/M |
| 3300013010|Ga0129327_10709577 | Not Available | 564 | Open in IMG/M |
| 3300017697|Ga0180120_10217493 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 786 | Open in IMG/M |
| 3300017697|Ga0180120_10417519 | Not Available | 525 | Open in IMG/M |
| 3300017706|Ga0181377_1073949 | Not Available | 616 | Open in IMG/M |
| 3300017706|Ga0181377_1081288 | Not Available | 577 | Open in IMG/M |
| 3300017713|Ga0181391_1087925 | Not Available | 707 | Open in IMG/M |
| 3300017717|Ga0181404_1107590 | All Organisms → Viruses | 682 | Open in IMG/M |
| 3300017720|Ga0181383_1013857 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2160 | Open in IMG/M |
| 3300017720|Ga0181383_1167764 | Not Available | 587 | Open in IMG/M |
| 3300017721|Ga0181373_1091345 | Not Available | 540 | Open in IMG/M |
| 3300017727|Ga0181401_1167323 | Not Available | 529 | Open in IMG/M |
| 3300017728|Ga0181419_1071510 | Not Available | 877 | Open in IMG/M |
| 3300017731|Ga0181416_1166818 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 532 | Open in IMG/M |
| 3300017732|Ga0181415_1070645 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 789 | Open in IMG/M |
| 3300017732|Ga0181415_1093569 | Not Available | 677 | Open in IMG/M |
| 3300017743|Ga0181402_1058662 | Not Available | 1028 | Open in IMG/M |
| 3300017746|Ga0181389_1149111 | Not Available | 623 | Open in IMG/M |
| 3300017748|Ga0181393_1068257 | Not Available | 946 | Open in IMG/M |
| 3300017751|Ga0187219_1132836 | Not Available | 729 | Open in IMG/M |
| 3300017751|Ga0187219_1172532 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 611 | Open in IMG/M |
| 3300017753|Ga0181407_1117330 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 665 | Open in IMG/M |
| 3300017753|Ga0181407_1152837 | Not Available | 569 | Open in IMG/M |
| 3300017757|Ga0181420_1176344 | Not Available | 629 | Open in IMG/M |
| 3300017759|Ga0181414_1046388 | Not Available | 1165 | Open in IMG/M |
| 3300017765|Ga0181413_1119203 | Not Available | 801 | Open in IMG/M |
| 3300017765|Ga0181413_1224025 | Not Available | 558 | Open in IMG/M |
| 3300017767|Ga0181406_1121743 | Not Available | 787 | Open in IMG/M |
| 3300017768|Ga0187220_1120565 | Not Available | 793 | Open in IMG/M |
| 3300017770|Ga0187217_1222926 | All Organisms → Viruses | 620 | Open in IMG/M |
| 3300017776|Ga0181394_1101453 | Not Available | 919 | Open in IMG/M |
| 3300017786|Ga0181424_10410217 | Not Available | 550 | Open in IMG/M |
| 3300018036|Ga0181600_10593418 | Not Available | 517 | Open in IMG/M |
| 3300018048|Ga0181606_10171071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1287 | Open in IMG/M |
| 3300018421|Ga0181592_10797273 | Not Available | 622 | Open in IMG/M |
| 3300019751|Ga0194029_1046714 | Not Available | 709 | Open in IMG/M |
| 3300019751|Ga0194029_1051371 | Not Available | 681 | Open in IMG/M |
| 3300019758|Ga0193951_1128307 | All Organisms → Viruses | 569 | Open in IMG/M |
| 3300020165|Ga0206125_10353615 | Not Available | 541 | Open in IMG/M |
| 3300020169|Ga0206127_1244955 | Not Available | 624 | Open in IMG/M |
| 3300020438|Ga0211576_10216284 | All Organisms → Viruses → Predicted Viral | 1016 | Open in IMG/M |
| 3300021375|Ga0213869_10337692 | Not Available | 632 | Open in IMG/M |
| 3300021389|Ga0213868_10175993 | All Organisms → Viruses → Predicted Viral | 1302 | Open in IMG/M |
| 3300021957|Ga0222717_10141775 | Not Available | 1470 | Open in IMG/M |
| 3300021958|Ga0222718_10189318 | Not Available | 1131 | Open in IMG/M |
| 3300021959|Ga0222716_10414172 | Not Available | 779 | Open in IMG/M |
| 3300021959|Ga0222716_10730924 | Not Available | 522 | Open in IMG/M |
| 3300021960|Ga0222715_10667119 | Not Available | 528 | Open in IMG/M |
| 3300022050|Ga0196883_1032201 | Not Available | 638 | Open in IMG/M |
| 3300022061|Ga0212023_1064990 | Not Available | 505 | Open in IMG/M |
| 3300022067|Ga0196895_1038407 | All Organisms → Viruses | 550 | Open in IMG/M |
| 3300022069|Ga0212026_1070390 | All Organisms → Viruses | 531 | Open in IMG/M |
| 3300022074|Ga0224906_1092514 | Not Available | 902 | Open in IMG/M |
| 3300022183|Ga0196891_1059803 | Not Available | 685 | Open in IMG/M |
| (restricted) 3300023210|Ga0233412_10282247 | All Organisms → Viruses | 731 | Open in IMG/M |
| (restricted) 3300023276|Ga0233410_10024421 | Not Available | 1727 | Open in IMG/M |
| (restricted) 3300024259|Ga0233437_1211569 | Not Available | 815 | Open in IMG/M |
| (restricted) 3300024517|Ga0255049_10218203 | Not Available | 872 | Open in IMG/M |
| (restricted) 3300024520|Ga0255047_10669538 | Not Available | 519 | Open in IMG/M |
| 3300025048|Ga0207905_1004373 | All Organisms → Viruses → environmental samples → uncultured virus | 2720 | Open in IMG/M |
