| Basic Information | |
|---|---|
| Family ID | F024356 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 206 |
| Average Sequence Length | 45 residues |
| Representative Sequence | STDVSQPGSEIVQGEYQFNKRWSVSVQRDQLGGVSVDGRYHTRF |
| Number of Associated Samples | 166 |
| Number of Associated Scaffolds | 206 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.49 % |
| % of genes near scaffold ends (potentially truncated) | 99.03 % |
| % of genes from short scaffolds (< 2000 bps) | 89.32 % |
| Associated GOLD sequencing projects | 153 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.718 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (14.563 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.699 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.485 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 27.78% Coil/Unstructured: 72.22% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 206 Family Scaffolds |
|---|---|---|
| PF03631 | Virul_fac_BrkB | 46.12 |
| PF11896 | GlgE_dom_N_S | 2.43 |
| PF00871 | Acetate_kinase | 1.46 |
| PF01593 | Amino_oxidase | 1.46 |
| PF04366 | Ysc84 | 0.97 |
| PF07885 | Ion_trans_2 | 0.97 |
| PF10417 | 1-cysPrx_C | 0.97 |
| PF00069 | Pkinase | 0.97 |
| PF01381 | HTH_3 | 0.97 |
| PF12779 | WXXGXW | 0.97 |
| PF01475 | FUR | 0.97 |
| PF06202 | GDE_C | 0.97 |
| PF00873 | ACR_tran | 0.97 |
| PF00072 | Response_reg | 0.97 |
| PF14742 | GDE_N_bis | 0.49 |
| PF05974 | DUF892 | 0.49 |
| PF01833 | TIG | 0.49 |
| PF00075 | RNase_H | 0.49 |
| PF11964 | SpoIIAA-like | 0.49 |
| PF14023 | DUF4239 | 0.49 |
| PF02321 | OEP | 0.49 |
| PF05336 | rhaM | 0.49 |
| PF13505 | OMP_b-brl | 0.49 |
| PF01266 | DAO | 0.49 |
| PF03928 | HbpS-like | 0.49 |
| PF00723 | Glyco_hydro_15 | 0.49 |
| PF07040 | DUF1326 | 0.49 |
| PF13365 | Trypsin_2 | 0.49 |
| PF02954 | HTH_8 | 0.49 |
| PF12811 | BaxI_1 | 0.49 |
| PF15780 | ASH | 0.49 |
| PF01229 | Glyco_hydro_39 | 0.49 |
| PF03534 | SpvB | 0.49 |
| PF13545 | HTH_Crp_2 | 0.49 |
| PF00440 | TetR_N | 0.49 |
| PF00310 | GATase_2 | 0.49 |
| PF12732 | YtxH | 0.49 |
| PF13439 | Glyco_transf_4 | 0.49 |
| PF13432 | TPR_16 | 0.49 |
| PF13561 | adh_short_C2 | 0.49 |
| PF00860 | Xan_ur_permease | 0.49 |
| PF01557 | FAA_hydrolase | 0.49 |
| COG ID | Name | Functional Category | % Frequency in 206 Family Scaffolds |
|---|---|---|---|
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 46.12 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.88 |
| COG0282 | Acetate kinase | Energy production and conversion [C] | 1.46 |
| COG3426 | Butyrate kinase | Energy production and conversion [C] | 1.46 |
| COG0735 | Fe2+ or Zn2+ uptake regulation protein Fur/Zur | Inorganic ion transport and metabolism [P] | 0.97 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 0.97 |
| COG2930 | Lipid-binding SYLF domain, Ysc84/FYVE family | Lipid transport and metabolism [I] | 0.97 |
| COG3408 | Glycogen debranching enzyme (alpha-1,6-glucosidase) | Carbohydrate transport and metabolism [G] | 0.97 |
| COG3254 | L-rhamnose mutarotase | Cell wall/membrane/envelope biogenesis [M] | 0.49 |
| COG3387 | Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family | Carbohydrate transport and metabolism [G] | 0.49 |
| COG3664 | Beta-xylosidase | Carbohydrate transport and metabolism [G] | 0.49 |
| COG3685 | Ferritin-like metal-binding protein YciE | Inorganic ion transport and metabolism [P] | 0.49 |
| COG5588 | Uncharacterized conserved protein, DUF1326 domain | Function unknown [S] | 0.49 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.72 % |
| Unclassified | root | N/A | 7.28 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_103470844 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1305 | Open in IMG/M |
| 3300001087|JGI12677J13195_1002765 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1618 | Open in IMG/M |
| 3300001144|JGI12645J13327_102890 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300001166|JGI12694J13545_1025531 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
| 3300001174|JGI12679J13547_1012001 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300001471|JGI12712J15308_10042530 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1161 | Open in IMG/M |
| 3300001545|JGI12630J15595_10087191 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 613 | Open in IMG/M |
| 3300001867|JGI12627J18819_10383810 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100113251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2549 | Open in IMG/M |
| 3300002568|C688J35102_120296557 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 974 | Open in IMG/M |
| 3300004479|Ga0062595_102186966 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300004633|Ga0066395_10760831 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300005168|Ga0066809_10179928 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300005176|Ga0066679_10029841 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2992 | Open in IMG/M |
| 3300005332|Ga0066388_103338087 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 820 | Open in IMG/M |
| 3300005332|Ga0066388_103664398 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 784 | Open in IMG/M |
| 3300005343|Ga0070687_100732253 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 694 | Open in IMG/M |
| 3300005435|Ga0070714_100845805 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 887 | Open in IMG/M |
| 3300005436|Ga0070713_101271324 | Not Available | 713 | Open in IMG/M |
| 3300005526|Ga0073909_10046569 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1557 | Open in IMG/M |
| 3300005530|Ga0070679_100285366 | All Organisms → cellular organisms → Bacteria | 1603 | Open in IMG/M |
| 3300005534|Ga0070735_10494714 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 728 | Open in IMG/M |
| 3300005558|Ga0066698_10325876 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1063 | Open in IMG/M |
| 3300005564|Ga0070664_102101685 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300005587|Ga0066654_10393661 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 755 | Open in IMG/M |
