Basic Information | |
---|---|
Family ID | F024696 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 204 |
Average Sequence Length | 40 residues |
Representative Sequence | LGGIYRSTWLGGQVASPRDKEGYPGITINPKLTISGVA |
Number of Associated Samples | 93 |
Number of Associated Scaffolds | 204 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 7.39 % |
% of genes near scaffold ends (potentially truncated) | 97.55 % |
% of genes from short scaffolds (< 2000 bps) | 96.08 % |
Associated GOLD sequencing projects | 93 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.14 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (55.392 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (95.588 % of family members) |
Environment Ontology (ENVO) | Unclassified (99.510 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Unclassified (51.471 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.55% β-sheet: 0.00% Coil/Unstructured: 95.45% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.14 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 204 Family Scaffolds |
---|---|---|
PF01025 | GrpE | 0.98 |
PF05764 | YL1 | 0.98 |
PF05514 | HR_lesion | 0.98 |
PF13966 | zf-RVT | 0.49 |
PF00009 | GTP_EFTU | 0.49 |
PF03040 | CemA | 0.49 |
PF00931 | NB-ARC | 0.49 |
PF14389 | Lzipper-MIP1 | 0.49 |
PF01148 | CTP_transf_1 | 0.49 |
PF02364 | Glucan_synthase | 0.49 |
PF01133 | ER | 0.49 |
PF00249 | Myb_DNA-binding | 0.49 |
PF00271 | Helicase_C | 0.49 |
PF14538 | Raptor_N | 0.49 |
PF03194 | LUC7 | 0.49 |
PF04542 | Sigma70_r2 | 0.49 |
PF03552 | Cellulose_synt | 0.49 |
PF10513 | EPL1 | 0.49 |
PF05699 | Dimer_Tnp_hAT | 0.49 |
PF03416 | Peptidase_C54 | 0.49 |
COG ID | Name | Functional Category | % Frequency in 204 Family Scaffolds |
---|---|---|---|
COG0576 | Molecular chaperone GrpE (heat shock protein HSP-70) | Posttranslational modification, protein turnover, chaperones [O] | 0.98 |
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.49 |
COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.49 |
COG1215 | Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase | Cell motility [N] | 0.49 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.49 |
COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.49 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 55.39 % |
All Organisms | root | All Organisms | 44.61 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300005843|Ga0068860_102606867 | Not Available | 525 | Open in IMG/M |
3300009992|Ga0105120_1003395 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida | 1281 | Open in IMG/M |
3300015280|Ga0182100_1043644 | Not Available | 668 | Open in IMG/M |
3300015290|Ga0182105_1001824 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida | 1675 | Open in IMG/M |
3300015290|Ga0182105_1053355 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 645 | Open in IMG/M |
3300015293|Ga0182103_1020775 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 825 | Open in IMG/M |
3300015293|Ga0182103_1026894 | Not Available | 768 | Open in IMG/M |
3300015297|Ga0182104_1026476 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 838 | Open in IMG/M |
3300015309|Ga0182098_1052786 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis | 685 | Open in IMG/M |
3300015309|Ga0182098_1116060 | Not Available | 521 | Open in IMG/M |
3300015310|Ga0182162_1029775 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 841 | Open in IMG/M |
3300015313|Ga0182164_1030344 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 865 | Open in IMG/M |
3300015313|Ga0182164_1104955 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 559 | Open in IMG/M |
3300015315|Ga0182120_1085970 | Not Available | 607 | Open in IMG/M |
3300015317|Ga0182136_1031736 | Not Available | 859 | Open in IMG/M |
3300015317|Ga0182136_1035483 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida | 828 | Open in IMG/M |
3300015317|Ga0182136_1116347 | Not Available | 543 | Open in IMG/M |
3300015319|Ga0182130_1031601 | Not Available | 837 | Open in IMG/M |
3300015319|Ga0182130_1061017 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 675 | Open in IMG/M |
3300015319|Ga0182130_1069977 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 644 | Open in IMG/M |
3300015320|Ga0182165_1017666 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae | 1067 | Open in IMG/M |
3300015325|Ga0182148_1010597 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae | 1190 | Open in IMG/M |
3300015325|Ga0182148_1054710 | Not Available | 722 | Open in IMG/M |
3300015325|Ga0182148_1111562 | Not Available | 559 | Open in IMG/M |
3300015326|Ga0182166_1069945 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 661 | Open in IMG/M |
3300015326|Ga0182166_1113310 | Not Available | 554 | Open in IMG/M |
3300015327|Ga0182114_1081163 | Not Available | 666 | Open in IMG/M |
3300015328|Ga0182153_1143304 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 516 | Open in IMG/M |
3300015329|Ga0182135_1003795 | Not Available | 1631 | Open in IMG/M |
3300015329|Ga0182135_1066826 | Not Available | 696 | Open in IMG/M |
3300015330|Ga0182152_1061421 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 719 | Open in IMG/M |
3300015331|Ga0182131_1074600 | Not Available | 673 | Open in IMG/M |
3300015332|Ga0182117_1000991 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 2514 | Open in IMG/M |
3300015332|Ga0182117_1047243 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 840 | Open in IMG/M |
3300015332|Ga0182117_1154628 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 524 | Open in IMG/M |
3300015333|Ga0182147_1037400 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 895 | Open in IMG/M |
3300015333|Ga0182147_1118724 | Not Available | 584 | Open in IMG/M |
3300015334|Ga0182132_1143641 | Not Available | 539 | Open in IMG/M |
3300015335|Ga0182116_1167645 | Not Available | 518 | Open in IMG/M |
3300015336|Ga0182150_1028541 | Not Available | 958 | Open in IMG/M |