| 3300025048|Ga0207905_1011305 | Not Available | 1553 | Open in IMG/M |
| 3300025070|Ga0208667_1021537 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 1248 | Open in IMG/M |
| 3300025070|Ga0208667_1032181 | Not Available | 931 | Open in IMG/M |
| 3300025070|Ga0208667_1061159 | Not Available | 587 | Open in IMG/M |
| 3300025071|Ga0207896_1070562 | Not Available | 545 | Open in IMG/M |
| 3300025083|Ga0208791_1027813 | Not Available | 1089 | Open in IMG/M |
| 3300025086|Ga0208157_1010140 | Not Available | 3147 | Open in IMG/M |
| 3300025086|Ga0208157_1022050 | Not Available | 1926 | Open in IMG/M |
| 3300025086|Ga0208157_1055691 | Not Available | 1048 | Open in IMG/M |
| 3300025086|Ga0208157_1144672 | Not Available | 528 | Open in IMG/M |
| 3300025098|Ga0208434_1032453 | Not Available | 1221 | Open in IMG/M |
| 3300025098|Ga0208434_1053428 | Not Available | 878 | Open in IMG/M |
| 3300025099|Ga0208669_1009812 | Not Available | 2712 | Open in IMG/M |
| 3300025099|Ga0208669_1047271 | Not Available | 994 | Open in IMG/M |
| 3300025102|Ga0208666_1148391 | Not Available | 526 | Open in IMG/M |
| 3300025108|Ga0208793_1140894 | Not Available | 644 | Open in IMG/M |
| 3300025120|Ga0209535_1046727 | Not Available | 1881 | Open in IMG/M |
| 3300025120|Ga0209535_1056870 | Not Available | 1625 | Open in IMG/M |
| 3300025120|Ga0209535_1060982 | Not Available | 1539 | Open in IMG/M |
| 3300025120|Ga0209535_1143271 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 768 | Open in IMG/M |
| 3300025120|Ga0209535_1215006 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 523 | Open in IMG/M |
| 3300025120|Ga0209535_1215024 | Not Available | 523 | Open in IMG/M |
| 3300025132|Ga0209232_1113385 | All Organisms → Viruses | 902 | Open in IMG/M |
| 3300025133|Ga0208299_1186900 | Not Available | 624 | Open in IMG/M |
| 3300025138|Ga0209634_1082194 | Not Available | 1477 | Open in IMG/M |
| 3300025141|Ga0209756_1136784 | Not Available | 1003 | Open in IMG/M |
| 3300025141|Ga0209756_1177868 | Not Available | 832 | Open in IMG/M |
| 3300025151|Ga0209645_1109529 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 887 | Open in IMG/M |
| 3300025168|Ga0209337_1174533 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 903 | Open in IMG/M |
| 3300025168|Ga0209337_1282338 | Not Available | 614 | Open in IMG/M |
| 3300025274|Ga0208183_1038187 | Not Available | 1002 | Open in IMG/M |
| 3300025282|Ga0208030_1118020 | Not Available | 652 | Open in IMG/M |
| 3300025293|Ga0208934_1037773 | Not Available | 915 | Open in IMG/M |
| 3300025300|Ga0208181_1068021 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 711 | Open in IMG/M |
| 3300025508|Ga0208148_1023201 | Not Available | 1742 | Open in IMG/M |
| 3300025543|Ga0208303_1042885 | Not Available | 1137 | Open in IMG/M |
| 3300025543|Ga0208303_1111114 | Not Available | 565 | Open in IMG/M |
| 3300025637|Ga0209197_1086600 | Not Available | 955 | Open in IMG/M |
| 3300025653|Ga0208428_1206375 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 501 | Open in IMG/M |
| 3300025803|Ga0208425_1066179 | Not Available | 880 | Open in IMG/M |
| 3300025806|Ga0208545_1033130 | Not Available | 1646 | Open in IMG/M |
| 3300025809|Ga0209199_1233464 | Not Available | 614 | Open in IMG/M |
| 3300025849|Ga0209603_1214823 | Not Available | 724 | Open in IMG/M |
| 3300025853|Ga0208645_1240653 | Not Available | 610 | Open in IMG/M |
| (restricted) 3300027996|Ga0233413_10464127 | Not Available | 558 | Open in IMG/M |
| (restricted) 3300028045|Ga0233414_10225520 | Not Available | 847 | Open in IMG/M |
| 3300028125|Ga0256368_1024091 | Not Available | 1081 | Open in IMG/M |
| 3300028189|Ga0257127_1083956 | Not Available | 963 | Open in IMG/M |
| 3300029448|Ga0183755_1026690 | Not Available | 1780 | Open in IMG/M |
| 3300029448|Ga0183755_1031233 | Not Available | 1564 | Open in IMG/M |
| 3300029448|Ga0183755_1057931 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 933 | Open in IMG/M |
| 3300031519|Ga0307488_10326403 | Not Available | 977 | Open in IMG/M |
| 3300031519|Ga0307488_10484951 | Not Available | 742 | Open in IMG/M |
| 3300031774|Ga0315331_10569915 | Not Available | 813 | Open in IMG/M |
| 3300032011|Ga0315316_10619423 | Not Available | 903 | Open in IMG/M |
| 3300032073|Ga0315315_10338762 | Not Available | 1400 | Open in IMG/M |
| 3300032073|Ga0315315_11105858 | Not Available | 706 | Open in IMG/M |
| 3300032274|Ga0316203_1039104 | Not Available | 1375 | Open in IMG/M |