| 3300005602|Ga0070762_11112705 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300005607|Ga0070740_10137012 | Not Available | 1071 | Open in IMG/M |
| 3300005610|Ga0070763_10640990 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 618 | Open in IMG/M |
| 3300005614|Ga0068856_101609570 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300005921|Ga0070766_10451741 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 848 | Open in IMG/M |
| 3300005921|Ga0070766_10776604 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
| 3300006028|Ga0070717_11889141 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300006034|Ga0066656_10910569 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
| 3300006086|Ga0075019_11054078 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300006176|Ga0070765_100399188 | Not Available | 1283 | Open in IMG/M |
| 3300006176|Ga0070765_101175963 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 724 | Open in IMG/M |
| 3300006176|Ga0070765_101699535 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300006176|Ga0070765_101766096 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
| 3300006176|Ga0070765_101902141 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300006755|Ga0079222_12345581 | Not Available | 533 | Open in IMG/M |
| 3300006797|Ga0066659_11666413 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
| 3300006893|Ga0073928_10326505 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1144 | Open in IMG/M |
| 3300007076|Ga0075435_100999667 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 730 | Open in IMG/M |
| 3300007255|Ga0099791_10565102 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300007788|Ga0099795_10228676 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300007788|Ga0099795_10387627 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300007982|Ga0102924_1219933 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 807 | Open in IMG/M |
| 3300007982|Ga0102924_1280397 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 672 | Open in IMG/M |
| 3300007982|Ga0102924_1335679 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300009088|Ga0099830_11512558 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300009088|Ga0099830_11832672 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300009090|Ga0099827_11466688 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
| 3300009628|Ga0116125_1155690 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 635 | Open in IMG/M |
| 3300009638|Ga0116113_1109297 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 672 | Open in IMG/M |
| 3300009645|Ga0116106_1272536 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300009665|Ga0116135_1253353 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 685 | Open in IMG/M |
| 3300009762|Ga0116130_1247064 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300010043|Ga0126380_11868557 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
| 3300010048|Ga0126373_10349349 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1490 | Open in IMG/M |
| 3300010152|Ga0126318_10910076 | Not Available | 589 | Open in IMG/M |
| 3300010358|Ga0126370_12636159 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300010360|Ga0126372_12929334 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300010376|Ga0126381_103277171 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 639 | Open in IMG/M |
| 3300010397|Ga0134124_10076910 | All Organisms → cellular organisms → Bacteria | 2860 | Open in IMG/M |
| 3300011269|Ga0137392_10176865 | All Organisms → cellular organisms → Bacteria | 1736 | Open in IMG/M |
| 3300011269|Ga0137392_11299807 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
| 3300011270|Ga0137391_10548126 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 974 | Open in IMG/M |
| 3300012189|Ga0137388_10776041 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 889 | Open in IMG/M |
| 3300012189|Ga0137388_10976243 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 782 | Open in IMG/M |
| 3300012208|Ga0137376_10646106 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 914 | Open in IMG/M |
| 3300012208|Ga0137376_11491901 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300012209|Ga0137379_10501269 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1122 | Open in IMG/M |
| 3300012211|Ga0137377_10023047 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5538 | Open in IMG/M |
| 3300012212|Ga0150985_105891147 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1935 | Open in IMG/M |
| 3300012353|Ga0137367_10645292 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 739 | Open in IMG/M |
| 3300012356|Ga0137371_10565171 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 875 | Open in IMG/M |
| 3300012361|Ga0137360_10445498 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1097 | Open in IMG/M |
| 3300012363|Ga0137390_10838215 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 876 | Open in IMG/M |
| 3300012363|Ga0137390_10941530 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 817 | Open in IMG/M |
| 3300012685|Ga0137397_11196098 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
| 3300012918|Ga0137396_10415194 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 998 | Open in IMG/M |
| 3300012923|Ga0137359_10208108 | All Organisms → cellular organisms → Bacteria | 1747 | Open in IMG/M |
| 3300012923|Ga0137359_10548268 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1017 | Open in IMG/M |
| 3300012925|Ga0137419_10403864 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
| 3300012971|Ga0126369_12186508 | Not Available | 640 | Open in IMG/M |
| 3300014169|Ga0181531_10292368 | Not Available | 996 | Open in IMG/M |
| 3300014199|Ga0181535_10505775 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
| 3300014489|Ga0182018_10472343 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 665 | Open in IMG/M |