3300015337|Ga0182151_1012115 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1234 | Open in IMG/M |
3300015338|Ga0182137_1064116 | Not Available | 770 | Open in IMG/M |
3300015338|Ga0182137_1086089 | Not Available | 687 | Open in IMG/M |
3300015339|Ga0182149_1013073 | Not Available | 1261 | Open in IMG/M |
3300015339|Ga0182149_1072268 | Not Available | 718 | Open in IMG/M |
3300015340|Ga0182133_1017533 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1217 | Open in IMG/M |
3300015340|Ga0182133_1049385 | Not Available | 869 | Open in IMG/M |
3300015340|Ga0182133_1067533 | All Organisms → cellular organisms → Eukaryota → Viridiplantae | 774 | Open in IMG/M |
3300015340|Ga0182133_1185869 | Not Available | 510 | Open in IMG/M |
3300015340|Ga0182133_1189650 | Not Available | 505 | Open in IMG/M |
3300015348|Ga0182115_1027969 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida | 1512 | Open in IMG/M |
3300015348|Ga0182115_1092304 | Not Available | 944 | Open in IMG/M |
3300015348|Ga0182115_1113067 | Not Available | 858 | Open in IMG/M |
3300015348|Ga0182115_1190028 | Not Available | 658 | Open in IMG/M |
3300015349|Ga0182185_1037878 | All Organisms → cellular organisms → Eukaryota → Viridiplantae | 1215 | Open in IMG/M |
3300015349|Ga0182185_1050170 | Not Available | 1096 | Open in IMG/M |
3300015349|Ga0182185_1199669 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 605 | Open in IMG/M |
3300015349|Ga0182185_1255499 | Not Available | 534 | Open in IMG/M |
3300015350|Ga0182163_1011020 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae | 1956 | Open in IMG/M |
3300015350|Ga0182163_1041141 | Not Available | 1269 | Open in IMG/M |
3300015350|Ga0182163_1092769 | Not Available | 909 | Open in IMG/M |
3300015350|Ga0182163_1108910 | Not Available | 846 | Open in IMG/M |
3300015350|Ga0182163_1207456 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 614 | Open in IMG/M |
3300015352|Ga0182169_1093360 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 958 | Open in IMG/M |
3300015352|Ga0182169_1223302 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii | 614 | Open in IMG/M |
3300015353|Ga0182179_1053930 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida | 1106 | Open in IMG/M |
3300015353|Ga0182179_1083028 | Not Available | 935 | Open in IMG/M |
3300015353|Ga0182179_1137500 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 755 | Open in IMG/M |
3300015353|Ga0182179_1188942 | Not Available | 653 | Open in IMG/M |
3300015353|Ga0182179_1299811 | Not Available | 523 | Open in IMG/M |
3300015354|Ga0182167_1072616 | Not Available | 1225 | Open in IMG/M |
3300015354|Ga0182167_1127180 | Not Available | 939 | Open in IMG/M |
3300015354|Ga0182167_1133445 | Not Available | 916 | Open in IMG/M |
3300015354|Ga0182167_1188094 | Not Available | 758 | Open in IMG/M |
3300015354|Ga0182167_1200739 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 729 | Open in IMG/M |
3300015354|Ga0182167_1228666 | Not Available | 675 | Open in IMG/M |
3300015354|Ga0182167_1282075 | Not Available | 593 | Open in IMG/M |
3300015354|Ga0182167_1321004 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 546 | Open in IMG/M |
3300017412|Ga0182199_1027860 | Not Available | 1035 | Open in IMG/M |
3300017422|Ga0182201_1037118 | Not Available | 794 | Open in IMG/M |
3300017422|Ga0182201_1075712 | Not Available | 630 | Open in IMG/M |
3300017435|Ga0182194_1102200 | Not Available | 588 | Open in IMG/M |
3300017439|Ga0182200_1095971 | Not Available | 608 | Open in IMG/M |
3300017445|Ga0182198_1042801 | Not Available | 894 | Open in IMG/M |
3300017445|Ga0182198_1154711 | Not Available | 560 | Open in IMG/M |
3300017693|Ga0182216_1022978 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1171 | Open in IMG/M |
3300017693|Ga0182216_1112377 | Not Available | 663 | Open in IMG/M |
3300017693|Ga0182216_1155297 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 583 | Open in IMG/M |
3300017693|Ga0182216_1173711 | Not Available | 558 | Open in IMG/M |
3300020223|Ga0182118_102162 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 883 | Open in IMG/M |
3300020223|Ga0182118_107721 | Not Available | 617 | Open in IMG/M |
3300028049|Ga0268322_1050061 | Not Available | 526 | Open in IMG/M |
3300028055|Ga0268338_1029382 | Not Available | 576 | Open in IMG/M |
3300028058|Ga0268332_1000695 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 2001 | Open in IMG/M |
3300028142|Ga0268347_1012304 | Not Available | 693 | Open in IMG/M |
3300028248|Ga0268312_1018939 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 630 | Open in IMG/M |
3300028475|Ga0268327_1017469 | Not Available | 578 | Open in IMG/M |
3300028529|Ga0268311_1014352 | Not Available | 633 | Open in IMG/M |
3300032464|Ga0214492_1011855 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1507 | Open in IMG/M |
3300032464|Ga0214492_1044372 | Not Available | 864 | Open in IMG/M |
3300032464|Ga0214492_1064211 | Not Available | 708 | Open in IMG/M |
3300032464|Ga0214492_1074355 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae | 650 | Open in IMG/M |
3300032464|Ga0214492_1074743 | Not Available | 648 | Open in IMG/M |
3300032464|Ga0214492_1099843 | Not Available | 540 | Open in IMG/M |
3300032465|Ga0214493_1001742 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 3008 | Open in IMG/M |
3300032465|Ga0214493_1006901 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 2053 | Open in IMG/M |
3300032465|Ga0214493_1019705 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1449 | Open in IMG/M |
3300032465|Ga0214493_1093907 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 713 | Open in IMG/M |
3300032467|Ga0214488_1001396 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 3021 | Open in IMG/M |
3300032467|Ga0214488_1019138 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1380 | Open in IMG/M |
3300032467|Ga0214488_1122266 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 552 | Open in IMG/M |