| 3300034375|Ga0348336_210961 | Not Available | 508 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 34.31% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 14.71% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 12.75% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 4.41% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 4.41% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 3.43% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 3.43% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.94% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.45% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.96% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 1.96% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.47% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.47% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.98% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.98% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.98% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.98% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.98% |
| Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater Microbial Mat | 0.49% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.49% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 0.49% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 0.49% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.49% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.49% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.49% |
| Estuary Water | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuary Water | 0.49% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.49% |
| Marine Water | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Water | 0.49% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.49% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300001355 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300001720 | Marine viral communities from the Pacific Ocean - LP-36 | Environmental | Open in IMG/M |
| 3300002483 | Marine viral communities from the Pacific Ocean - ETNP_6_30 | Environmental | Open in IMG/M |
| 3300002930 | Estuary water microbial communities from Pearl Estuary, Zhujiang, China | Environmental | Open in IMG/M |
| 3300004277 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_200m | Environmental | Open in IMG/M |
| 3300004941 | Marine water microbial communities from the Pohang Bay, Korea with extracellular vesicles - Pohang-0.2um | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007231 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007236 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007543 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-3 | Environmental | Open in IMG/M |
| 3300007863 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459B_0.2um | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300009058 | Estuarine microbial communities from the Columbia River estuary - metaG 1370A-02 | Environmental | Open in IMG/M |
| 3300009077 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 | Environmental | Open in IMG/M |
| 3300009193 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 | Environmental | Open in IMG/M |
| 3300009413 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12 | Environmental | Open in IMG/M |
| 3300009414 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 | Environmental | Open in IMG/M |
| 3300009418 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009505 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 | Environmental | Open in IMG/M |
| 3300009544 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M Metagenome | Environmental | Open in IMG/M |
| 3300009550 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome | Environmental | Open in IMG/M |
| 3300009604 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 | Environmental | Open in IMG/M |
| 3300009677 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300011261 | Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_4, 0.02 | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017706 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaG | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017721 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaG | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017732 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11 | Environmental | Open in IMG/M |
| 3300017743 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017748 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21 | Environmental | Open in IMG/M |
| 3300017751 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2) | Environmental | Open in IMG/M |
| 3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
| 3300017768 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2) | Environmental | Open in IMG/M |