| 3300014501|Ga0182024_10736809 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1211 | Open in IMG/M |
| 3300014501|Ga0182024_11121820 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 927 | Open in IMG/M |
| 3300014654|Ga0181525_10636422 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
| 3300015241|Ga0137418_10843386 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 681 | Open in IMG/M |
| 3300015241|Ga0137418_10867916 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
| 3300015371|Ga0132258_12920930 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1187 | Open in IMG/M |
| 3300016319|Ga0182033_10033464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3314 | Open in IMG/M |
| 3300017959|Ga0187779_10999355 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
| 3300017974|Ga0187777_10605734 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300018008|Ga0187888_1041932 | All Organisms → cellular organisms → Bacteria | 2165 | Open in IMG/M |
| 3300018017|Ga0187872_10214394 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 881 | Open in IMG/M |
| 3300018062|Ga0187784_10434894 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1060 | Open in IMG/M |
| 3300019268|Ga0181514_1307885 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
| 3300019786|Ga0182025_1018296 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 3300019888|Ga0193751_1011805 | All Organisms → cellular organisms → Bacteria | 4567 | Open in IMG/M |
| 3300020581|Ga0210399_11170628 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 612 | Open in IMG/M |
| 3300020582|Ga0210395_10074313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → Thermomicrobiaceae → Thermomicrobium → Thermomicrobium roseum | 2502 | Open in IMG/M |
| 3300020583|Ga0210401_11291826 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300021168|Ga0210406_10741133 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 753 | Open in IMG/M |
| 3300021170|Ga0210400_10566400 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 937 | Open in IMG/M |
| 3300021170|Ga0210400_11457317 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300021171|Ga0210405_10028691 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4467 | Open in IMG/M |
| 3300021178|Ga0210408_10043989 | All Organisms → cellular organisms → Bacteria | 3498 | Open in IMG/M |
| 3300021180|Ga0210396_10012302 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8009 | Open in IMG/M |
| 3300021180|Ga0210396_10446088 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
| 3300021401|Ga0210393_11399368 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 559 | Open in IMG/M |
| 3300021403|Ga0210397_10256904 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1270 | Open in IMG/M |
| 3300021403|Ga0210397_10258846 | All Organisms → cellular organisms → Bacteria | 1265 | Open in IMG/M |
| 3300021420|Ga0210394_10717089 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300021420|Ga0210394_11492007 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300021433|Ga0210391_10481781 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 974 | Open in IMG/M |
| 3300021474|Ga0210390_10086964 | All Organisms → cellular organisms → Bacteria | 2598 | Open in IMG/M |
| 3300021474|Ga0210390_10344227 | All Organisms → cellular organisms → Bacteria | 1262 | Open in IMG/M |
| 3300021478|Ga0210402_10178190 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1947 | Open in IMG/M |
| 3300021479|Ga0210410_10254719 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1574 | Open in IMG/M |
| 3300021479|Ga0210410_11682748 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300021560|Ga0126371_10735828 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1134 | Open in IMG/M |
| 3300021560|Ga0126371_11525958 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300021560|Ga0126371_12508611 | Not Available | 624 | Open in IMG/M |
| 3300022557|Ga0212123_10479880 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 812 | Open in IMG/M |
| 3300022557|Ga0212123_10713614 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
| 3300022733|Ga0224562_1024931 | Not Available | 500 | Open in IMG/M |
| 3300024225|Ga0224572_1001901 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3236 | Open in IMG/M |
| 3300024271|Ga0224564_1008489 | All Organisms → cellular organisms → Bacteria | 1684 | Open in IMG/M |
| 3300024271|Ga0224564_1100483 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300025414|Ga0208935_1003698 | All Organisms → cellular organisms → Bacteria | 2271 | Open in IMG/M |
| 3300025500|Ga0208686_1121352 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300025915|Ga0207693_10468226 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
| 3300025921|Ga0207652_10450208 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1161 | Open in IMG/M |
| 3300025922|Ga0207646_10713150 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 896 | Open in IMG/M |
| 3300025928|Ga0207700_10329722 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1324 | Open in IMG/M |
| 3300025928|Ga0207700_11986168 | Not Available | 508 | Open in IMG/M |
| 3300025945|Ga0207679_10655079 | Not Available | 950 | Open in IMG/M |
| 3300026308|Ga0209265_1044618 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1372 | Open in IMG/M |
| 3300026467|Ga0257154_1019017 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 989 | Open in IMG/M |
| 3300026515|Ga0257158_1122948 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300026529|Ga0209806_1088197 | All Organisms → cellular organisms → Bacteria | 1353 | Open in IMG/M |
| 3300026538|Ga0209056_10226491 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1346 | Open in IMG/M |
| 3300027109|Ga0208603_1011613 | All Organisms → cellular organisms → Bacteria | 1444 | Open in IMG/M |
| 3300027432|Ga0209421_1054415 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 799 | Open in IMG/M |
| 3300027643|Ga0209076_1187142 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