3300032469|Ga0214491_1012263 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 1778 | Open in IMG/M |
3300032469|Ga0214491_1031704 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1232 | Open in IMG/M |
3300032469|Ga0214491_1051167 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 993 | Open in IMG/M |
3300032469|Ga0214491_1103734 | Not Available | 682 | Open in IMG/M |
3300032469|Ga0214491_1149277 | Not Available | 545 | Open in IMG/M |
3300032490|Ga0214495_1029166 | Not Available | 1243 | Open in IMG/M |
3300032490|Ga0214495_1036645 | Not Available | 1125 | Open in IMG/M |
3300032490|Ga0214495_1056184 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta | 918 | Open in IMG/M |
3300032490|Ga0214495_1072525 | Not Available | 802 | Open in IMG/M |
3300032490|Ga0214495_1075663 | Not Available | 784 | Open in IMG/M |
3300032490|Ga0214495_1142666 | Not Available | 533 | Open in IMG/M |
3300032502|Ga0214490_1067527 | Not Available | 817 | Open in IMG/M |
3300032502|Ga0214490_1079057 | Not Available | 753 | Open in IMG/M |
3300032502|Ga0214490_1154233 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 518 | Open in IMG/M |
3300032514|Ga0214502_1104097 | Not Available | 1079 | Open in IMG/M |
3300032514|Ga0214502_1267173 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 651 | Open in IMG/M |
3300032514|Ga0214502_1371840 | Not Available | 538 | Open in IMG/M |
3300032550|Ga0321340_1022069 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 898 | Open in IMG/M |
3300032551|Ga0321339_1014859 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1539 | Open in IMG/M |
3300032551|Ga0321339_1020102 | Not Available | 1387 | Open in IMG/M |
3300032551|Ga0321339_1094860 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 682 | Open in IMG/M |
3300032551|Ga0321339_1106374 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis | 636 | Open in IMG/M |
3300032591|Ga0214484_1016814 | Not Available | 1401 | Open in IMG/M |
3300032591|Ga0214484_1026892 | Not Available | 1169 | Open in IMG/M |
3300032591|Ga0214484_1038336 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1002 | Open in IMG/M |
3300032591|Ga0214484_1111601 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis | 555 | Open in IMG/M |
3300032592|Ga0214504_1039267 | Not Available | 925 | Open in IMG/M |
3300032593|Ga0321338_1113561 | Not Available | 956 | Open in IMG/M |
3300032625|Ga0214501_1032424 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida | 1573 | Open in IMG/M |
3300032625|Ga0214501_1174032 | Not Available | 686 | Open in IMG/M |
3300032689|Ga0214497_1090741 | Not Available | 668 | Open in IMG/M |
3300032689|Ga0214497_1100568 | Not Available | 627 | Open in IMG/M |
3300032689|Ga0214497_1108271 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 598 | Open in IMG/M |
3300032689|Ga0214497_1138722 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida | 506 | Open in IMG/M |
3300032697|Ga0214499_1066476 | Not Available | 1079 | Open in IMG/M |
3300032697|Ga0214499_1073501 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis | 1031 | Open in IMG/M |
3300032697|Ga0214499_1106317 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 862 | Open in IMG/M |
3300032698|Ga0214485_1013499 | Not Available | 1404 | Open in IMG/M |
3300032758|Ga0314746_1023678 | Not Available | 1332 | Open in IMG/M |
3300032758|Ga0314746_1036246 | All Organisms → Viruses → Predicted Viral | 1119 | Open in IMG/M |
3300032758|Ga0314746_1086712 | Not Available | 725 | Open in IMG/M |
3300032760|Ga0314754_1008752 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta | 1470 | Open in IMG/M |
3300032761|Ga0314733_1074938 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 645 | Open in IMG/M |
3300032789|Ga0314725_1017988 | Not Available | 862 | Open in IMG/M |
3300032791|Ga0314748_1013869 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1533 | Open in IMG/M |
3300032791|Ga0314748_1051713 | Not Available | 874 | Open in IMG/M |
3300032792|Ga0314744_1014843 | Not Available | 1418 | Open in IMG/M |
3300032792|Ga0314744_1078605 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 634 | Open in IMG/M |
3300032812|Ga0314745_1004504 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 2262 | Open in IMG/M |
3300032812|Ga0314745_1012667 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1609 | Open in IMG/M |
3300032812|Ga0314745_1040128 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 1003 | Open in IMG/M |
3300032821|Ga0314719_1008549 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1248 | Open in IMG/M |
3300032823|Ga0314723_1058031 | Not Available | 739 | Open in IMG/M |
3300032843|Ga0314736_1020692 | Not Available | 850 | Open in IMG/M |
3300032843|Ga0314736_1045634 | Not Available | 563 | Open in IMG/M |
3300032844|Ga0314743_1144144 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 527 | Open in IMG/M |
3300032844|Ga0314743_1146565 | Not Available | 521 | Open in IMG/M |
3300032875|Ga0314737_1052050 | Not Available | 709 | Open in IMG/M |
3300032889|Ga0314751_1025556 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 1159 | Open in IMG/M |
3300032889|Ga0314751_1031228 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 1064 | Open in IMG/M |
3300032889|Ga0314751_1038387 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 966 | Open in IMG/M |
3300032889|Ga0314751_1044140 | Not Available | 903 | Open in IMG/M |
3300032890|Ga0314747_1059177 | Not Available | 555 | Open in IMG/M |
3300032915|Ga0314749_1062388 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 804 | Open in IMG/M |
3300032916|Ga0314734_1048823 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 855 | Open in IMG/M |
3300032916|Ga0314734_1074418 | Not Available | 682 | Open in IMG/M |
3300032916|Ga0314734_1084205 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 635 | Open in IMG/M |
3300032934|Ga0314741_1029205 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 1225 | Open in IMG/M |