| 3300017770 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2) | Environmental | Open in IMG/M |
| 3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300018036 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018048 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019751 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MG | Environmental | Open in IMG/M |
| 3300019758 | Microbial mat bacterial communities from the Broadkill River, Lewes, Delaware, United States - BB_2_MG | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020169 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160419_1 | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300022050 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v3) | Environmental | Open in IMG/M |
| 3300022061 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v2) | Environmental | Open in IMG/M |
| 3300022067 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v3) | Environmental | Open in IMG/M |
| 3300022069 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v2) | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022183 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3) | Environmental | Open in IMG/M |
| 3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
| 3300023276 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_1_MG | Environmental | Open in IMG/M |
| 3300024259 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_200_MG | Environmental | Open in IMG/M |
| 3300024517 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_3 | Environmental | Open in IMG/M |
| 3300024520 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_1 | Environmental | Open in IMG/M |
| 3300025048 | Marine viral communities from the Subarctic Pacific Ocean - LP-49 (SPAdes) | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025071 | Marine viral communities from the Pacific Ocean - LP-36 (SPAdes) | Environmental | Open in IMG/M |
| 3300025083 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025098 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025133 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025141 | Marine viral communities from the Pacific Ocean - ETNP_6_85 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025274 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_51 (SPAdes) | Environmental | Open in IMG/M |
| 3300025282 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 (SPAdes) | Environmental | Open in IMG/M |
| 3300025293 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025300 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s6 (SPAdes) | Environmental | Open in IMG/M |
| 3300025508 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025637 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512 (SPAdes) | Environmental | Open in IMG/M |
| 3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025806 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025809 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 (SPAdes) | Environmental | Open in IMG/M |
| 3300025849 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300027996 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MG | Environmental | Open in IMG/M |
| 3300028045 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_10_MG | Environmental | Open in IMG/M |
| 3300028125 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB | Environmental | Open in IMG/M |
| 3300028189 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI060_135m | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031774 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915 | Environmental | Open in IMG/M |
| 3300032011 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416 | Environmental | Open in IMG/M |
| 3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
| 3300032274 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 1 | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_101700133 | 3300000101 | Marine | MENELKRIADALEEVIRMVKKDQEETKARYEKHWDKEDE* |
| DelMOSum2010_102034692 | 3300000101 | Marine | MEQELKRIADALELVIQMVKKDQEETKARFEERWDKEDKEAAQ* |
| DelMOSum2010_102160013 | 3300000101 | Marine | MDNEQLKRIADAMEEIIRMVKKDQQETRERFEKRWDKEDE* |
| DelMOSum2010_102296071 | 3300000101 | Marine | MYIERYIMDNEQLKRIADAMEEILRLVKKDQQETRARFEERWDKEDKEAAQ* |
| DelMOSum2010_102593651 | 3300000101 | Marine | MEHELKRIADALELVIQMVKKDQEETRARFEERWDKEDSEEN* |
| DelMOSum2010_102729752 | 3300000101 | Marine | LPCNTYLERYNMDNEQLKRIADALEEVLRLVKKDQQETRERFEKRWDKEDE* |
| DelMOSum2011_101040442 | 3300000115 | Marine | MDNEQLKRIADAXEEVLRLVKKDQQETRERFEKRWDKEDE* |