| 3300027648|Ga0209420_1157052 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300027648|Ga0209420_1169758 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
| 3300027648|Ga0209420_1203541 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300027651|Ga0209217_1024271 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1927 | Open in IMG/M |
| 3300027667|Ga0209009_1182079 | Not Available | 533 | Open in IMG/M |
| 3300027676|Ga0209333_1058181 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1064 | Open in IMG/M |
| 3300027842|Ga0209580_10570246 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
| 3300027903|Ga0209488_10543564 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300027903|Ga0209488_11000413 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300027908|Ga0209006_10627063 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 886 | Open in IMG/M |
| 3300028560|Ga0302144_10266394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300028746|Ga0302233_10370360 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300028792|Ga0307504_10146937 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 797 | Open in IMG/M |
| 3300028863|Ga0302218_10260485 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 559 | Open in IMG/M |
| 3300028874|Ga0302155_10012065 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4578 | Open in IMG/M |
| 3300028906|Ga0308309_10893947 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 771 | Open in IMG/M |
| 3300028906|Ga0308309_11376617 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300029883|Ga0311327_10285127 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1081 | Open in IMG/M |
| 3300029943|Ga0311340_10193214 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2061 | Open in IMG/M |
| 3300029944|Ga0311352_10234263 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1551 | Open in IMG/M |
| 3300029951|Ga0311371_11516389 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 745 | Open in IMG/M |
| 3300029951|Ga0311371_12142651 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300029982|Ga0302277_1248614 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
| 3300029986|Ga0302188_10211035 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 818 | Open in IMG/M |
| 3300030503|Ga0311370_10027211 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8684 | Open in IMG/M |
| 3300030503|Ga0311370_11079491 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 885 | Open in IMG/M |
| 3300030580|Ga0311355_10933513 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 785 | Open in IMG/M |
| 3300030687|Ga0302309_10336743 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
| 3300030940|Ga0265740_1002665 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1267 | Open in IMG/M |
| 3300031090|Ga0265760_10121947 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300031233|Ga0302307_10609647 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300031234|Ga0302325_10226317 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3164 | Open in IMG/M |
| 3300031234|Ga0302325_10417537 | All Organisms → cellular organisms → Bacteria | 2079 | Open in IMG/M |
| 3300031525|Ga0302326_12031075 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 741 | Open in IMG/M |
| 3300031573|Ga0310915_10883249 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 627 | Open in IMG/M |
| 3300031715|Ga0307476_10874638 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 664 | Open in IMG/M |
| 3300031716|Ga0310813_10151538 | Not Available | 1866 | Open in IMG/M |
| 3300031718|Ga0307474_11165025 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
| 3300031718|Ga0307474_11315060 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
| 3300031718|Ga0307474_11375609 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300031718|Ga0307474_11388704 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300031720|Ga0307469_10313745 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1298 | Open in IMG/M |
| 3300031753|Ga0307477_10363932 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
| 3300031754|Ga0307475_10503760 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 972 | Open in IMG/M |
| 3300031823|Ga0307478_10281014 | All Organisms → cellular organisms → Bacteria | 1359 | Open in IMG/M |
| 3300031897|Ga0318520_10646254 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 659 | Open in IMG/M |
| 3300031910|Ga0306923_10723366 | Not Available | 1106 | Open in IMG/M |
| 3300031954|Ga0306926_10154448 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2843 | Open in IMG/M |
| 3300031962|Ga0307479_12116988 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300032783|Ga0335079_11384323 | Not Available | 699 | Open in IMG/M |
| 3300032805|Ga0335078_10236024 | All Organisms → cellular organisms → Bacteria | 2508 | Open in IMG/M |
| 3300032805|Ga0335078_10247151 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2438 | Open in IMG/M |
| 3300032828|Ga0335080_11679827 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
| 3300032892|Ga0335081_10658299 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1279 | Open in IMG/M |
| 3300033158|Ga0335077_11020278 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 823 | Open in IMG/M |