3300032934|Ga0314741_1069174 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 821 | Open in IMG/M |
3300032934|Ga0314741_1135295 | Not Available | 556 | Open in IMG/M |
3300032959|Ga0314738_1040713 | Not Available | 846 | Open in IMG/M |
3300032959|Ga0314738_1063335 | Not Available | 666 | Open in IMG/M |
3300032959|Ga0314738_1092693 | Not Available | 527 | Open in IMG/M |
3300032959|Ga0314738_1095783 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 516 | Open in IMG/M |
3300032966|Ga0314722_1056698 | Not Available | 617 | Open in IMG/M |
3300032976|Ga0314752_1025386 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 1107 | Open in IMG/M |
3300032976|Ga0314752_1089061 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 593 | Open in IMG/M |
3300032976|Ga0314752_1109371 | Not Available | 531 | Open in IMG/M |
3300033523|Ga0314768_1325141 | Not Available | 535 | Open in IMG/M |
3300033526|Ga0314761_1057230 | Not Available | 862 | Open in IMG/M |
3300033526|Ga0314761_1059281 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae | 847 | Open in IMG/M |
3300033526|Ga0314761_1153797 | Not Available | 505 | Open in IMG/M |
3300033530|Ga0314760_1169039 | Not Available | 531 | Open in IMG/M |
3300033531|Ga0314756_1011762 | Not Available | 1483 | Open in IMG/M |
3300033533|Ga0314770_1229014 | Not Available | 582 | Open in IMG/M |
3300033534|Ga0314757_1027531 | Not Available | 1305 | Open in IMG/M |
3300033534|Ga0314757_1039495 | Not Available | 1111 | Open in IMG/M |
3300033535|Ga0314759_1012021 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Zizaniinae → Zizania → Zizania palustris | 2083 | Open in IMG/M |
3300033535|Ga0314759_1143959 | Not Available | 758 | Open in IMG/M |
3300033535|Ga0314759_1164403 | Not Available | 706 | Open in IMG/M |
3300033535|Ga0314759_1255486 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 555 | Open in IMG/M |
3300033538|Ga0314755_1018408 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida | 1603 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 95.59% |
Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 3.43% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.49% |
Switchgrass Associated | Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated | 0.49% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300009992 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaG | Host-Associated | Open in IMG/M |
3300015280 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015290 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015293 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015297 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015309 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015310 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015313 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015315 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015317 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015319 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015320 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015325 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015326 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015327 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015328 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015329 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015330 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015331 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015332 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015333 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015334 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015335 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015336 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015337 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015338 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015339 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015340 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015348 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015349 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015350 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015352 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015353 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015354 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017412 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017422 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017435 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017439 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017445 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017693 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300020223 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_31MAY2016_LD2 MG | Host-Associated | Open in IMG/M |
3300028049 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028055 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028058 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028142 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028248 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028475 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