| JGI20158J14315_101856601 | 3300001355 | Pelagic Marine | HELKRIADALELVIQMVKKDQEETKARFEERWDKEDKEAAQ* |
| JGI24006J15134_101236661 | 3300001450 | Marine | MEQELKRIADALEEVIRMVKKDQQETRERFEKRWDKEDE* |
| JGI24006J15134_101589422 | 3300001450 | Marine | MEHELKRIADALELVIQMVKKDQEETXARFEERWDKEDNEKN* |
| JGI24003J15210_100600063 | 3300001460 | Marine | MNNEKTELQRIADALEEILRLVKKDQQETRERFEKHWDKEDE* |
| JGI24003J15210_101543541 | 3300001460 | Marine | YLERNIMEHELKRIADALELVIQMVKKDQEETRARFEERWDKEDNEKN* |
| JGI24003J15210_101598441 | 3300001460 | Marine | LKRIADALEEVIRMVKKDQQETKERFEKRWDKEDE* |
| JGI24003J15210_101826161 | 3300001460 | Marine | GIIMEHELKRIADALELVIQMVKKDQEETKERFEKRWDKEDE* |
| JGI24004J15324_101080241 | 3300001472 | Marine | MVQGSCRMYLERNIMEDIYEKIKASELKRIADALEEVIRMVKKDQQETRERFEKRWDKEDE* |
| JGI24004J15324_101263423 | 3300001472 | Marine | MEHELKRIADALELVIQMVKKDQEETKARFEERWDKEDNEKN* |
| JGI24005J15628_101638423 | 3300001589 | Marine | NIMEHELKRIADALELVIQMVKKDQEETRARFEERWDKEDNEKN* |
| JGI24005J15628_101828152 | 3300001589 | Marine | RMYLERNIMEHELKRIADALELVIQMVKKDQEETRARFEERWDKEDKEAAQ* |
| JGI24513J20088_10115133 | 3300001720 | Marine | MENELKRIADAMEEIIRMVKKDQQETRERFEKRWDKE |
| JGI24513J20088_10180541 | 3300001720 | Marine | MEHELKRIADALELVIQMVKKDQEETKERFEKRWDKEDE* |
| JGI25132J35274_10137263 | 3300002483 | Marine | MEHELKRIADALELVIQMVKKDQEETRARFEERWDKEDSEKN* |
| Water_1037093 | 3300002930 | Estuary Water | MEHELKRIADALELVIQMVKKDQEETKARFEERWDKEDKEAAQ* |
| Ga0066611_102941311 | 3300004277 | Marine | MENELKRIADALEEVIRMVKKDQQETRERFEKRWDKEDE* |
| Ga0068514_10411961 | 3300004941 | Marine Water | MEHELKRIADALELVIQMVKKDQEETRARFEERWDKEDKEAAQ* |
| Ga0075478_101816283 | 3300006026 | Aqueous | MDNEQLKRIADALEEVLRLVKKDQQETRERFEKRWDKEDE* |
| Ga0075462_100584853 | 3300006027 | Aqueous | RMYLERNIMEHELKRIADALELVIQMVKKDQEETKARFEERWDKEDKEAAQ* |
| Ga0098038_10815511 | 3300006735 | Marine | ERNIMEHELKRIADALELVIQMVKKDQEETKARFEERWDKEDNEKN* |
| Ga0098038_11036023 | 3300006735 | Marine | ADALELVIQMVKKDQEETRARFEERWDKEDQEAAQ* |
| Ga0098038_11270393 | 3300006735 | Marine | MEHELKRIADALEEVIRMVKKDQEDTRARFEERWDKEDSEKN* |
| Ga0098038_11762653 | 3300006735 | Marine | MEHELKRIADALELVIQMVKKDQEETRARFEERWDKEDQEAAQ* |
| Ga0098038_12961041 | 3300006735 | Marine | MEHELKRIADALELVIQMVKKDQEETKARFEERWD |
| Ga0098037_11979952 | 3300006737 | Marine | MENELKRIADALEEVIRMVKKDQQETRARFEERWDKEDQEAAQ* |
| Ga0098037_13013372 | 3300006737 | Marine | MEHELKRIADALELVIQMVKKDQEETKARFEERWDKEDQEAAQ*AAVPAGP |
| Ga0098048_10960654 | 3300006752 | Marine | MEHELKRIADALELVIQMVKKDQEETKARFEERWDKEDQEAAQ*A |
| Ga0070749_103009342 | 3300006802 | Aqueous | MEQELKRIADALEEVIRMVKKDQQETKERFEKRWDKEDE* |
| Ga0070749_104374152 | 3300006802 | Aqueous | MYLERNIMEHELKRIADALELVIQMVKKDQEETKARFEERWDKEDKEAAQ* |
| Ga0070749_105032392 | 3300006802 | Aqueous | MDNEQLKRIADALELVIQMVKKDQEETRARFEERWDKEDKEAAQ* |
| Ga0075467_103512362 | 3300006803 | Aqueous | MDNEQLKRIADAMEEILRLVKKDQQETRARFEERWDKEDKEAAQ* |
| Ga0075467_104788271 | 3300006803 | Aqueous | DALELVIQMVKKDQEETRARFEERWDKEDKEAAQ* |
| Ga0098060_10686551 | 3300006921 | Marine | RIADALEEVIRMVKKDQQETKARFEERWDKEDQEAAQ* |
| Ga0098060_11400292 | 3300006921 | Marine | MENELKRIADALEEVIRMVKKDQQETRARFEERWDKEDQEAA |
| Ga0098060_11971332 | 3300006921 | Marine | MSNETKTEYQFRRIADALEEVIRMVKKDQQETKARFEER |
| Ga0098045_11373312 | 3300006922 | Marine | MEHELKRIADALELVIQMVKKDQEETRARFEKRWDKEDEEAAQ* |
| Ga0098050_11292211 | 3300006925 | Marine | KRIADALEEVIRMVKKDQQETKERFEKRWDKEDE* |
| Ga0098041_12287682 | 3300006928 | Marine | MSESSEELKRIADALELVIQMVKKDQEETRARFEERWDKEDSEKN* |
| Ga0098036_11352133 | 3300006929 | Marine | MENELKRIADALELVIQMVKKDQEETRARFEERWDKEDKEAAQ* |
| Ga0075468_100779822 | 3300007229 | Aqueous | MYLERYIMDNEQLKRIADAMEEIIRMVKKDQQETRERFEKRWDKEDE* |
| Ga0075469_101220363 | 3300007231 | Aqueous | MYLERNIMEHELKRIADALELVIQMVKKDQEETRARFEERWDKEDKEAAQ* |
| Ga0075460_101928422 | 3300007234 | Aqueous | IMEHELKRIADALELVIQMVKKDQEETKARFEERWDKEDKEAAQ* |
| Ga0075463_102696391 | 3300007236 | Aqueous | MYLERYNMDNEQLKRIADAMEEIIRMVKKDQQETRERFEKRWDKEDE* |
| Ga0070747_12452711 | 3300007276 | Aqueous | MYIERYIMDNEQLKRIADAMEEIIRMVKKDQQETRERFEKRWDKE |
| Ga0070745_11073231 | 3300007344 | Aqueous | MEHELKRIADALELVIQMVKKDQEETKERFEKRWDKEDD* |
| Ga0070745_13007322 | 3300007344 | Aqueous | EHELKRIADALELVIQMVKKDQEETKARFEERWDKEDKEAAQ* |
| Ga0099847_11111671 | 3300007540 | Aqueous | MDNEQLKRIADALELVIQMVKKDQEETRARLEERWDKEDKEAAQ* |
| Ga0099846_10630993 | 3300007542 | Aqueous | SINPLIRIAETLEEILRLVKKDQQETRARFEERWDKEDKEAAQ* |
| Ga0102853_10750141 | 3300007543 | Estuarine | MENELKRIADALEEVIRMVKKDQQETKERFEKRWDKEDE* |
| Ga0105744_11904882 | 3300007863 | Estuary Water | MYIERNIMENELKRIADALEEVIRMVKKDQQETKERFEKRWD |