| 3300033158|Ga0335077_12161410 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300034163|Ga0370515_0164360 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 950 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 14.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.14% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 8.25% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 6.80% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.34% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.88% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.40% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.40% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 2.91% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.91% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.43% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.94% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.46% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.46% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.46% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.46% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.46% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.46% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.97% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.97% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.49% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.49% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.49% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.49% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.49% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.49% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.49% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.49% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.49% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.49% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.49% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.49% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.49% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.49% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001087 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 | Environmental | Open in IMG/M |
| 3300001144 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O1 | Environmental | Open in IMG/M |
| 3300001166 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 | Environmental | Open in IMG/M |
| 3300001174 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 | Environmental | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005607 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
| 3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300019268 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022733 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU3 | Environmental | Open in IMG/M |
| 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5 | Host-Associated | Open in IMG/M |
| 3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
| 3300025414 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025500 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026467 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-A | Environmental | Open in IMG/M |
| 3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027109 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF008 (SPAdes) | Environmental | Open in IMG/M |
| 3300027432 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028560 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_2 | Environmental | Open in IMG/M |
| 3300028746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028863 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300028874 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029883 | I_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029982 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_1 | Environmental | Open in IMG/M |
| 3300029986 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_1 | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030687 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_1 | Environmental | Open in IMG/M |
| 3300030940 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1034708441 | 3300000955 | Soil | MVQGEYQINKRWSVSVARDQVGGVSVDGRFHTKF*TG |
| JGI12677J13195_10027651 | 3300001087 | Forest Soil | QPGSEIVQGDYQINPRWSVSLTRDEVGGVSVDGKYHTKF* |
| JGI12645J13327_1028902 | 3300001144 | Forest Soil | SQPGSEIVQGDYQINQRWSVSLTRDEVGGVSVDGKYHTKF* |
| JGI12694J13545_10255311 | 3300001166 | Forest Soil | GAEMVEGEYQVNKRWSVSMTRDQLGGVSVDGRYHTRF* |
| JGI12679J13547_10120012 | 3300001174 | Forest Soil | GSEMVQGEYQLNKRWSVSAARDQLGGVSVDGRYHTRF* |
| JGI12712J15308_100425302 | 3300001471 | Forest Soil | FTFSTDVSQPGTEIVQGDYQINKRWSVSVARDETGGVSVDGRYHTKF* |
| JGI12630J15595_100871912 | 3300001545 | Forest Soil | LGGNNQNPSARIALQQRVTKNFLFTFSTDISQPGSQIVQGDYQINKRWSVSVARDQVGGVSVDGKFHKRF* |
| JGI12627J18819_103838102 | 3300001867 | Forest Soil | FTFSTDVSQPGSEMVEGDYQLTKRWSVSVARDQTGGVSVDGRFHTRF* |
| JGIcombinedJ26739_1001132511 | 3300002245 | Forest Soil | NLLFTFSTDVSQPGTEVVQGDYQINKRWSVSVARDETGGVSVDGRYHTKF* |
| C688J35102_1202965572 | 3300002568 | Soil | SKDLLFSFSTDVSQPGSEIVQGEYQINRRWSVTVQRDQLGGVSIDGRYHKRF* |
| Ga0062595_1021869661 | 3300004479 | Soil | SSDVSQPGSEMVQGDYQINKRWSVSVARDQLGGVSIDGKFHTRF* |
| Ga0066395_107608312 | 3300004633 | Tropical Forest Soil | FTFSTDVSQPGSEIVQGEYQINQRWSTTVTRDQLGGVSIDGKYHKRF* |
| Ga0066809_101799281 | 3300005168 | Soil | ITRNFLFTFSTDVSQPGSEVVQGEYQINKRWSVSMARDQSGGVSVDGRYHTRF* |
| Ga0066679_100298414 | 3300005176 | Soil | KNFLFTFSTDVSQPGSEMVQGDYRLTKRWSVSVARDQLGGVAVDGRFHTRF* |
| Ga0066388_1033380871 | 3300005332 | Tropical Forest Soil | SQPGSEIVQGEYQLNKRWSVSVERDQLGGVSIDGRYHSRF* |
| Ga0066388_1036643982 | 3300005332 | Tropical Forest Soil | QPGSEIVQGDYQINKRWSVSVARDQLGGVSIDGKFHTSF* |
| Ga0070687_1007322532 | 3300005343 | Switchgrass Rhizosphere | FLFTFSTDVSQPGAETVEGKYQINKRWSIGAARDQVGGIAVNGRYHTRF* |
| Ga0070714_1008458052 | 3300005435 | Agricultural Soil | TQPQGEIVQGEYQLNKRWSVSVVRDESGGFAVDGRYHTNF* |
| Ga0070713_1012713242 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | FLFSFSTDVSEPGNEIVQGEYQFNKRWSVSVERDQLGGVSIDGRYHKQF* |
| Ga0073909_100465691 | 3300005526 | Surface Soil | VTKNFLFTFSTDVSQPGNEIVQGEYQINKRWSVSVSRDQSGGVSVDGRYHKRF* |
| Ga0070679_1002853663 | 3300005530 | Corn Rhizosphere | TKNFLFTFSTDVSQPGAETVEGKYQINKRWSIGAARDQVGGIAVNGRYHTRF* |
| Ga0070735_104947142 | 3300005534 | Surface Soil | EIVQGEYQINKRWSVSVARDELGGISVDGRLHTRF* |
| Ga0066698_103258762 | 3300005558 | Soil | EIVQGEYQINKRWSVSATRDASGGFSVDGKFHSTF* |
| Ga0070664_1021016852 | 3300005564 | Corn Rhizosphere | RVTNKLLFSFSTDVSQPGSEIVQGEYQINKRWSVSLARDQVGGISVDGKYHTRF* |
| Ga0066654_103936613 | 3300005587 | Soil | TDVSQPGSELVQGDYKINKRWSVSVARDQLGGVSVDGRFHSTF* |