3300028529 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300032464 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032465 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032467 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_31MAY2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032469 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032490 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032502 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032514 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12SEP2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032550 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032551 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_31MAY2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032591 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032592 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_12SEP2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032593 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032625 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032689 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12JUL2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032697 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032698 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032758 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032760 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032761 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032789 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032791 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032792 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032812 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032821 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_15MAY2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032823 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032843 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032844 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032875 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032889 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032890 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032915 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032916 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032934 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032959 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032966 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_15MAY2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032976 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300033523 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_18SEP2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300033526 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300033530 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300033531 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300033533 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_18SEP2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300033534 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300033535 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300033538 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0068860_1026068671 | 3300005843 | Switchgrass Rhizosphere | VYTVVDCIALSPLGGIYRSTWFGGQVASPRDKEGYPGITINPKLTISGVA* |
Ga0105120_10033952 | 3300009992 | Switchgrass Associated | MYRSTWLGGQVDSPRDKEGYLGITINPKLTISGVA* |
Ga0182100_10436441 | 3300015280 | Switchgrass Phyllosphere | IYMSIWLGEQVTSPRDKEGYPGITINPKLTISGVA* |
Ga0182105_10018241 | 3300015290 | Switchgrass Phyllosphere | CIALSPLGGIYRSTWLGGQVASPRDKEGYPGITINPKLTISGVA* |
Ga0182105_10533551 | 3300015290 | Switchgrass Phyllosphere | IYRSTWLGGQVASPRDKEGYPGITINPKLTISGVA* |
Ga0182103_10207751 | 3300015293 | Switchgrass Phyllosphere | SPLGGIYRSTWLGGQVASPRDKEGYSGITINPKLTISGVA* |
Ga0182103_10268941 | 3300015293 | Switchgrass Phyllosphere | RIYRSTWLGGQVASPRDKEGYHGITINPKLTISGVA* |
Ga0182104_10264761 | 3300015297 | Switchgrass Phyllosphere | LGGIYMSTWLGGQVAFPRDKKDYPGITINPKLAISRDA* |
Ga0182098_10527861 | 3300015309 | Switchgrass Phyllosphere | LDGIYRSTWLGGQVASPRDKEGYSGITINPKLTISGVA* |
Ga0182098_11160601 | 3300015309 | Switchgrass Phyllosphere | IYKSTWLGGQVASPRDKEDYFGITINPKLTISEVA* |
Ga0182162_10297753 | 3300015310 | Switchgrass Phyllosphere | LSPLGGIYRSTWLGGQVASPRDNEGYPGITINPKLTISGVA* |
Ga0182164_10303442 | 3300015313 | Switchgrass Phyllosphere | LGGIYRSTWFGGQVASPRDKEGYPGITINPKLTISGVA* |
Ga0182164_11049551 | 3300015313 | Switchgrass Phyllosphere | YCIEPLGRIYRSTWLGRQVASPRDKEGYPGITINPKLTISGVA* |
Ga0182120_10859702 | 3300015315 | Switchgrass Phyllosphere | IYRSTWLGGQVASPRDKEGYPGITINSKLTISGVA* |
Ga0182136_10317361 | 3300015317 | Switchgrass Phyllosphere | TWLGGQVASPRDKEGYPGITINPKLTISRDATEVD* |
Ga0182136_10354831 | 3300015317 | Switchgrass Phyllosphere | CGRCIALSPLDGIYRSTWLEGQVVSPRDKEGYSGITINPKLTISGVA* |
Ga0182136_11163472 | 3300015317 | Switchgrass Phyllosphere | YMSTWLGGQVAFPRDKESYPRITINPKLTISGVA* |
Ga0182130_10316011 | 3300015319 | Switchgrass Phyllosphere | CGRCIALSPLDGIYRSTWLEGQVASPRDKEGYPGITINPKLIISGVD* |
Ga0182130_10610171 | 3300015319 | Switchgrass Phyllosphere | IEPLGRIYRSTWLGRQVASPRDKEGYPGITINPKLTISGVA* |
Ga0182130_10699772 | 3300015319 | Switchgrass Phyllosphere | CIALSPLGGIYRSTWLGGQVASPRDKEGYPGITINPKLTVSGVA* |
Ga0182165_10176661 | 3300015320 | Switchgrass Phyllosphere | EPLGRIYRSTWLGGQVASPRDKEGYPGITINSKLIISGVA* |
Ga0182148_10105971 | 3300015325 | Switchgrass Phyllosphere | IYRSTWLGGQVASPRDKESYPGITINPKLTISGVA* |
Ga0182148_10547101 | 3300015325 | Switchgrass Phyllosphere | YRSTWLGGQVASPRDKEDYPGITINPKLTMSRVA* |
Ga0182148_11115622 | 3300015325 | Switchgrass Phyllosphere | IALSPLGSIYRSTWFGGQVASPRDNEGYPEITINPKLTIFGVA* |
Ga0182166_10699451 | 3300015326 | Switchgrass Phyllosphere | RCIALSPLGGICRSTWLGGQVASPRDKEGYSGITINPKLTISGVA* |
Ga0182166_11133101 | 3300015326 | Switchgrass Phyllosphere | MDCIAFELLRRIYRSTWFGGQIASPRDEEGYPEITINPKLTIFGVA* |
Ga0182114_10811631 | 3300015327 | Switchgrass Phyllosphere | YRSTWLGGQVTSPRDKEGYPGITINPKLTISGVA* |
Ga0182153_11433042 | 3300015328 | Switchgrass Phyllosphere | YRSTWLGGQVASPRDKKGYSGITINPKLTISGVA* |
Ga0182135_10037952 | 3300015329 | Switchgrass Phyllosphere | CIALRPLGGIYRSTWFGGQVSSPRDKEGYPGITINPKLIISGVA* |
Ga0182135_10668261 | 3300015329 | Switchgrass Phyllosphere | RIYSSTWLGGQVTSPRDKQGYLGITINPKLTISGVA* |
Ga0182152_10614211 | 3300015330 | Switchgrass Phyllosphere | PLGGIYRSTWLGGQVASPRDKEGYPGITINPKLTVSGVA* |
Ga0182131_10746001 | 3300015331 | Switchgrass Phyllosphere | YRSTWFGGQIASPRDEEGYPEITINPKLTIFGVA* |
Ga0182117_10009913 | 3300015332 | Switchgrass Phyllosphere | YRSTWLGVQVASLRDKEGYPGITINPKLTISGVA* |