| Ga0099850_12730952 | 3300007960 | Aqueous | YLERNIMEHELKRIADALELVIQMVKKDQEETKARFEERWDKEDKEAAQ* |
| Ga0110931_10228844 | 3300007963 | Marine | MDLERNIMEHELKRIADALELVIQMVKKDQEETRARFEERWDKEDKEAAQ* |
| Ga0110931_12312561 | 3300007963 | Marine | MYLERNIMEHELKRIADALELVIQMVKKDQEETKARFEERWDKEDNEKN* |
| Ga0105746_11193252 | 3300007973 | Estuary Water | MDNEQLKRIADAIEEILRLVKKDQQETRARFEERWDKEDQEAAQ* |
| Ga0105747_10662832 | 3300007974 | Estuary Water | MYLERNIMEHELKRIADALELVIQMVKKDQEETKERFEKRWDKEDE* |
| Ga0102854_12290001 | 3300009058 | Estuarine | MYIERYIMDNEQLKRIADAMEEIIRMVKKDQQETRERFEKRWDKEDE* |
| Ga0115552_14240751 | 3300009077 | Pelagic Marine | CRMYLERNIMEHELKRIADALELVIQMVKKDQEETKARFEERWDKEDKEAAQ* |
| Ga0115551_12745821 | 3300009193 | Pelagic Marine | MYLERNIMEHELKRIADALELVIQMVKKDQEETKARFEERWYKEDKEAAQ* |
| Ga0114902_10937102 | 3300009413 | Deep Ocean | KRIADALELVIQMVKKDQEETKARFEERWDKEDQEAAQ* |
| Ga0114909_11341701 | 3300009414 | Deep Ocean | KRIADALELVIQMVKKDQEETRARFEERWDKEDQEAAQ* |
| Ga0114909_11688021 | 3300009414 | Deep Ocean | IANDNLKRIADALELVIQMVKKDQEETKARYEKHWDKEDE* |
| Ga0114908_12488711 | 3300009418 | Deep Ocean | MSNETKTEYQFRRIADALEEVLRLVKEDQEAAKKRWEYK |
| Ga0115545_12299691 | 3300009433 | Pelagic Marine | MEHELKRIADALEEVIRMVKKDQQETKERFEKRWDKEDE* |
| Ga0115545_12784212 | 3300009433 | Pelagic Marine | IMEHELKRIADALELVIQMVKKDQEETRARFEERWDKEDSEKN* |
| Ga0115546_12602384 | 3300009435 | Pelagic Marine | KRIADALELVIQMVKKDQEETKARFEERWDKEDNEKN* |
| Ga0114932_107554093 | 3300009481 | Deep Subsurface | KRIADALELVIQMVKKDQEETRARFEERWDKEDKEAAQ* |
| Ga0115564_103997122 | 3300009505 | Pelagic Marine | IADALDEILRLVKKDQQETRARFEERWDKEDQEAAQ* |
| Ga0115006_119917961 | 3300009544 | Marine | MDNEQLKRIADAMEEIIRMVKKDQQETRERFEKRWEKEDE* |
| Ga0115013_103773312 | 3300009550 | Marine | MDLERNIMEQELKRIADALELVIQMVKKDQEETRARFEERWDKEDKEAAQ* |
| Ga0114901_11195151 | 3300009604 | Deep Ocean | KRIADALELVIQMVKKDQEETKARFEERWDKEDKEAAQ* |
| Ga0115104_103596701 | 3300009677 | Marine | MEHELKRIADALELVIQMVKKDQEETKARFEERWDKEDKEA |
| Ga0115012_107891861 | 3300009790 | Marine | MYLERNIMEHELKRIADALELVIQMVKKDQEETRARFEERWDKEDSEKN* |
| Ga0098043_10646123 | 3300010148 | Marine | MEHELKRIADALELVIQMVKKDQEETRARFEKRWDKEDQEAAQ* |
| Ga0098056_11448971 | 3300010150 | Marine | LKRIADALEEVIRMVKKDQQETKARFEERWDKEDQEAAQ* |
| Ga0098059_13612341 | 3300010153 | Marine | MEHELKRIADALELVIQMVRKDQEETKARFEERWDKEDKEAAQ* |
| Ga0129324_103191292 | 3300010368 | Freshwater To Marine Saline Gradient | MYLVRYNMDNEQLKRIADAMEEIIRMVKKDQQETRERFEKRWDKEDE* |
| Ga0118733_1083809681 | 3300010430 | Marine Sediment | MENELKRIADALELVIQMVKKDQEETKARFEERWDKEDKEAAQ* |
| Ga0151661_11935851 | 3300011261 | Marine | MYLERNIMEHELKRIADALELVIQMVKKDQEETRARFEERWDKEDNEKN* |
| Ga0163111_118473491 | 3300012954 | Surface Seawater | MEQELKRIADALEEVIRMVKKDQQETRARFEERWDKEDQEAAQ* |
| Ga0129327_107095771 | 3300013010 | Freshwater To Marine Saline Gradient | MEHELKRIADALELVIQMVKKDQEETKARFEERWDKEDSEKN* |
| Ga0180120_102174932 | 3300017697 | Freshwater To Marine Saline Gradient | MEHELKRIADALELVIQMVKKDQEETKARYEKHWDKEDKEAAQ |
| Ga0180120_104175191 | 3300017697 | Freshwater To Marine Saline Gradient | TYIERYNMDNEQLKRIADALEEVLRLVKKDQQETRERFEKRWDKEDE |
| Ga0181377_10739491 | 3300017706 | Marine | MEHELKRIADALEEVIRMVKKDQQETRARFEERWDKENQEAAQ |
| Ga0181377_10812881 | 3300017706 | Marine | YLERNIMDNEQLKRIADAMEEIIRMVKKDQQETRERFEKRWDKEDE |
| Ga0181391_10879252 | 3300017713 | Seawater | MEHELKRIADALELVIQMVKKDQQETKERFEKRWDKEDE |
| Ga0181404_11075901 | 3300017717 | Seawater | MYLERYIMDNEQLKRIADAMEEIIRMVKKDQQETRERFEKRWDKEDE |
| Ga0181383_10138576 | 3300017720 | Seawater | EHELKRIADALELVIQMVKKDQEETRARFEERWDKEDKEAAQ |
| Ga0181383_11677641 | 3300017720 | Seawater | MYLERYIMENKLKRIADAMEEIIRMVKKDQQETRERFEKRWDKEDE |
| Ga0181373_10913451 | 3300017721 | Marine | MEHELKRIADALEEVIRMVKKDQQETKARFEERWDKE |
| Ga0181401_11673231 | 3300017727 | Seawater | LKRIADALELVIQMVKKDQEETKERFEKRWDKEDD |
| Ga0181419_10715101 | 3300017728 | Seawater | YRMYLERYIMENELKRIADALEEVIRMVKKDQQETKERFEKRWDKEDE |
| Ga0181416_11668181 | 3300017731 | Seawater | IIIEHELKRIADALELVIQMVKKDQEETRARFEERWDKEDNEKN |
| Ga0181415_10706451 | 3300017732 | Seawater | RMYLERNIMEHELKRIADALELVIQMVKKDQEETKERFEKRWDKEDD |
| Ga0181415_10935692 | 3300017732 | Seawater | MEHELKRIADALELVIQMVKKDQEETRARFEERWDKEDQEAAQXAAVPAGP |
| Ga0181402_10586621 | 3300017743 | Seawater | YDRMYLERNIMEHELKRIADALELVIQMVKKDQEEIKERFEKRWDKEDD |
| Ga0181389_11491112 | 3300017746 | Seawater | MEHELKRIADALELVIQMVKKDQQETKERFEKRWDKEDQEAAQ |
| Ga0181393_10682574 | 3300017748 | Seawater | NIMEHELKRIADALELVIQMVKKDQEETKERFEKRWDKEDD |
| Ga0187219_11328362 | 3300017751 | Seawater | MENELKRIADALEEILRLVKEDQERTRARFEERWDKEDE |