| Ga0070762_111127051 | 3300005602 | Soil | LFTFSTDVSQPGSEIVQGEYQINKRWSVSMERDQVGGVSVDGKYHTRF* |
| Ga0070740_101370121 | 3300005607 | Surface Soil | SEIVQGDYQFNKRWSVSVQRDQLGGVSVDGRYHKQF* |
| Ga0070763_106409903 | 3300005610 | Soil | FTFSTDVSQPGSEIVQGEYQLNKRWSVSMARDQLGGVSVDGKYRKSF* |
| Ga0068856_1016095702 | 3300005614 | Corn Rhizosphere | FSTDVSQPGSEIVQGEYEINKRWSMSVARDQVGGISVDGKYHTRF* |
| Ga0070766_104517412 | 3300005921 | Soil | SEIVQGEYQLNKRWSVSMARDQLGGVSVDGKYRKSF* |
| Ga0070766_107766041 | 3300005921 | Soil | SEMVQGEYQINKRWSVSMARDQLGGVSVDGKYHTRF* |
| Ga0070717_118891411 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | KNFLFTFSTDVTRPQSEIVQGEYQLTKRWSVSLVRDQSGGVAVDGKFHTNF* |
| Ga0066656_109105692 | 3300006034 | Soil | QSEIVQGEYQFTKRWSVSVVRDKNGGVAVDGKFHTKF* |
| Ga0075019_110540781 | 3300006086 | Watersheds | ISQPGSEMVQGEYQVNKHWSVSVSRDQLGGASVDGKYHTRF* |
| Ga0070765_1003991883 | 3300006176 | Soil | GSEIVQGDYQINQRWSVSLTRDEVGGVSVDGKYHTKF* |
| Ga0070765_1011759631 | 3300006176 | Soil | FSTDVTQPQQEIVQGEYQINKRWSVSVTRDELGGIAVDGRLHTKF* |
| Ga0070765_1016995352 | 3300006176 | Soil | VSQPGQEIVQGDYQINKKWSVSVQRDQLGGVSVDGRFHTSF* |
| Ga0070765_1017660962 | 3300006176 | Soil | GSEIVQGEYQFNKRWSVSVQRDQLGGVAVDGRYHTRF* |
| Ga0070765_1019021411 | 3300006176 | Soil | QRVTKNFLFTFSSDISQPGSQIVQGDYQINQRWSVSVGRDQVGGVSVDGKFHTRF* |
| Ga0079222_123455812 | 3300006755 | Agricultural Soil | GSEIVQGEYQINKRWSVSVARDQLGGVSVDGRFHTRF* |
| Ga0066659_116664132 | 3300006797 | Soil | SEPGSEIVHGDYLVTKRWSVSVARDQLGGVSVDGKYHTKF* |
| Ga0073928_103265051 | 3300006893 | Iron-Sulfur Acid Spring | RNFLFTFSTDLSQPGSEIVQGDYQINKRWSVSLTRDEVGGVSVDGKYHTKF* |
| Ga0075435_1009996671 | 3300007076 | Populus Rhizosphere | PGSEIVQGEYQINRRWSVSVQRDELGGVSVDGKYHSRF* |
| Ga0099791_105651021 | 3300007255 | Vadose Zone Soil | MVQGEYQLNKHWSVSTARDQFGGVSIDGKYRTRF* |
| Ga0099795_102286761 | 3300007788 | Vadose Zone Soil | QPGEEIVEGDYQINKRWSVSVARDQLGGVSVDGRFHTKF* |
| Ga0099795_103876271 | 3300007788 | Vadose Zone Soil | NFLFTFSTDVSQPGTEIVQGEYQINKRWSVSVARDEVGGVSVDGHFRTKF* |
| Ga0102924_12199332 | 3300007982 | Iron-Sulfur Acid Spring | SQPGQEIVQGDYQINQKWSVSVARDQLGGVSVDGRYRTKF* |
| Ga0102924_12803972 | 3300007982 | Iron-Sulfur Acid Spring | SQPGQEIVQGDYQINQKWSVSVARDQLGGVSVDGRYHTKF* |
| Ga0102924_13356791 | 3300007982 | Iron-Sulfur Acid Spring | TKNLLFTFSTDVSQPGSEMVQGEYQLNKRWSVSMARDQLGGVSVDGRYHTRF* |
| Ga0099830_115125581 | 3300009088 | Vadose Zone Soil | EIVQGDYQINKRWSVSVARDQLGGVAVDGRFHTKF* |
| Ga0099830_118326722 | 3300009088 | Vadose Zone Soil | VSKNFLFTFSTDVSQPGSEMVQGDYQINKRWSVSVARGQQGGVSIDGRFHTKF* |
| Ga0099827_114666881 | 3300009090 | Vadose Zone Soil | GSEMVQGEYQLNKHWSVSTARDQLGGVSIDGKYRTRF* |
| Ga0116125_11556901 | 3300009628 | Peatland | TDVSQPGSEIVQGEYQINKRWSVSVQRDQLGGVAVDGRYHKQF* |
| Ga0116113_11092973 | 3300009638 | Peatland | FLFTFSTDLSQPGSEIVQGDYQINQHWSVGVTRDEVGGVAVNGKYHTKF* |
| Ga0116106_12725362 | 3300009645 | Peatland | VTKNFLFTFSTDLSQPGSEIVQGDYQINQHWSVGVTRDEVGGVAVNGKYHTKF* |
| Ga0116135_12533532 | 3300009665 | Peatland | EIVEGDYQINKRWSVSVARDQLGGVSVDGRFHTKF* |
| Ga0116130_12470642 | 3300009762 | Peatland | SQPGSEMVQGEYQINKRWSVSAARDQLGGVSVDGRYHTRF* |
| Ga0126380_118685572 | 3300010043 | Tropical Forest Soil | EIVQGEYQINKHWSVSVTRDELGGVAVDGRFHTKF* |
| Ga0126373_103493491 | 3300010048 | Tropical Forest Soil | KSLLFTFSTDVSQPGSEIVQGEYQLNKRWSVSVERDQLGGVSIDGRYHSRF* |
| Ga0126318_109100762 | 3300010152 | Soil | LLFSFSTDVSQPGSEIVQGEYEINKRWSMSVARDQVGGISVDGKYHTRF* |
| Ga0126370_126361591 | 3300010358 | Tropical Forest Soil | EIVQGEYHINKRWSVSVSRDQLGGVSVDGRYHKRF* |
| Ga0126372_129293341 | 3300010360 | Tropical Forest Soil | KNFLFTFSTDVTQPGSELVQGDYQINKRWSVSVARDQLGGVSVDGRFHTSF* |
| Ga0126381_1032771712 | 3300010376 | Tropical Forest Soil | FLFTFSTDVSQPGSEIVQGEYHINKRWSVSVSRDQLGGVSVDGRYHKRF* |
| Ga0134124_100769101 | 3300010397 | Terrestrial Soil | GAETVEGKYQINKRWSIGAARDQVGGIAVNGRYHTRF* |
| Ga0137392_101768651 | 3300011269 | Vadose Zone Soil | QPGSQIVQGDYQINKRWSVSVARDQVGGVSVDGKFHKRF* |
| Ga0137392_112998071 | 3300011269 | Vadose Zone Soil | QRVTKNFLFTFSTDVSQPGEEIVEGDYQINKRWSVSVARDQVGGVSVDGKFHTSF* |
| Ga0137391_105481261 | 3300011270 | Vadose Zone Soil | LGGNNQNPSARIALQQRVTKNFLFTFSSDISQPGSQIVQGDYQINKRWSVSVARDQVGGVSVDGKFHKSF* |
| Ga0137388_107760412 | 3300012189 | Vadose Zone Soil | QPGSEMVQGDYQINKRWSVSVARDQLGGVSVDGRYHTKF* |
| Ga0137388_109762431 | 3300012189 | Vadose Zone Soil | PGAETVGGDYQINKRWSVSVSRDPLGGVSVDGRYHTKF* |
| Ga0137376_106461061 | 3300012208 | Vadose Zone Soil | GNEIVQGNYQINKRWSVSVARDQLGGVSIDGRFHTKF* |
| Ga0137376_114919011 | 3300012208 | Vadose Zone Soil | QRVTKNFLFTFSTDISQPGSQIVQGDYQISKRWSVSVARDQVGGVSVDGKFHKRF* |
| Ga0137379_105012691 | 3300012209 | Vadose Zone Soil | LFTFSTDVSQPGSEMVQGEYQISKRWSVSMARDQLGGVSVDGRYHTRF* |
| Ga0137377_100230471 | 3300012211 | Vadose Zone Soil | LLGGSNQNPSARIALQQRVTKNFLFTFSTDISQPGSQIVQGDYQISKRWSVSVARDQVGGVSVDGKFHKRF* |
| Ga0150985_1058911473 | 3300012212 | Avena Fatua Rhizosphere | DVSQPGSEIVQGEYQLNKRWSVSVERDQLGGVSVDGRYHTRF* |
| Ga0137367_106452921 | 3300012353 | Vadose Zone Soil | NLLFTFSTDVSQPGSEMVQGEYQLNKHWSVSTARDQLGGVSVDGRYHTRF* |
| Ga0137371_105651711 | 3300012356 | Vadose Zone Soil | MVQGEYQISKRWSVSMARDQLGGVSVDGRYHTRF* |
| Ga0137360_104454981 | 3300012361 | Vadose Zone Soil | FSTDVSQPGNEIVQGNYQINKRWSVSVARDQLGGVSIDGRFHTKF* |
| Ga0137390_108382151 | 3300012363 | Vadose Zone Soil | AETVGGDYQINKRWSVSVSRDPLGGVSVDGRYHTKF* |
| Ga0137390_109415302 | 3300012363 | Vadose Zone Soil | STDVSQPGAEIVQGDYQINKRWSVSVARDQLGGVAVDGRFHTKF* |
| Ga0137397_111960982 | 3300012685 | Vadose Zone Soil | GSEIVQGEYQINKRWSVNVARDQLGGVSVDGRYHKRF* |
| Ga0137396_104151942 | 3300012918 | Vadose Zone Soil | QPGSQIVQGDYQINKRWSVSVARDQVGGVSVDGKFHRRF* |
| Ga0137359_102081081 | 3300012923 | Vadose Zone Soil | PGAEVVEGDYQINKRWSVSVARDQLGGVSVDGRFHTKF* |
| Ga0137359_105482681 | 3300012923 | Vadose Zone Soil | QRVTKNFLFTFSTDISQPGSQIVQGDYQINKRWSVSVARDQVGGVSVDGKFHRRF* |
| Ga0137419_104038641 | 3300012925 | Vadose Zone Soil | KNFLFTFSTDVSQPGSEVVQGEYQINKRWSVSTTRDQVGGVSIDGRLHTRF* |