Ga0182117_10472431 | 3300015332 | Switchgrass Phyllosphere | LSPLGSSTWLGGQVASPRDKEGYPRITINPKLTISGVA* |
Ga0182117_11546281 | 3300015332 | Switchgrass Phyllosphere | LGGIYRSTWLGGQVAPPRDKEGYPGITINPKLPISGV |
Ga0182147_10374002 | 3300015333 | Switchgrass Phyllosphere | YRSTWLGGQVASPKDKEGYPGITINPKLTISGVA* |
Ga0182147_11187242 | 3300015333 | Switchgrass Phyllosphere | GIYRSTWLGGQVASPRDKKDYSEITINSKLIISGVG* |
Ga0182132_11436411 | 3300015334 | Switchgrass Phyllosphere | GRCIALSPLGGIYRSTWLGGQVASARDKEGYPRITINSKLTISGVA* |
Ga0182116_11315731 | 3300015335 | Switchgrass Phyllosphere | MRAIYCIEPLGQIYRSTWFGGQVVSPRDNKDYYGITINPKLTI |
Ga0182116_11676451 | 3300015335 | Switchgrass Phyllosphere | GRCIALNLLGGIYRSTWVGGHVASPRDKEGYSGIIINHKLTISEVA* |
Ga0182150_10285413 | 3300015336 | Switchgrass Phyllosphere | IALSPLGGIYRSTWLGGQVASPIDKEGYPGITINPKLTIFRVA* |
Ga0182151_10121151 | 3300015337 | Switchgrass Phyllosphere | IALSPLGGIYRSTRLGGQVASPRDKEGYPGITINPKLTISGVA* |
Ga0182137_10641161 | 3300015338 | Switchgrass Phyllosphere | GIYRSTWLGGEVASPRDKEGYPGITINPKLTISGVA* |
Ga0182137_10860892 | 3300015338 | Switchgrass Phyllosphere | LGGIYRSTWLGGQVASPRDKEGYPGITINPKLIISKVA* |
Ga0182149_10130732 | 3300015339 | Switchgrass Phyllosphere | GIYRSTWLGGQVASPRDKEGYPEITINPKLTISGVA* |
Ga0182149_10722681 | 3300015339 | Switchgrass Phyllosphere | GRCIALSPLGGIYRNTWLRGQVASPRDKEGYPGITINPKLTISGVA* |
Ga0182133_10175334 | 3300015340 | Switchgrass Phyllosphere | PLGRIYRSTWLGGQVASPRDKKGYPGITINPKVTISGVV* |
Ga0182133_10493852 | 3300015340 | Switchgrass Phyllosphere | LGGIYKGTWLGGQLTSPRDKEGYPGITMNPKLTISGVA* |
Ga0182133_10675332 | 3300015340 | Switchgrass Phyllosphere | MGCIALSLLGRIYRSAWLGGQVAPLRDKEGYPGITINPKLTISGAA* |
Ga0182133_11858691 | 3300015340 | Switchgrass Phyllosphere | GIYRSTWLGGQVASPRENEGYSGITINPKLTISGVA* |
Ga0182133_11896502 | 3300015340 | Switchgrass Phyllosphere | ALSPLGGIYRSTWLGVQVVSPKDKEGYLGITINPKLTISGVA* |
Ga0182115_10279693 | 3300015348 | Switchgrass Phyllosphere | VYCGRCIVLSPLGGIYRSTWLGGQVASPRDKEGYSGITINPKLTISGVA* |
Ga0182115_10923041 | 3300015348 | Switchgrass Phyllosphere | LGGIYRSTRLGGQVASPRDKEGYPGITINPKLTISG |
Ga0182115_11130671 | 3300015348 | Switchgrass Phyllosphere | MWSIYCLSPLGGIYRSTWLGGQVASPRDKEGYPGITINPKLT |
Ga0182115_11900281 | 3300015348 | Switchgrass Phyllosphere | LGGIYKNTWLGGQVISPRDKEGYLGITINSKLTIS* |
Ga0182185_10378781 | 3300015349 | Switchgrass Phyllosphere | MGCIALSLLGRIYRSTWLGVQVAPLRDKEGYPGITINPKLTISG |
Ga0182185_10501701 | 3300015349 | Switchgrass Phyllosphere | CGQCIALSPLGGIYRSTWLGGQVASPRDKEGYSGITINPKLTISGVA* |
Ga0182185_11996691 | 3300015349 | Switchgrass Phyllosphere | IELLGQIYRSTWLGGQVASPKDKKGYPIITINPKLTIPGLA* |
Ga0182185_12554991 | 3300015349 | Switchgrass Phyllosphere | GRCIALSPLDGIYRSTWLGGQVASPRDKEEGYLGITINPKLTISGVA* |
Ga0182163_10110202 | 3300015350 | Switchgrass Phyllosphere | GRCIALSPLGGIYRSTWLGGQVASPRDKEGYPGITVNPKLTISGVA* |
Ga0182163_10411411 | 3300015350 | Switchgrass Phyllosphere | YRNTWLGGQVASPRDKEGYPGITINSKLIISGVA* |
Ga0182163_10927691 | 3300015350 | Switchgrass Phyllosphere | GRIYRSTWLGGQVASPRDKEGYPGITINPKLTISEVA* |
Ga0182163_11089101 | 3300015350 | Switchgrass Phyllosphere | PLGGIYRSTWLGGQVASPRDKEGYPEITINKLTISGVA* |
Ga0182163_12074561 | 3300015350 | Switchgrass Phyllosphere | MWSMYCLSPLGGIYRSTWLGRQVASPRDKKGYPGITINPKL |
Ga0182169_10933601 | 3300015352 | Switchgrass Phyllosphere | SPLGGIYRSTWLGGQVASPRDKEGYPGITINPKLTVSGVA* |
Ga0182169_12233021 | 3300015352 | Switchgrass Phyllosphere | IALSPLGGIYRSTWLGGQVASPRDKKGYPGITINPKLTISGVV* |
Ga0182179_10539301 | 3300015353 | Switchgrass Phyllosphere | LGGIYRSTWLGGQVASPRDKECYPEITINSKLTISGVA* |
Ga0182179_10830281 | 3300015353 | Switchgrass Phyllosphere | RIYRSTWFGGQVASPRDKEGYSGITINPKLTISGVA* |
Ga0182179_11375001 | 3300015353 | Switchgrass Phyllosphere | EPLGQIYRSTWLGGQVTSPRDKEGYPGITINTKLTIYGVA* |
Ga0182179_11889421 | 3300015353 | Switchgrass Phyllosphere | CIALSPLDGIYRSTWLGGQVASPRDKEGFLGITINPKLTISGAA* |
Ga0182179_12998111 | 3300015353 | Switchgrass Phyllosphere | CGRCIALSPLGGIYRSTWLGGQVASPRDKEGYPGITINSKLTISGVA* |
Ga0182167_10726161 | 3300015354 | Switchgrass Phyllosphere | YRSTWFGGQVASPRDKEGYPGITINPKLTISGVA* |
Ga0182167_11271801 | 3300015354 | Switchgrass Phyllosphere | CIALSPLDGIYRSTWLGGQVASPRDKEDYLGITINSELTISGVV* |
Ga0182167_11334451 | 3300015354 | Switchgrass Phyllosphere | MYCIEPLGRIYRSTWLGGQVASPRDKEGYSGITINSKLTISGVA* |
Ga0182167_11880942 | 3300015354 | Switchgrass Phyllosphere | QDAYNAVNILLEPLGPIYRSIWFGGQVASPRDKKGHLGITINSKLTIFGVV* |
Ga0182167_12007391 | 3300015354 | Switchgrass Phyllosphere | LDGIYRSTWLGGQVASPRDKEGYLGITINPKLTISGVA |
Ga0182167_12286663 | 3300015354 | Switchgrass Phyllosphere | WSIYCLSPLGGIYRSTWLGGQVASPRDKEDYPGITINPKLTISGVA* |
Ga0182167_12820751 | 3300015354 | Switchgrass Phyllosphere | GIYRSTWLGGQVASPKDKEGYPGITINSKLTISGVA* |
Ga0182167_13210042 | 3300015354 | Switchgrass Phyllosphere | IYCWSPLGGIYRSTWLGGQVASPRDKEGYLGITINPKLTVSGVA* |
Ga0182199_10278601 | 3300017412 | Switchgrass Phyllosphere | LGGIYKSTWLGGQVISPRDKEGYLGITINSKLTIS |
Ga0182201_10371181 | 3300017422 | Switchgrass Phyllosphere | LSPLGGIYRSTWLGGQVASPRDKEGYPEITINPKLTISGVA |
Ga0182201_10757121 | 3300017422 | Switchgrass Phyllosphere | LGGIYRSAWLGGQVASPRDKECYPGITINPKLTIFGV |
Ga0182194_11022001 | 3300017435 | Switchgrass Phyllosphere | LLGRIYMSTWLGGQVASHRDKEGYSGITINPKLTISGVA |
Ga0182200_10959711 | 3300017439 | Switchgrass Phyllosphere | IALNPLDGIYRSAWLEGQVAFPRDNECYPGITINPKLIMSGVA |
Ga0182198_10428011 | 3300017445 | Switchgrass Phyllosphere | YCLSPLGGIYRSTWLGGQVASPRDKEDYSGITINPKLTISGVA |
Ga0182198_11547111 | 3300017445 | Switchgrass Phyllosphere | GRCIALSPLSGIYRSTWLGGQVASPREKEGYSGITINPKLTISGVA |
Ga0182216_10229781 | 3300017693 | Switchgrass Phyllosphere | CGRCIALSPLGGIYRSTWLGGQVAFLRDKEGYPGITINPKLTIS |
Ga0182216_11123771 | 3300017693 | Switchgrass Phyllosphere | TWLGGQVASPRDKEGYPGITINPKLTISRDATEVD |
Ga0182216_11552971 | 3300017693 | Switchgrass Phyllosphere | LGGIYRSTWLEGQVASPRDKEGYPGITINAKLTISG |