| Ga0187219_11725321 | 3300017751 | Seawater | QGEQLKRIADALELVIQMVKKDQEETKARFEERWDKEDQEAAQ |
| Ga0181407_11173301 | 3300017753 | Seawater | IMEHELKRIADALELVIQMVKKDQEETRARFEERWDKEDNEKN |
| Ga0181407_11528371 | 3300017753 | Seawater | MDNEQLKRIADALELVIQMVKKDQEETRARFEERWDKEDQEAAQXAAVP |
| Ga0181420_11763442 | 3300017757 | Seawater | MEHELKRIAVALELVIQMVKKDQEENRARFEERWDKEDQEAA |
| Ga0181414_10463883 | 3300017759 | Seawater | IMEHELKRIADALELVIQMVKKDQEETKARFEERWDKEDQEAAQ |
| Ga0181413_11192033 | 3300017765 | Seawater | LNRIANAMEEVIQMVKKDQEETKARFEERWDKEDNEKN |
| Ga0181413_12240251 | 3300017765 | Seawater | MENELKRIADAMEEIIRMVKKDQQETRERFEKRWDKED |
| Ga0181406_11217433 | 3300017767 | Seawater | ERYIMDNEQLKRIADAMEEIIRMVKKDQQETRERFEKRWDKEDE |
| Ga0187220_11205652 | 3300017768 | Seawater | MYLERNIMENELKRIADAMEEIIRMVKKDQQETRERFEKRWDKEDE |
| Ga0187217_12229262 | 3300017770 | Seawater | MEQELKRIADALEEVIRIVKKDQQETKERFEKRWDKEDE |
| Ga0181394_11014531 | 3300017776 | Seawater | ITRIANYMEEILRLVKKDQQETRERFEKRWDKEDQEAAQ |
| Ga0181424_104102171 | 3300017786 | Seawater | YLERNIMEHELKRIADALEEVIRMVKKDQQETKERFEKRWDKEDE |
| Ga0181600_105934181 | 3300018036 | Salt Marsh | RIADALELVIQMVKKDQEETRARFEERWDKEDQEAAQ |
| Ga0181606_101710711 | 3300018048 | Salt Marsh | SEGEQLKRIADALELVIQMVKKDQEETRARFEERWDKEDNEKN |
| Ga0181592_107972731 | 3300018421 | Salt Marsh | ADALELVIQMVKKDQEETRARFEERWDKEDQEAAQ |
| Ga0194029_10467142 | 3300019751 | Freshwater | MEHELKRIADALELVIQMVKKDQEETRARFEERWDKEDKEAAQ |
| Ga0194029_10513711 | 3300019751 | Freshwater | MDNEQLKRIADALEEVLRLVKKDQQETRERFEKRWDKEDE |
| Ga0193951_11283071 | 3300019758 | Freshwater Microbial Mat | RSVNPLIRIANTLEEILRLVKKDQEETRARFEERWDKEDNEKN |
| Ga0206125_103536152 | 3300020165 | Seawater | MDNEQLKRIADAMEEIIRMVKKDQQETRERFEKRWDKEDE |
| Ga0206127_12449552 | 3300020169 | Seawater | MDTTQLKRIADALDEILRLVKKDQQETRARFEERWDKEDNEKN |
| Ga0211576_102162842 | 3300020438 | Marine | MYLERYIMENELKRIADAMEEIIRMVKKDQQETRERFEKRWDKEDE |
| Ga0213869_103376921 | 3300021375 | Seawater | NEQLKRIADALEEVLRLVKKDQQETRERFEKRWDKEDE |
| Ga0213868_101759931 | 3300021389 | Seawater | MENELKRIADALELVIQMVKKDQEETRARFEERWDKEDKEAAQ |
| Ga0222717_101417754 | 3300021957 | Estuarine Water | MEQELKRIADALEEVIRMVKKDQQETKERFEKRWDKEDE |
| Ga0222718_101893181 | 3300021958 | Estuarine Water | IAETLEEILRLVKKDQQETRARFEERWDKEDQEAAQ |
| Ga0222716_104141722 | 3300021959 | Estuarine Water | LKRIADALELVIQMVKKDQEETRTRFEERWDKEDQEAAQ |
| Ga0222716_107309243 | 3300021959 | Estuarine Water | LNEGVTRIANYMEEILRLVKKDQQETRERFEKRWDKEDQEAAQ |
| Ga0222715_106671191 | 3300021960 | Estuarine Water | MEHELKRIADALELVIQMVKKDQEETRARFEERWDKEDQEAAQ |
| Ga0196883_10322011 | 3300022050 | Aqueous | MEHELKRIADALELVIQMVKKDQEETKERFEKRWDKEDD |
| Ga0212023_10649901 | 3300022061 | Aqueous | MEHELKRIADALELVIQMVKKDQEETRARFEERWDKEDSEEN |
| Ga0196895_10384072 | 3300022067 | Aqueous | FNPLIRIANTLEEILRLVKKDQEETRARFEERWDKEDNEKN |
| Ga0212026_10703901 | 3300022069 | Aqueous | CRIYLERNIMEHELKRIADALELVIQMVKKDQEETRARFEERWDKEDKEAAQ |
| Ga0224906_10925142 | 3300022074 | Seawater | MDTTQLKRIADALEEVLRLVKEDQERTRARFEERWDKEDE |
| Ga0196891_10598032 | 3300022183 | Aqueous | CNTYIERYNMDNEQLKRIADALEEVLRLVKKDQQETRERFEKRWDKEDE |
| (restricted) Ga0233412_102822472 | 3300023210 | Seawater | MDNEQLKRIADAMEEILRLVKKDQQETRARFEERWDKEDKEAAQ |
| (restricted) Ga0233410_100244212 | 3300023276 | Seawater | MDNEQLKRIANAMEEILRLVKKDQQETRARFEERWDKEDKEAAQ |
| (restricted) Ga0233437_12115691 | 3300024259 | Seawater | MEHELKRIADALELVIQMVKKDQEETKARFEERWDKEDKEAAQ |
| (restricted) Ga0255049_102182032 | 3300024517 | Seawater | MDNEQLKRIANAMEEILRLVKKDQQETRTRFEERWDKEDKEAAQ |
| (restricted) Ga0255047_106695381 | 3300024520 | Seawater | MENELKRIADALEEVIRMVKKDQQETKERFEKRWDKEDE |
| Ga0207905_10043732 | 3300025048 | Marine | MENELKRIADAMEEIIRMVKKDQQETRERFEKRWDKEDE |
| Ga0207905_10113053 | 3300025048 | Marine | MENELKRIADALEEVIQMVKKDQQETKERFEKRWDKEDE |
| Ga0208667_10215374 | 3300025070 | Marine | MEHELKRIADALELVIQMVKKDQEETKARFEERWDKEDQEAAQ |
| Ga0208667_10321812 | 3300025070 | Marine | MSNETKTEYQFRRIADALEEVIRMVKKDQEETRARFEERWDKEDKEAAQ |
| Ga0208667_10611592 | 3300025070 | Marine | MEHELKRIADALEEVIRMVKKDQQETKERFEKRWDKEDE |
| Ga0207896_10705621 | 3300025071 | Marine | MYIERNIMENELKRIADALEEVIRMVKKDQQETKERFEKRWDKEDE |
| Ga0208791_10278133 | 3300025083 | Marine | MEHELKRIADALEEVIRMVKKDQQETRARFEERWDKEDQEAAQ |
| Ga0208157_10101403 | 3300025086 | Marine | MEHELKRIADALELVIQMVKKDQEETKARFEERWDKEDNEKN |
| Ga0208157_10220501 | 3300025086 | Marine | MEHELKRIADALEEVIRMVKKDQQETKARFEERWDKEDQEAA |
| Ga0208157_10556911 | 3300025086 | Marine | MENELKRIADALEEVIRMVKKDQQETRARFEERWDKEDQEAAQ |