| Ga0126369_121865081 | 3300012971 | Tropical Forest Soil | TDVSQPNGETIEGEYQINKNWSIGVARDPVGGISVEGRHRTKF* |
| Ga0181531_102923682 | 3300014169 | Bog | STDVSQPGSEIVQGEYQFNKRWSVSVQRDQLGGVSVDGRYHTRF* |
| Ga0181535_105057752 | 3300014199 | Bog | VSQPGQEIVQGEYQIDKKWSVSVERDQLGGVSVDGRFHTSF* |
| Ga0182018_104723432 | 3300014489 | Palsa | LQQRVTKNFLFTFSTDVTQAGSEVVQGDYDINRRWSVSVSRDQLGGVSVYGRYRTKF* |
| Ga0182024_107368092 | 3300014501 | Permafrost | LFTFSTDLSQPGTEIVQGDYQINPRWSVSLTRDEVGGVSVDGKYHTKF* |
| Ga0182024_111218201 | 3300014501 | Permafrost | GQEIVQGDYQINQKWSVSVARDQLGGVSVDGRYHTKF* |
| Ga0181525_106364221 | 3300014654 | Bog | RVTKNFLFTFSTDVSQPGSEIVEGNYQINKRWSVSVARDEAGGVSTEGRLHTRF* |
| Ga0137418_108433862 | 3300015241 | Vadose Zone Soil | NLLFTFSTDVSQPGSEMVQGEYRISKHWSVSMSRDQIGGVSVDGKYHSRF* |
| Ga0137418_108679161 | 3300015241 | Vadose Zone Soil | FTFSTDVSQPGTEIVQGEYQINKRWSVSVARDEVGGVSVDGHFRTKF* |
| Ga0132258_129209301 | 3300015371 | Arabidopsis Rhizosphere | PGSEIVQGEYHLNKRWSVSLERDQLGGVSVDGRYHTRF* |
| Ga0182033_100334642 | 3300016319 | Soil | PSARIALQQRVTKNFLFTFTTDVSQPGSEQIQGEYQFNPRWSLRVTGDELGGVAADGRYHTKF |
| Ga0187779_109993551 | 3300017959 | Tropical Peatland | TFSTDVSEPGSEQLQGEYQFNPRWSVRVTGDELGGVAVDGRYHTKF |
| Ga0187777_106057341 | 3300017974 | Tropical Peatland | KNFLFTFSTDVSQPGSEQLQGEYQFNPRWSVRVTGDELGGVAVDGRYHTKF |
| Ga0187888_10419321 | 3300018008 | Peatland | FLFTFSTDLSQPGSEIVQGDYQINQHWSVGVTRDEVGGVAVNGKYHTKF |
| Ga0187872_102143942 | 3300018017 | Peatland | RVTKNFLFTFSTDLSQPGSEIVQGDYQINQHWSVGVTRDEVGGVAVNGKYHTKF |
| Ga0187784_104348942 | 3300018062 | Tropical Peatland | GSEQVQGEYTFNPRWSIRVTGDELGGVAVDGRYHTKF |
| Ga0181514_13078851 | 3300019268 | Peatland | PGSEIVQGDYQLNKRWSVSLTRDEVGGISVDGKYHTKF |
| Ga0182025_10182961 | 3300019786 | Permafrost | NNQNPSARVALQQRVTKNFLFTFSTDLSQPGSEVVQGDYQINKRWSVSLTRDEVGGVSVDGKYHTKF |
| Ga0193751_10118051 | 3300019888 | Soil | STDVSQPGSEMVQGEYQVSKHWSVSMARDQLGGVSVDGRYHTRF |
| Ga0210399_111706281 | 3300020581 | Soil | SEIVQGEYQLNKRWSVSMSRDQLGGVSVDGKYRKSF |
| Ga0210395_100743131 | 3300020582 | Soil | TKNLLFTFSTDVSQPGSEIVQGEYQLNKRWSVSMARDQLGGVSVDGKYRKSF |
| Ga0210401_112918261 | 3300020583 | Soil | FSTDVSQPGSEIVQGEYQLNKRWSVSMARDQLGGVSVDGKYRKSF |
| Ga0210406_107411331 | 3300021168 | Soil | FTFSTDVSEPGSEMVQGEYQLNKRWSVSVERDQLGGVSVDGKYHTRF |
| Ga0210400_105664001 | 3300021170 | Soil | DVSQPGSEIVQGEYQLNKRWSVSMARDQLGGVSVDGKYRKSF |
| Ga0210400_114573172 | 3300021170 | Soil | QRVTKNFLFTFSTDVSQPGSEMVRGEYQVNKRWSVSMARDQTGGVSVDGHYHTRF |
| Ga0210405_100286914 | 3300021171 | Soil | TDVSQPGEEIVEGDYQINKRWSVSVARDQLGGVSVDGRFHTKF |
| Ga0210408_100439891 | 3300021178 | Soil | QRVTKNFLFTFSTDVSQPGNEMVQGDYQINKRWSVSMARDQTGGVSVNGRYHTNF |
| Ga0210396_1001230212 | 3300021180 | Soil | LLFTFSTDVSQPGSEIVQGEYQLNKRWSVSMARDQLGGVSVDGKYRKSF |
| Ga0210396_104460883 | 3300021180 | Soil | SQPGSEMVRGEYQVNKRWSVSMARDQTGGVSVDGHYHTRF |
| Ga0210393_113993682 | 3300021401 | Soil | NLLFTFSTDVSQPGAELVEGEYQVNKRWSVSMARDQLGGVSVDGRYHTRF |
| Ga0210397_102569041 | 3300021403 | Soil | TDVSQPGQEIVQGDYQINQKWSVSVARDQLGGVSVDGRYHTKF |
| Ga0210397_102588461 | 3300021403 | Soil | SEMVRGEYQVNKRWSVSMARDQTGGVSVDGHYHTRF |
| Ga0210394_107170892 | 3300021420 | Soil | NFLFTFSTDVSQPGNEMVQGDYQINKRWSVSMARDQTGGVSVNGRYHTNF |
| Ga0210394_114920071 | 3300021420 | Soil | GSEIVQGEYQLNKRWSVSMARDQLGGVSVDGKYRKSF |
| Ga0210391_104817811 | 3300021433 | Soil | FSFSTDVSQPGSEIVQGEYQFNKRWSVSVQRDQLGGVAVDGRYHTRF |
| Ga0210390_100869643 | 3300021474 | Soil | PGQEIVQGEYQINKKWSVSVERDQLGGVSVDGRFHTSF |
| Ga0210390_103442273 | 3300021474 | Soil | EIVQGEYQLNKRWSVSMARDQLGGVSVDGKYRKSF |
| Ga0210402_101781901 | 3300021478 | Soil | TFSTDLSEPGSEIVQGEYQINKRWSVSVQRDQLGGVSVDGRYHSKF |
| Ga0210410_102547193 | 3300021479 | Soil | SQPGSEIVQGEYQLNKRWSVSMARDQLGGVSVDGKYRKSF |
| Ga0210410_116827482 | 3300021479 | Soil | TEVVQGDYQVNKRWSVSVTRDEVGGVSVGGKYHTKF |
| Ga0126371_107358282 | 3300021560 | Tropical Forest Soil | TFSTDVSQPGSEIIQGEYQINRRWSVSAARDELGGLSVDGRFHRRF |
| Ga0126371_115259581 | 3300021560 | Tropical Forest Soil | QPGAEIIQGEYQINRRWSVSMSRDQLGGFSIDGRYHKRF |
| Ga0126371_125086111 | 3300021560 | Tropical Forest Soil | LFTFSTDLSNPGSEQIQGDYQLTKRWSVSMARDELGGVSVDGRYHTRF |
| Ga0212123_104798801 | 3300022557 | Iron-Sulfur Acid Spring | VSQPGQEIVQGDYQINQKWSVSVARDQLGGVSVDGRYRTKF |
| Ga0212123_107136141 | 3300022557 | Iron-Sulfur Acid Spring | FSTDLSQPGSEIVQGDYQINKRWSVGLTRDEVGGVSVDGKYHTKF |
| Ga0224562_10249311 | 3300022733 | Soil | EIVQGDYQINKRWSVSVTRDEVGGVSVDGKYHTKF |
| Ga0224572_10019011 | 3300024225 | Rhizosphere | PGTEIVQGDYQINQRWSVSVTRDEVGGISVDGKYHTKF |
| Ga0224564_10084893 | 3300024271 | Soil | DVSQAGQEIVQGEYQINKKWSVSVERDQLGGVSVDGRFHTSF |
| Ga0224564_11004832 | 3300024271 | Soil | NFLFTFSTDLSQPGTEIVQGDYQINQRWSVSVTRDEVGGISVDGKYHTKF |
| Ga0208935_10036981 | 3300025414 | Peatland | STDLSQPGTEVVQGDYQLNKRWSVSVTRDETGGISVDGKYHTKF |
| Ga0208686_11213522 | 3300025500 | Peatland | VTKNFLFTFSTDLSQPGSEIVQGDYQINQHWSVGVTRDEVGGVAVNGKYHTKF |
| Ga0207693_104682262 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | FSTDVSQAGSEIVQGEYRINKRWSVSATRDQLGGVSVDGKYHTKF |
| Ga0207652_104502082 | 3300025921 | Corn Rhizosphere | RVTKNFLFTFSTDVSQPGAETVEGKYQINKRWSIGAARDQVGGIAVNGRYHTRF |
| Ga0207646_107131501 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | GSEMVQGEYQLNKRWSVSMARDQLGGVSVDGRFHTKF |
| Ga0207700_103297221 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | GNEIVQGDYQINRRWSVSVSRDQLGGVSVDGRYHTKF |
| Ga0207700_119861682 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | KNFLFSFSTDVSEPGNEIVQGEYQFNKRWSVSVERDQLGGVSIDGRYHKQF |
| Ga0207679_106550792 | 3300025945 | Corn Rhizosphere | RVTKKLLFSFSTDVSQPGSEIVQGEYEINKRWSMSVARDQVGGISVDGKYHTRF |
| Ga0209265_10446182 | 3300026308 | Soil | FTFSTDVTQPQNEIVQGEYQLNKRWSVSVVRNESGGFAVDGRFHTNF |
| Ga0257154_10190171 | 3300026467 | Soil | NFLFTFSTDVSQPGSEVVEGDYQINKRWSVSVTRDQVGGVAVDGRLHTRF |
| Ga0257158_11229481 | 3300026515 | Soil | ALQQRVTKNFLFTFSTDISQPGGQIVQGDYQINKRWSVSVARDQVGGVSVDGKFHKRF |