Ga0182216_11737111 | 3300017693 | Switchgrass Phyllosphere | GIYRSTWLGGQVASPRDKEGYHGITINPKLTISGVA |
Ga0182118_1021621 | 3300020223 | Switchgrass Phyllosphere | GRCIALSPLGGIYRSTWLGGQVASPRDKEGYPGITINPKLTISGVA |
Ga0182118_1077211 | 3300020223 | Switchgrass Phyllosphere | MYCIEPLGRIYRSTWLGGQIASPRDKEGYSGITINPKLTISGVA |
Ga0268322_10500611 | 3300028049 | Phyllosphere | GLEWLGGQVASPLRLSRDKEGYLEITINPKLTISSS |
Ga0268338_10293821 | 3300028055 | Phyllosphere | SPLGGIYRSTWFGGQVASPRDKEGYPGISINPKLTISGVA |
Ga0268332_10006953 | 3300028058 | Phyllosphere | GGIYRSTWLGVQVASPRDKEGYSGITINPKLTISRVA |
Ga0268347_10123041 | 3300028142 | Phyllosphere | LGGIYRSTWLGGQVASPRDKEGYPGITVNPKLTISG |
Ga0268312_10189391 | 3300028248 | Phyllosphere | RIYRSTWLGGQVASPRDKEGYPGITINPKLTISGVA |
Ga0268327_10174691 | 3300028475 | Phyllosphere | TLGGIYRSTWVGGQVASPRDKEGYPGITINPKLTISGVA |
Ga0268311_10143521 | 3300028529 | Phyllosphere | PLGSIYRSTWFGGQVASPRDKEGYPGITINPKLTISGVA |
Ga0214492_10118552 | 3300032464 | Switchgrass Phyllosphere | GGIYRSTWLGGQVASPRDKEGYPGITINPKLTISRVA |
Ga0214492_10443721 | 3300032464 | Switchgrass Phyllosphere | LGGIYRSTWFGGQVASPKDKEGSPGITINPKLTISGVA |
Ga0214492_10642111 | 3300032464 | Switchgrass Phyllosphere | CGRCIALNPLGGIYRSTWLGGQVASPRDKEGYPEITINPKLTISGVA |
Ga0214492_10743551 | 3300032464 | Switchgrass Phyllosphere | GRCIALSPLGGIYRSTWLGGQVASPRDKKGYPGITINPKLTISGVA |
Ga0214492_10747431 | 3300032464 | Switchgrass Phyllosphere | LGSIYRSTWLGGQVASPRDKEGYLGITINSKLTISGVA |
Ga0214492_10998431 | 3300032464 | Switchgrass Phyllosphere | IYCLSPLGGIYRSTWLGGQVASPRDKEGYPGITINPKLTISGVA |
Ga0214493_10017423 | 3300032465 | Switchgrass Phyllosphere | IALSPLGGIYRSTWLGGQVASPRDKEGYPGITINPKLTISRVA |
Ga0214493_10069011 | 3300032465 | Switchgrass Phyllosphere | GIYRSTWLGGQVASPRDKEGYPEITINPKLTISRVA |
Ga0214493_10197052 | 3300032465 | Switchgrass Phyllosphere | LGGIYRSTWLGGQVASPRDKEGYPGITINPKLTISGVA |
Ga0214493_10939072 | 3300032465 | Switchgrass Phyllosphere | SPLGGIYRSTWLGGQVASPRDKEGYPGITINPKLTISGVA |
Ga0214488_10013961 | 3300032467 | Switchgrass Phyllosphere | CGRCIALSPLGGLYRSTWLGGQVASPRDKEGYPGITINPKLTISRVA |
Ga0214488_10191382 | 3300032467 | Switchgrass Phyllosphere | IYRSTWLGGQVASPRDKEGYPGITINPKLTISGVA |
Ga0214488_11222661 | 3300032467 | Switchgrass Phyllosphere | CGRCIALSPLGGIYRSTWLGGQVASPRDKEGYPGITINPKLTISGVA |
Ga0214491_10122633 | 3300032469 | Switchgrass Phyllosphere | GIYRSTWLGGQVASPRDKEGYPGITINPKLTISGVA |
Ga0214491_10317041 | 3300032469 | Switchgrass Phyllosphere | IYRSTWLGGQVASPRDKEGYLEITINPNLTISGVA |
Ga0214491_10511671 | 3300032469 | Switchgrass Phyllosphere | GGIYRSTWLGGQVASPSPRDKEGYPGITINPKLTISGVA |
Ga0214491_11037342 | 3300032469 | Switchgrass Phyllosphere | LGGIYRSTLFGGQVASPRDKEGYPGITINHKLTISGVA |
Ga0214491_11492771 | 3300032469 | Switchgrass Phyllosphere | RCIALSPLGGIYSTWLGGQVASPRDKEEGYLGITINPKLTISGVA |
Ga0214495_10291661 | 3300032490 | Switchgrass Phyllosphere | CIALSPLGGIYRSTWLGGQVASPRDKEGYPGITINPKLTISGVA |
Ga0214495_10366451 | 3300032490 | Switchgrass Phyllosphere | IALSPLGGIYRSTWLGGQVASPRDKEGYPGITINPKLTISGVA |
Ga0214495_10561841 | 3300032490 | Switchgrass Phyllosphere | GIYRSTWLGGQVASPRDKEGYPGITINSKLTISGVA |
Ga0214495_10725251 | 3300032490 | Switchgrass Phyllosphere | GRCIALSPLGGIYRSTWLGGQVASPSPRDKEGYPGITINPKLTISGVA |
Ga0214495_10756631 | 3300032490 | Switchgrass Phyllosphere | LSPLGGIYRNTWLGGQVASPRDKEDYPGITINPKLTISGVA |
Ga0214495_11426661 | 3300032490 | Switchgrass Phyllosphere | IYRSTWLGGQVASPREKEGYSGITINPKLTISGVA |
Ga0214490_10675272 | 3300032502 | Switchgrass Phyllosphere | CIEPLGRIYRSTWLEGQVASPKDKKGYPGITINPKVTISGVV |
Ga0214490_10790571 | 3300032502 | Switchgrass Phyllosphere | PLGGIYRSAWLGGQVASPRDKKSYLGITINPKLTISGVA |
Ga0214490_11542332 | 3300032502 | Switchgrass Phyllosphere | GRCIALSPLGGIYSTWLGGQVASPRDKESYPGITINPKLTISGVA |
Ga0214502_11040971 | 3300032514 | Switchgrass Phyllosphere | PLGRIYRSTWLGGQVASPRDKEGYPGITINPKLTISGVA |
Ga0214502_12671732 | 3300032514 | Switchgrass Phyllosphere | LSPLGGIYRSTWLGGQVASPRDKEGYPKITINPKLIIWS |
Ga0214502_13718401 | 3300032514 | Switchgrass Phyllosphere | LGGIYRNTWLGGQVASPRDKEGYPGITINPKLTISGVA |
Ga0321340_10220691 | 3300032550 | Switchgrass Phyllosphere | LYRSTWLGGQVASPRDKEGYLGITINPKLTISGVA |
Ga0321339_10148591 | 3300032551 | Switchgrass Phyllosphere | LGGIYRSTWLGGQVASPRDKEGYPGITINPKLTISRVA |
Ga0321339_10201021 | 3300032551 | Switchgrass Phyllosphere | IYRSTWFGGQVASPRDKEGYPGITINPKLTISGVA |
Ga0321339_10948601 | 3300032551 | Switchgrass Phyllosphere | ALSPLGGIYRSTWLGGQVASARDKEGYPRITINSKLTISGVA |
Ga0321339_11063741 | 3300032551 | Switchgrass Phyllosphere | GIYRSTWFGGQVASPREMEGYSGITINPKLTISGVA |
Ga0214484_10168141 | 3300032591 | Switchgrass Phyllosphere | GRIYRITWLGGQVASPRDKEGYPGSTINPKLTISRDATEVD |
Ga0214484_10268921 | 3300032591 | Switchgrass Phyllosphere | PLGSIYRSTWLGGQLASPRDKESYHGITINPKLTISGVA |
Ga0214484_10383361 | 3300032591 | Switchgrass Phyllosphere | SPLGGIYRSTWLGGQVASPSPRDKEGYPGITINPKLTISGVA |
Ga0214484_11116011 | 3300032591 | Switchgrass Phyllosphere | LGGIYRSTWLRGQVASPRDKEGYPGITINPKLTISEVV |
Ga0214504_10392672 | 3300032592 | Switchgrass Phyllosphere | GSIYRSTWFGGQVASPRDKESYPGITINPKLTISGVA |
Ga0321338_11135611 | 3300032593 | Switchgrass Phyllosphere | GRCIALSPLGSIYRSTWLGGQVASPRDKEGYPGITIKPKLTISGVA |
Ga0214501_10324244 | 3300032625 | Switchgrass Phyllosphere | IYMSTWLEGQVASHREKEGYPGITINSKLTISGVA |
Ga0214501_11740321 | 3300032625 | Switchgrass Phyllosphere | IYRSTWLGGQVAFPRDKEDYLGITINPELIISGVV |
Ga0214497_10907411 | 3300032689 | Switchgrass Phyllosphere | RCIALSPLDGIYRSTWLGGQVASPRDKEEGYLGITINPKLTISGVA |
Ga0214497_11005682 | 3300032689 | Switchgrass Phyllosphere | MYCIEPLGYIYRRTWLGGQVAFPRDKEDYLGITINPELTISGVV |
Ga0214497_11082712 | 3300032689 | Switchgrass Phyllosphere | LGGIYRSTWLGGQVASPRDKECYPEITINSKLTISGVA |
Ga0214497_11387221 | 3300032689 | Switchgrass Phyllosphere | MWSMYCLSPLGGIYRSTWLGGQVASPRDKEGYPGITINPKLTISGVA |
Ga0214499_10664761 | 3300032697 | Switchgrass Phyllosphere | CIALSPLGSIYRSTWLGGQVASPRDKEGYPGITINPKLTISGVA |