| Ga0208157_11446721 | 3300025086 | Marine | MEHELKRIADALELVIQMVRKDQEETKARFEERWDKEDKEAAQ |
| Ga0208434_10324531 | 3300025098 | Marine | LKRIADALELVIQMVKKDQEETKARFEERWDKEDQEAAQ |
| Ga0208434_10534283 | 3300025098 | Marine | MEHELKRIADALELVIQMVKKDQEETRARFEKRWDKEDEEAAQ |
| Ga0208669_10098128 | 3300025099 | Marine | MDLERNIMEHELKRIADALELVIQMVKKDQEETRARFEERWDKEDKEAAQ |
| Ga0208669_10472712 | 3300025099 | Marine | MEHELKRIADALEEVIRMVKKDQEDTRARFEERWDKEDSEKN |
| Ga0208666_11483911 | 3300025102 | Marine | MSNETKTEYQFRRIADALEEVIRMVKKDQQETKARFEERWDKED |
| Ga0208793_11408941 | 3300025108 | Marine | MSNETKTEYQFRRIADALEEVIRMVKKDQEETRARFEERWDKEDKEAAQXVAVP |
| Ga0209535_10467272 | 3300025120 | Marine | MNNEKTELQRIADALEEILRLVKKDQQETRERFEKHWDKEDE |
| Ga0209535_10568701 | 3300025120 | Marine | MEQELKRIADALEEVIRMVKKDQQETRERFEKRWDKEDE |
| Ga0209535_10609821 | 3300025120 | Marine | MYLERYIMENELKRIADALEEVIRMVKKDQQETRERFEKRWDKEDE |
| Ga0209535_11432711 | 3300025120 | Marine | MEHELKRIADALELVIQMVKKDQEETRARFEERWDKEDNEKN |
| Ga0209535_12150061 | 3300025120 | Marine | MYIERNIMEHELKRIADALELVIQMVKKDQEETRARFEERWDKEDNEKN |
| Ga0209535_12150243 | 3300025120 | Marine | RMYIERNIMENELKRIADALEEVIRMVKKDQQETRERFEKRWDKEDD |
| Ga0209232_11133853 | 3300025132 | Marine | MDTTQLKRIADALEEILRLVKEDQERTRARFEERWDKEDE |
| Ga0208299_11869002 | 3300025133 | Marine | MEHELKRIADALEEVIRMVKKDQQETKARFEERWDKEDQE |
| Ga0209634_10821942 | 3300025138 | Marine | MENELKRIADALEEVIRMVKKDQQETKERFEKRWDK |
| Ga0209756_11367843 | 3300025141 | Marine | QLKRIADALEEVLRLVKEDQERTRARFEERWDKEDE |
| Ga0209756_11778681 | 3300025141 | Marine | MEHELKRIADALELVIQMVKKDQEETKARFEERWNKEDQEAAQ |
| Ga0209645_11095292 | 3300025151 | Marine | MEHELKRIADALELVIQMVKKDQEETRARFEERWDKEDSEKN |
| Ga0209337_11745332 | 3300025168 | Marine | MEHELKRIADALELVIQMVKKDQEETRARFEERWDKE |
| Ga0209337_12823382 | 3300025168 | Marine | MYIERYIMDNEQLKRIADAMEEIIRMVKKDQQETRERFEKRWDKEDE |
| Ga0208183_10381873 | 3300025274 | Deep Ocean | MYLERNIMEHELKRIADALELVIQMVKKDQEETKARYEKHWDKEDE |
| Ga0208030_11180202 | 3300025282 | Deep Ocean | MSESSEELKRIADALELVIQMVKKDQEETKARFEERWDKEDQEAAQ |
| Ga0208934_10377733 | 3300025293 | Deep Ocean | GEQLKRIADALELVIQMVKKDQEETRARFEERWDKEDKEAAQ |
| Ga0208181_10680211 | 3300025300 | Deep Ocean | ADALELVIQMVKKDQEETKARFEERWDKEDKEAAQ |
| Ga0208148_10232012 | 3300025508 | Aqueous | MDNEQLKRIADALELVIQMVKKDQEETRARFEERWDKEDKEAAQ |
| Ga0208303_10428852 | 3300025543 | Aqueous | MYLERNIMEHELKRIADALELVIQMVKKDQEETKARFEERWDKEDKEAAQ |
| Ga0208303_11111142 | 3300025543 | Aqueous | MDNEQLKRIADAMEEILRLVKKDQQETRARFEERWDK |
| Ga0209197_10866001 | 3300025637 | Pelagic Marine | VTQLRRIADALDEILRLVKKDQQETRARFEERWDKEDNEKN |
| Ga0208428_12063752 | 3300025653 | Aqueous | ELKRIADALELVIQMVKKDQEETRARFEERWDKEDKEAAQ |
| Ga0208425_10661791 | 3300025803 | Aqueous | IRIAETLEEILRLVKKDQQETRARFEERWDKEDQEAAQ |
| Ga0208545_10331303 | 3300025806 | Aqueous | MEHELKRIADALELVIQMVKKDQEETKARYEKHWD |
| Ga0209199_12334642 | 3300025809 | Pelagic Marine | MDNEQLKRIADAIEEILRLVKKDQQETRARFEERWDKEDSEKN |
| Ga0209603_12148231 | 3300025849 | Pelagic Marine | YIMDNEQLKRIADAMEEIIRMVKKDQQETRERFEKRWDKEDE |
| Ga0208645_12406532 | 3300025853 | Aqueous | ERNIMEHELKRIADALELVIQMVKKDQEETKARFEERWDKEDKEAAQ |
| (restricted) Ga0233413_104641271 | 3300027996 | Seawater | MDNEQLKRIADAIEEILRLVKKDQQETRARFEERWDKEDQEAAQ |
| (restricted) Ga0233414_102255203 | 3300028045 | Seawater | IERYIMDNEQLKRIADAIEEILRLVKKDQQETRARFEERWDKEDKEAAQ |
| Ga0256368_10240912 | 3300028125 | Sea-Ice Brine | DELKRIADALEEVIRMVKKDQQETKERFEKRWDKEDE |
| Ga0257127_10839562 | 3300028189 | Marine | MENELKRIADALEEVIRMVKKDQQETRERFEKRWDKEDE |
| Ga0183755_10266901 | 3300029448 | Marine | RIADALELVIQMVKKDQEETKARFEERWDKEDKEAAQ |
| Ga0183755_10312331 | 3300029448 | Marine | MKLYDQGEQLKRXXXXVIQMVKKDQEETRARFEERWDKEDKEAAQ |
| Ga0183755_10579312 | 3300029448 | Marine | MEHELKRIADALELVIQMVKKDQEETKARFEERWDKEDSEKN |
| Ga0307488_103264033 | 3300031519 | Sackhole Brine | MDNEQLKRIADAIEEILRLVKKDQQETRARFEERWDKEDKEAAQ |
| Ga0307488_104849511 | 3300031519 | Sackhole Brine | MDNEQLKRIADAIEEILRLVKKDQQETRARFEERWDKE |
| Ga0315331_105699152 | 3300031774 | Seawater | RIADALEEVIRMVKKDQQETKARFEERWDKEDQEAAQ |
| Ga0315316_106194231 | 3300032011 | Seawater | MEHELKRIADALEEVIRMVKKDQQETKARFEERWDKEDQEAAQ |
| Ga0315315_103387621 | 3300032073 | Seawater | HELKRIADALELVIQMVKKDQEETKARFEERWDKEDQEAAQ |
| Ga0315315_111058582 | 3300032073 | Seawater | ITELRRIADALDTVIKMVKKDQQETRERFEKRWDKEDE |
| Ga0316203_10391041 | 3300032274 | Microbial Mat | MENELKRIADALELVIQMVKKDQEETKARFEERWDKEDKEAAQ |
| Ga0348336_210961_1_156 | 3300034375 | Aqueous | MYIERYIMDNEQLKRIADAMEEILRLVKKDQQETRARFEERWDKEDKEAAQ |
| ⦗Top⦘ |