| Ga0209806_10881971 | 3300026529 | Soil | TFSTDISQPGSQIVQGDYQISKRWSVSVARDQVGGVSVDGKFHKRF |
| Ga0209056_102264911 | 3300026538 | Soil | DVSQPGSELVQGDYQINKRWSVSVARDQLGGVSVDGRFHSKF |
| Ga0208603_10116131 | 3300027109 | Forest Soil | TKNFLFTFSTDVSQPGNEMVQGDYQINKRWSVSMARDQTGGVSVNGRYHTNF |
| Ga0209421_10544151 | 3300027432 | Forest Soil | QPGNEIVEGDYQINKRWSVSVARDQLGGVSIDGRFHTKF |
| Ga0209076_11871423 | 3300027643 | Vadose Zone Soil | QPGSEIVQGEYQINKRWSASVTRDQLGGVSIDGKYHTKF |
| Ga0209420_11570522 | 3300027648 | Forest Soil | NFLFTFSTDLSQPGEEIVQGDYQINKRWSVSVARDQVGGVSVDGRFHTKF |
| Ga0209420_11697581 | 3300027648 | Forest Soil | FSTDVSQPGSEIVEGTYQINKRWSVSVARDEAGGVSTEGKLHTRF |
| Ga0209420_12035411 | 3300027648 | Forest Soil | QNPTARVAIQQLVSKDFLFTFSTDLSQPGSEIVQGDYQINKRWSVSVTRDEVGGISVDGKYHTSF |
| Ga0209217_10242713 | 3300027651 | Forest Soil | QNPSARIALQQRVTKNFLFTFSTDISQPGSQIVQGDYQINKRWSVSVARDQVGGVSVDGKFHKRF |
| Ga0209009_11820791 | 3300027667 | Forest Soil | TFSTDVTQPGSEVVQGDYEINRRWSVSVSRDQLGGVSVYGRYRTKF |
| Ga0209333_10581812 | 3300027676 | Forest Soil | STDVSQPGQEIVQGEYQINKKWSVSVERDQLGGVSVDGRYHTSF |
| Ga0209580_105702462 | 3300027842 | Surface Soil | EIVQGDYQLTKRWLVSVARDQLGGVSIDGRFHTKF |
| Ga0209488_105435642 | 3300027903 | Vadose Zone Soil | DVSQPGSEVVQGEYQINKRWSVSTTRDQVGGVSIDGRLHTRF |
| Ga0209488_110004131 | 3300027903 | Vadose Zone Soil | FLFTFSTDVSQPGSEVVQGEYQINKRWSVSTTRDQVGGVSIDGRLHTRF |
| Ga0209006_106270631 | 3300027908 | Forest Soil | EMVQGEYQINKRWSVSMARDQLGGVSVDGKYHTRF |
| Ga0302144_102663942 | 3300028560 | Bog | EVVQGDYQINPRWSVSVARQEAGGISAEGRFHTKF |
| Ga0302233_103703602 | 3300028746 | Palsa | RVTRNFLFTFSTDLSQPGEEIVQGDYQINKRWSVSVARDQVGGVSVDGRFHTKF |
| Ga0307504_101469371 | 3300028792 | Soil | SQPGNEIVQGNYQINKRWSVSVARDQLGGVSIDGRFHTKF |
| Ga0302218_102604851 | 3300028863 | Palsa | NQNPSARVAIQQRVSKNFLFTFSTDLSQPGTEVVQGDYQINKRWSVSVTRDEVGGISVDGKYHTKF |
| Ga0302155_100120656 | 3300028874 | Bog | IQQRVSKNFLFTFSTDVSQPGSEIVQGDYRINPRWSLSVARQEAGGVSAEGRFHTQF |
| Ga0308309_108939471 | 3300028906 | Soil | FSTDVTQPQQEIVQGEYQINKRWSVSVTRDELGGIAVDGRLHTKF |
| Ga0308309_113766172 | 3300028906 | Soil | KNFLFTFSTDVSQPGQEIVQGDYQINKKWSVSVQRDQLGGVSVDGRFHTSF |
| Ga0311327_102851271 | 3300029883 | Bog | VALQQRVTKNFLFTFSTDLSQPGSEIVQGDYQINKRWSVSVTRDEVGGVSVDGKYHTKF |
| Ga0311340_101932143 | 3300029943 | Palsa | QPGTEVVQGEYQLNKRWSVSVARDETGGVSVNGRYHTKF |
| Ga0311352_102342631 | 3300029944 | Palsa | FTTDVSQPGSEMVQGEYQINKRWSVSTTRDQLGGVSVDGRYHTRF |
| Ga0311371_115163891 | 3300029951 | Palsa | FSTDLSQPGTEVVQGEYQLNKRWSVSVARDETGGVSVNGRYHTKF |
| Ga0311371_121426512 | 3300029951 | Palsa | QPGSEIVLGEYQINKRWSVSVERDQVGGVSVDGKYHTKF |
| Ga0302277_12486141 | 3300029982 | Bog | QRVSKNFLFTFSTDLSQPGEEIVEGDYQINKRWSVSVARDQLGGVSVDGRFHTKF |
| Ga0302188_102110351 | 3300029986 | Bog | PGEEIVQGDYQINKRWSVSVARDQLGGVTVDGRFHTKF |
| Ga0311370_1002721112 | 3300030503 | Palsa | ALQQRVTKNFLFTFSTDVSQPGSEIVEGNYQINKRWSVSVARDEAGGVSTEGRLHTRF |
| Ga0311370_110794912 | 3300030503 | Palsa | LFTFSTDVSQPGSEVVQGEYQFNKRWSASVTRDQVGGISVDGRLHTRF |
| Ga0311355_109335131 | 3300030580 | Palsa | GSEIVEGNYQINKRWSVSVARDEAGGVSTEGRLHTRF |
| Ga0302309_103367432 | 3300030687 | Palsa | STDLSQPGTEVVQGEYQLNKRWSVSVARDETGGVSVNGRYHTKF |
| Ga0265740_10026652 | 3300030940 | Soil | QPGSEIVQGEYQLNKRWSVSMARDQLGGVSVDGKYRKSF |
| Ga0265760_101219472 | 3300031090 | Soil | SQPGSEIVQGDYQINPRWSVSLTRDEVGGVSVDGKYHTKF |
| Ga0302307_106096472 | 3300031233 | Palsa | FTFSTDVSQPGSEVVQGEYQFNKRWSASVTRDQVGGISVDGRLHTRF |
| Ga0302325_102263176 | 3300031234 | Palsa | QNPSARVAIQQRVSKNFLFTFSTDLSQPGTEVVQGDYQINKRWSVSVTRDEVGGISVDGKYHTKF |
| Ga0302325_104175374 | 3300031234 | Palsa | FTFSTDVSQPGSEIVEGNYQINKRWSVSVARDEAGGVSTEGRLHTRF |
| Ga0302326_120310751 | 3300031525 | Palsa | TEIVEGDYRINNRWSVSVTRDEVGGVSVDGKFHTKF |
| Ga0310915_108832491 | 3300031573 | Soil | LQQRVTKNFLFTFTTDVSQPGSEQIQGEYQFNPRWSLRVTGDELGGVAADGRYHTKF |
| Ga0307476_108746381 | 3300031715 | Hardwood Forest Soil | SQPGSEIVQGEYQFNKRWSVSVQRDQLGGVAVDGRYHTRF |
| Ga0310813_101515382 | 3300031716 | Soil | STDVSQPGSEIVQGEYEINKRWSMSVARDQVGGISVDGKYHTRF |
| Ga0307474_111650251 | 3300031718 | Hardwood Forest Soil | LSQPGTEIVQGDYQINKRWSVSLTRDQVGGVSVDGKYHTKF |
| Ga0307474_113150601 | 3300031718 | Hardwood Forest Soil | DASQPGSEIVQGEYQINKRWSVSATRDQVGGVAVDGRLHTRF |
| Ga0307474_113756092 | 3300031718 | Hardwood Forest Soil | NEIVQGEYQINKRWSASVTRDQLGGVAVDGKFHTRF |
| Ga0307474_113887042 | 3300031718 | Hardwood Forest Soil | QPGEEIVEGDYQINKRWSVSVARDQLGGVSVDGRFHTKF |
| Ga0307469_103137451 | 3300031720 | Hardwood Forest Soil | SEVVRGEYQINKRWSVSTTRDQVGGVAVDGRLHTRF |
| Ga0307477_103639323 | 3300031753 | Hardwood Forest Soil | TDVSQPGNEMVQGEYQINKRWSVSMSRDQLGGVSVDGRYHRRF |
| Ga0307475_105037602 | 3300031754 | Hardwood Forest Soil | QPGSEIVQGEYQINKRWSVSATRDQVGGVAVDGRLHTRF |
| Ga0307478_102810141 | 3300031823 | Hardwood Forest Soil | EIVQGDYQINQRWSVSLTRDEVGGVSVDGKYHTKF |
| Ga0318520_106462541 | 3300031897 | Soil | TKDLLFSFSTDVSQPGSEIIQGEYQINKRWSVSVSRDELGGFSVDGRYHKRF |
| Ga0306923_107233661 | 3300031910 | Soil | GFSTDLSQPGSEIVQGEYQVNKRWPVGTSRDQLGGVSIDGRYDTRF |
| Ga0306926_101544481 | 3300031954 | Soil | STDVSQPGSEIIQGEYQINKRWSVSVSRDELGGFSVDGRYHKRF |
| Ga0307479_121169882 | 3300031962 | Hardwood Forest Soil | TKNLLFTFSTDVSQPGSEIVQGEYQLNKRWSVSMARDQLGGVSVDGKYRKNF |
| Ga0335079_113843231 | 3300032783 | Soil | STDVSQPESEIVQGEYQINRHWSVSVARDQIGGISIDGRFHTKF |
| Ga0335078_102360243 | 3300032805 | Soil | EQEIVQGEYQINKRWSVSATSDQLGGVTVDGRYHTRF |
| Ga0335078_102471511 | 3300032805 | Soil | VTQPGSEIVQGEYQINKRWSVSMERDQLGGVSVDGRYHTRF |
| Ga0335080_116798273 | 3300032828 | Soil | TFSTDVTQPGSEIVQGDYQINRRWSVSVARDQLGGVSVDGRFHTQF |
| Ga0335081_106582991 | 3300032892 | Soil | FTFSTDVTQPGTEVIQGDYQINRRWSVSVARDQQGGVSVDGQYHTKF |
| Ga0335077_110202781 | 3300033158 | Soil | NLLFSFSTDVTQPGSEIVQGEYQINKRWSVSMERDQLGGVSVDGRYHTRF |
| Ga0335077_121614102 | 3300033158 | Soil | KNFLFTFSTDVAQPGNETVQGEYQINKRWSVSMARDQLGGVSVDGRYHTRF |
| Ga0370515_0164360_835_948 | 3300034163 | Untreated Peat Soil | GSEIVQGDYQINKRWSVGVTRDEVGGVSVDGKYHTKF |
| ⦗Top⦘ |