Ga0214499_10735011 | 3300032697 | Switchgrass Phyllosphere | IALSPLSGIYRSTWLGGQVASPREKEGYSGITINPKLTISGVA |
Ga0214499_11063171 | 3300032697 | Switchgrass Phyllosphere | XLYRSTXLGGQVASPRDKKGYLGITINPKLTISGVA |
Ga0214485_10134991 | 3300032698 | Switchgrass Phyllosphere | PLGGIYRSTWFGGQVASPRDKEGYPEITINPKLTISGVA |
Ga0314746_10236781 | 3300032758 | Switchgrass Phyllosphere | LSPLDGIYRSTWLGGQIASARDKEGYSEITINPKLTISGVA |
Ga0314746_10362461 | 3300032758 | Switchgrass Phyllosphere | MYCIEPLGQIYRSTWFGGQIASPRDKEGWVDKESYPRITINHKLTISEVAYYT |
Ga0314746_10867121 | 3300032758 | Switchgrass Phyllosphere | SIYRSTWLGGQVASPRDKEGYPGITINSKLTISGVA |
Ga0314754_10087523 | 3300032760 | Switchgrass Phyllosphere | GIYRSTWLGGQVTSLRDKEGYPGITINSKLTISGVA |
Ga0314733_10749382 | 3300032761 | Switchgrass Phyllosphere | GPLGGIYRSTWLGGQVASPRDKEGYPEITINPKLTISGVA |
Ga0314725_10179881 | 3300032789 | Switchgrass Phyllosphere | RCIALRPLGGIYRSTWFGGQVASPRDKEGYPGITINPKLTISGVA |
Ga0314748_10138691 | 3300032791 | Switchgrass Phyllosphere | CIALSPLGGIYRSTWLGGQVASPRDKEGYPGITINPKLTISRVA |
Ga0314748_10517132 | 3300032791 | Switchgrass Phyllosphere | GRCIALSHLGGIYRSTWLGGQVTSPRDKEGYHGITINPKLTISGVA |
Ga0314744_10148431 | 3300032792 | Switchgrass Phyllosphere | QCIALRPLGGIYRSTWFGGQVASPRDKEGYPGITINPKLTISGVA |
Ga0314744_10786051 | 3300032792 | Switchgrass Phyllosphere | MWSMYCLSPLGGIYRSTWLGRQVASPRDKKGYPGITINPKLIISGVA |
Ga0314745_10045041 | 3300032812 | Switchgrass Phyllosphere | ALSPLGGIYRSTWLGGQVASPSPRDKEGYPGITINPKLTISGIA |
Ga0314745_10126673 | 3300032812 | Switchgrass Phyllosphere | LYRSTWFGGQVASPRDKEGYPGITINPKLTISGVA |
Ga0314745_10401281 | 3300032812 | Switchgrass Phyllosphere | ARQVEGGIYRSTWLGGQIASPIDKEGYPGITINPKLTISGVA |
Ga0314719_10085491 | 3300032821 | Switchgrass Phyllosphere | IYRSTWLGGQVASPRDKEGYPGITINPKLTISEVA |
Ga0314723_10580311 | 3300032823 | Switchgrass Phyllosphere | SIYRSTWLGGQVTSPRDKEGYSGITINSKLTISGVA |
Ga0314736_10206921 | 3300032843 | Switchgrass Phyllosphere | CIALSPLGGIYRSTWFGGQVASPRDKEGYPGITINPKLTISGVA |
Ga0314736_10456341 | 3300032843 | Switchgrass Phyllosphere | IYRSTWLGGQVASPRENEGYSGITINPKLTISGVA |
Ga0314743_11441441 | 3300032844 | Switchgrass Phyllosphere | LLGGIYRSTWLGGQVDSPRDKEGYPGITINPKLTISGVA |
Ga0314743_11465651 | 3300032844 | Switchgrass Phyllosphere | SGIYRSTWLGGQVASPREKEGYSGITINPKLTISGVA |
Ga0314737_10520501 | 3300032875 | Switchgrass Phyllosphere | LGSIYRSTWLGGQVASPRDKEGYPGITINSKLTISGVA |
Ga0314751_10255561 | 3300032889 | Switchgrass Phyllosphere | RIMWSMYCLSSLGGIYRSTWLGGQVASPRDKECYPEITINSKLTISGVA |
Ga0314751_10312281 | 3300032889 | Switchgrass Phyllosphere | VRLGIMRGICCIELLGRMYRSTWLGGHVASPRDKEGYPGITINPKLTVSRVA |
Ga0314751_10383871 | 3300032889 | Switchgrass Phyllosphere | GRIYRSTWLGGQVASPRDKEGYPGITINPKLTISEVA |
Ga0314751_10441401 | 3300032889 | Switchgrass Phyllosphere | LYRSTWLGGQVASPRDKKGYPGITINPKLTISGVA |
Ga0314747_10591772 | 3300032890 | Switchgrass Phyllosphere | GRIYRSTWLGGQVASPRDKEGYPGITINPKLTISGVA |
Ga0314749_10623881 | 3300032915 | Switchgrass Phyllosphere | SSLGGIYRSTWLGGKVASHRDKECYPGITINFKLTISRVA |
Ga0314734_10488232 | 3300032916 | Switchgrass Phyllosphere | GRIYRSTWLGGQVASPRDKKGYPGITINPKVTISGVV |
Ga0314734_10744181 | 3300032916 | Switchgrass Phyllosphere | LGRIYRSTWLGGQVASPRDKEGYPGITINPKLTISGVA |
Ga0314734_10842051 | 3300032916 | Switchgrass Phyllosphere | GGIYRSTWLGGQVASARDKEGYPRITINPKLTISGVA |
Ga0314741_10292051 | 3300032934 | Switchgrass Phyllosphere | IALSPLGGIYRSIRLGGQVASPRDKEGYPGITINPKLTISGVA |
Ga0314741_10691742 | 3300032934 | Switchgrass Phyllosphere | GRCIALSPLGGIYRSTWLGGQVASARDKEGYPRITINSKLTISGVA |
Ga0314741_11352951 | 3300032934 | Switchgrass Phyllosphere | ALSPLDGIYRSTWLGGQVASPRDKVEGYLGITINPKLTISGVA |
Ga0314738_10407133 | 3300032959 | Switchgrass Phyllosphere | SMYCIEPLGGIYRSTWLGGQVASPRDKEGYPGITINAKLTISGVA |
Ga0314738_10633351 | 3300032959 | Switchgrass Phyllosphere | RIYRSTWLGVQVAPLRDKEGYPGITINPKLTISGAA |
Ga0314738_10926931 | 3300032959 | Switchgrass Phyllosphere | SMYCIEPLGGGIYRSTWLGGQVASPRDKEGYPGITINPKLTISVVA |
Ga0314738_10957832 | 3300032959 | Switchgrass Phyllosphere | ALSPLGGIYRSTWLGGKVASPRDKEGYPGITINPKLTISGVA |
Ga0314722_10566981 | 3300032966 | Switchgrass Phyllosphere | SIYRSTWLGGQVASPRDKEGYPGITINSKLTISGVG |
Ga0314752_10253861 | 3300032976 | Switchgrass Phyllosphere | LYRSTWLGEQVASPRDKGGYPGITINPKLTVSRVA |
Ga0314752_10890611 | 3300032976 | Switchgrass Phyllosphere | LGGIYRSTWLGGQVASPRDKEGYPGITINPKLTISG |
Ga0314752_11093711 | 3300032976 | Switchgrass Phyllosphere | FGXLYRSTWHGEQVASPRDKEGYPGITINLKLTISGGA |
Ga0314768_13251412 | 3300033523 | Switchgrass Phyllosphere | VYTVVDCIALSPLGGIYRSTWLGGQVASPRDKEGYPGITINPKLTI |
Ga0314761_10572302 | 3300033526 | Switchgrass Phyllosphere | MWSIYCLSPLGGIYRSTWLGGQVASPRDKEGYPGITINPKL |
Ga0314761_10592811 | 3300033526 | Switchgrass Phyllosphere | RCIALSPLGGIYRSTWFGGQVASPRDKKGYPGITINPKLTISGVA |
Ga0314761_11537972 | 3300033526 | Switchgrass Phyllosphere | GIYRSTWLGGQVVSPRDKEGYPGITINPKLTISGVA |
Ga0314760_11690391 | 3300033530 | Switchgrass Phyllosphere | CIALSPLGGIYRSTWLGGQVASPRDKKGYPGITINPKLTISGVA |
Ga0314756_10117621 | 3300033531 | Switchgrass Phyllosphere | PLGRIYRSTWLGGKVASPRDKEGYSGITINPKLTISGVA |
Ga0314770_12290141 | 3300033533 | Switchgrass Phyllosphere | LYRSTWLGGQVASPRDKEGYPEIAINSKLTIPGVA |
Ga0314757_10275311 | 3300033534 | Switchgrass Phyllosphere | PLGGIYRSTWFGGQVASPRDKEGYPGITINPKLTISGVA |
Ga0314757_10394952 | 3300033534 | Switchgrass Phyllosphere | GIYRSTWLGGQVASPRDKEGYPGITINPKLTISRVA |
Ga0314759_10120211 | 3300033535 | Switchgrass Phyllosphere | TALSPLDGIYRSTLFGGQVASPRDKEGYPGITINHKLTISGVA |
Ga0314759_11439591 | 3300033535 | Switchgrass Phyllosphere | PGRIYRSTWLGGQVASPRDKKSYPGITINPKATISGVV |
Ga0314759_11644031 | 3300033535 | Switchgrass Phyllosphere | GRYIALSPLGGICRSTWLGGQVASPRDKEGYSGITINPKLTISGVA |
Ga0314759_12554861 | 3300033535 | Switchgrass Phyllosphere | GRCIALSLLGGIYRSTWLGGQVDSPRDKEGYPGITINPKLTISGVA |
Ga0314755_10184081 | 3300033538 | Switchgrass Phyllosphere | IALSPLGSIYRSTWLGGQVTSPRDKEGYPGITINSKLTISGVA |
⦗Top⦘ |